Bos taurus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119874925|ref|XP_583818.3| PREDICTED: chloride intracellular channel 6-like [Bos taurus]
    MAGVAELDGGAPRPRSPSGGPALQAERRDEPEAAGPKAQREEAREGPAEAPGGEGAGAAATAAGPEGEGPGPAGGRAGGL
    EPGSGGGPGAETRGGSGAQGQAEAGEDAREGEGPTSGAEPEEEASPGPGAQGEEPGEVQAGPRDPAALNAKEEAGNGPGE
    PAGSAPGASGARVDAPESVGESVVAEGSMGALVDAPESVGNSVDSEGSVGARVDAEGPAGESVGAEESMADSTDVGGPTG
    ASTDVGVPTAGAQGSEGESRDGGDSKSQSQAEAIEAPAPESAECTPGELARGPRGSAEETGDPEGEEAGEAAPGDARAEA
    SEEADQDGPSGQEEEAEEERPEQGLQGPGEEATAGGEEESPDGTAAGEAIQPAEVGEPQADLSNHLADERSAERGGGIVP
    ENGGQEGGEASEEGAPGQDHDITLFVKAGCDGESIGN
    CPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPF
    MTFDGEVKTDVNKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYERNLLKALKKLDSYLNS
    PLPDEIDAYSTEEAAISGRKFLDGNELTLADCNLLPKLHIIKIVAKRYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPAD
    QEIEHAYSDVAKRMK

    >gi|114052625|ref|NP_001039556.1| protein disulfide-isomerase A5 precursor [Bos taurus]
    MARVVPAWLLLPLAVWVVLPTWLSSAKFSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAAESHLKLLSTVAQAVKGQG
    TICWVDCGDAESRKLCKKMKVDLSAKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHIDN
    EKDFRRLLKKEEKPILMMFYAPW
    CSVCKRIMPHFQKAATQLRGQFVLAGMNVYPSEFENIKEEYSVRGYPTICYFEKGRF
    LFQYDSYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLSDEDFDQFVKEHSSVLVMFHAPW
    CGHCKKMKPEFESA
    AEVLHGEGDSSGVLAAVDATVNKALAERFHIAEFPTLKYFKNGEKYAVPALRTKKSFIEWMRNPESPPPPDPAWEEQQTS
    VLHLSGDNFRETLKRKKHALVMFYAPW
    CPHCKKAIPHFTAAADAFKDDRKIACAAIDCVKENNKDLCQQEAVKAYPTFHY
    YHYGKFVEKYDTNPTELGFTSFIRTLREGDHERLGKKKEEL

    >gi|115497932|ref|NP_001069083.1| thioredoxin domain-containing protein 6 [Bos taurus]
    MGSKKKEIALQVNVSTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRVEVGPDLLHFASAEADCLDVLERYRGK
    CEPTFLFYAGGELVAVVRGANAPLLEKTIREQLEAEKRVLAEGRERRVIKDEALSDEDECFSHEKNNGDDEDLVSSEKAC
    TLAIIKPDAVVHGKTDEIIMKIQEAGFDILTNEERTMTEAEMRLFYQHRAGEDTFEKLVHHMCSGPSHLLILARTEGTED
    VVTAWRTLMGPCDPHVARREQPDSLRAQYGTEMPFNAVHGSWDSEDARRELALLFPGFQFSDQIPESAPLGHEAEGAEGP
    NKMLCSPEDVDEAARDQSEATS

    >gi|149642569|ref|NP_001092591.1| DnaJ (Hsp40) homolog, subfamily C, member 10 [Bos taurus]
    MGVWLNKDDYVRDLKRVMLFFLVMYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKV
    NRAYEVLKDEDLRKKYDKYGEKGLADNQGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CSH
    CHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLMNFAMQHVRSTVTEL
    WTGNFVNSIQTAFAAGIGWLITFCSEGSDCLTSQTRLRLSGMLDGLVNVGWVDCATQDNLCKSLDITTSTTAYFPPGATL
    NNKEKSGILFLSSLDAKEIYLEIMHNLPDFELLSANSLQDRLAHHRWLLFFQFGQNENSNDPELKKLKTLLKNEHIQIGK
    FDCSSAPDVCSNFYVFQPCLAVFKGQGTKEFEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANEKEPWLVDFFAPW
    C
    PPCQALLPELRKASKHLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFVEDLMNPSVIS
    LTPTTFNELVKQRKHDGVWMVDFYSPW
    CHPCQVLMPEWKRMARTLIGLINVGSIDCQQYHSFCAQENVRRYPEIRFFPQK
    SNKAYEYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVLQGKNHWVVDFYAPW
    CGPCQNFAPEFELLARTLKGK
    VKAGKVDCQAYAQTCQKAGIRAYPTVRLYPYERAKRNTWGEQIDSRDAKEIATLIYEKLEKLQNHEKRDKDEL

    >gi|122692293|ref|NP_001073687.1| chloride intracellular channel protein 4 [Bos taurus]
    MALSMPLNGLKEEDKEPIIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITF
    NNEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLP
    DEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV
    EIAYSDVAKRLTK

    >gi|144953871|ref|NP_001029931.2| 15 kDa selenoprotein precursor [Bos taurus]
    MAARRDGWLGPAFGLRLLLATVLQTVSALGAEFSSESCRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETK
    KLYAGAILEVCG
    CKLGRFPQVQAFVRSDKPKLFKGLQIKYVRGSDPVLKLLDDSGNIAEELSILKWNTDSVEEFLSEKLE
    RI

    >gi|155371955|ref|NP_001094583.1| glutathione peroxidase 7 precursor [Bos taurus]
    MVAARAAAWLLLAAAACAPREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNV
    LAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTETSGKEPTWNFWKYLVAPDGKVIGAWDP
    TVSVEEIRPQITALVRKLILKKREDL

    >gi|62751458|ref|NP_001015536.1| thioredoxin domain-containing protein 12 precursor [Bos taurus]
    MELRPRLGATCLLGFSFLLLVTSSHGPNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAEST
    EISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVRPEIINENGNPSYKYFYISAEQVVQGMKEAQERLTG
    DAFREKHLEDEL

    >gi|27806081|ref|NP_776856.1| peroxiredoxin-1 [Bos taurus]
    MSSGNAKIGHRAPQFKATAVMPDGQFKDISLADYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLISAPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|194665910|ref|XP_001790138.1| PREDICTED: similar to magnesium transporter 1 [Bos taurus]
    MEECWWLRHVSLTVVALMFMTPEASAHPDQGQKVLEEKVRQLMDWTKRDRVMRMNTAAFNHFVLEKPRNYSVIAMFTALQ
    RFRS
    CAPCKLAVEEFQVLAGSWQFSSAFSNKVFFAMLDFDESPEVFKTLQVKGGPVVLHLPAKSEFTADDIYNFQVRDIS
    AQHMFTWVDDRTGRWMGNFTTRQPIHFHYPFKLGISVALIGGLVYVLKWKRTFIFSKNFWAVLALCFVILMSSGRMWIHI
    RGAPFAESKTHTGQTHYIQDTYFFQYVAEMYIISLFYMCITLGMVLLSTAATSRMNIIRRKIMSVTGMCLLVIFFSWLLS
    LVRLKYHVYPFRILMN

    >gi|194665187|ref|XP_583261.3| PREDICTED: thioredoxin reductase 3 [Bos taurus]
    MACVWSLREENAGAFSLQVKELFSSLGVDCNILELDQVDEGASVQEALSEITSQRTVPSVFVNRVHVGGCDHTFQAHQSG
    LLQQLLQQDPAYDYDLIVIGGGSGGLSCAQEAAVLGRKVMVLDFVVPSPRGTAWGLGGT
    CVNVGCIPKKLMHQAALLGQA
    LTDSRKFGWEYSQQVRHSWATMTEAIQSHIGSLSWGHRLALREKAVTYVNSFGEFVEHHKVKATNEKGQEVLYTAAKFVI
    ATGERPRYLGIPGDREY
    CITSDDLFSLPYCPGATLVVGASYVALECAGFLAGLGLEVTVMVRSVLLRGFDQEMAEKVGAS
    MQQLGVRFLRKFVPVEVQQLERGLPGRLKVVAKSTEGTETIEGIYNTVLLAIGRDSCTKKLGLEKIGVNVSEKTGKIPVN
    DEEQTSVSYVYAVGDVLEGKPQLTPVAVQAGKLLARRLFGGRSEKCDYVNVPTVVFTPLEYGCCGYSEEKAGEVYQAENL
    NVYHTLFWPLEWTVAGRDNNTCYAKIICNKLDNDRVIGFHVLGPNAGEITQGFAAAMKCGLTKQLLDDTIGIHPTCGEVF
    TTLEITKASGLDITQKGC

    >gi|94966801|ref|NP_001035590.1| anterior gradient protein 2 homolog [Bos taurus]
    MEKIPVSAFLLLVALSYTLAKDTTVKPGAKKDTKDSQLKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDE
    CPHSQALKKAFAENKEIQRLAEQFVLLNLVYETTDKHLSPDGQYVPRILFVDPSLTVRADITGRYSNRLYAYEPSGTALL
    LDNMKKALKLLKTEL

    >gi|297465809|ref|XP_002704095.1| PREDICTED: anterior gradient homolog 3-like [Bos taurus]
    MMSHSVLVLCLLSITVSSNLAIAIKREKRPPQTLSRGWGDDITWVQTYEEGLFHTQKSNKPLMVIHHLEDCQYCQALKKV
    FAQNKEIQEMAQNNFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPLLIENMKKALK
    LIQSEL

    >gi|76615127|ref|XP_870811.1| PREDICTED: dihydrolipoamide dehydrogenase isoform 2 [Bos taurus]
    MQSWSRVYCSLVKRGHFSRISHGLQGVSVVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTC
    LNVGCIPSKALLNNSHFYHLAHGKDFASRGIEMSEVRLNLEKMMEQKSNAVKALTGGIAHLFKQNKVVHVNGYGKITGKN
    QVTATKADGSTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVT
    AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTQ
    NLGLEELGIELDTRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVA
    WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
    ARVCHAHPTLSEAFREANLAASFGKSINF

    >gi|114053199|ref|NP_001039700.1| thioredoxin domain containing 3 [Bos taurus]
    MAGKKREIQLQAVINNQSLRDEMMQNKGLTVIDVYQAWCGPCKAMQTLFRKLKNELNEDELLHFAVAEADSIVTLQPLRD
    KCEPVFLFSVNGTIVAKIQGANAPLVNQKIIALVNEERKIAAGEMVRPQYHEIAFVDSDSEDAGELNYESVDQIYTIVII
    KPDAVAARKVQEIKEKINKAGFVIEAEDKKPLTEEQVKHFYSQIVDQPDFEDFVSFMTRNLSYILVVSQAKAKQPSWDES
    EVNSETESKEPWDEQQEMAKPSRMKERKSLQQYLEIQQISQFCDVEENITNTKFIDVLIPDFKKIRGIKFEKILALLRPA
    LANERTEDVLNKIQDEGFKILLQRQIVLSEEEAKTLCKEYENKDYFGNVIENMTSGPSLALVLVRENGLGHWKQLIGPSN
    VEEAKEYLPE

    >gi|119891132|ref|XP_001249843.1| PREDICTED: 3-mercaptopyruvate sulfurtransferase-like [Bos taurus]
    MVLQRLLPWSTCWTIFGSAEAALWGLKSIKRSCLSFCTAICEGVTYKELKNLLKSKKIMLIDVREPWEIYESGKIPGSVN
    IPLDDVGEALQMNPKDFKENYKEVKPSKSDSLVFS
    CLAGVRSKVAMVTAISLGFNNAQHYAGGWKEWATYELSEKKQGN

    >gi|114326226|ref|NP_001039344.1| protein disulfide-isomerase A4 precursor [Bos taurus]
    MRPRKAWMLVLLLALVQLLAVASAGAPDEDSTDKEDAIEEDEEEDEDDDDDDDDLEVKEENGVLILNDANFDNFVADKDT
    VLLEFYAPW
    CGHCKQFAPEYEKIAATLKENDPPIPVAKIDATSESALASRFDVSGYPTIKILKKGQEVDYEGSRTQEEIV
    AKVKEVSQPNWTPPPEVTLVLTKDNFDEVVNDADIILVEFYAPW
    CGHCKKLAPEYEKAAKELSKSSPPIPLAKVDAIAET
    DLAKRFDVSSYPTLKIFRKGKAFSYNGPREKYGIVDYMMEQSGPPSKQILALKQVQEFLKDGDDVIIIGVFKSESDPAYQ
    LYQDAANSLREDYKFHHTFSTEIAKFLKVSLGKLVVMQPEKFQSKYEPKSYVMDIKDSTEAAAITEHVVKHTLPLVGHRK
    AADAKRYTRRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFPEYTFAVADEEDFATELKDLGLSESGEEVNAAILDEG
    GRRFAMEPDDFDADALRDFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPW
    CGHCKQLE
    PVYTSLGKKYKGHKNLVIAKMDATANDVTSDRYKVEGFPTIYFAPSGDKKKPIKFEDGNRDLEHLSKFIEEHATKLSRTK
    EEL

    >gi|119925464|ref|XP_001249763.1| PREDICTED: methyltransferase like 7A-like isoform 1 [Bos taurus]
    MALTIFILWLAVCILAFPMYLLDFLGLWNWICKQWFPYFLARFTVMYNKQMESKKQELFSNLREFMGPSGKLSLLELGCG
    TGANFKFYPSGCQVTCVDPNPNFEKFLIKSIAQNRHLQFERFIVAAGENMHQVASGSMDVVVCTLVLCSVKNQEQILQEV
    CRVLRPGGAFYFMEHVADKPSTWNYFWQQVLDPVWYLLFDG
    CNLTRESWKALEKARFSKLKLQHLQAPLSWELVRPHIYG
    YAVK

    >gi|78369268|ref|NP_001030516.1| methyltransferase like 7A [Bos taurus]
    MALTIFILRLAVCILAFPMYLLDFLGLWNWICKQWFPYFLARFTVMYNKQMESKKQELFSNLREFMGPSGKLSLLELGCG
    TGANFKFYPSGCQVTCVDPNPNFEKFLIKSIAQNRHLQFERFIVAAGENMHQVASGSMDVVVCTLVLCSVKNQEQILQEV
    CRVLRPGGAFYFMEHVADKPSTWNYFWQQVLDPVWYLLFDG
    CNLTRESWKALEKARFSKLKLQHLQAPLSWELVRPHIYG
    YAVK

    >gi|119892367|ref|XP_875267.2| PREDICTED: methionine sulfoxide reductase B3 isoform 4 [Bos taurus]
    MSPRRTLPRPFLLCLCLSLCLAAAAARGAVQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKD
    PGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CIN
    SASLSFSPAESSGAQGDSAGGSPAPGDKTEL

    >gi|119892369|ref|XP_001250066.1| PREDICTED: methionine sulfoxide reductase B3 isoform 1 [Bos taurus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVINSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFS
    PAESSGAQGDSAGGSPAPGDKTEL

    >gi|119892371|ref|XP_001250113.1| PREDICTED: methionine sulfoxide reductase B3 isoform 2 [Bos taurus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVINSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFS
    PAESSGAQGDSAGGSPAPGDKTEL

    >gi|119892373|ref|XP_001250169.1| PREDICTED: methionine sulfoxide reductase B3 isoform 3 [Bos taurus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVINSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFS
    PAESSGAQGDSAGGSPAPGDKTEL

    >gi|27807129|ref|NP_777050.1| thioredoxin reductase 1, cytoplasmic [Bos taurus]
    MNGSKDLPEPYDYDLIIIGGGSGGLAAAKEAAKYDKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQAL
    RDSRNYGWNVEETVKHDWERMTEAVQNHIGSLNWGYRVALREKKVTYENAYGEFVGPHRIKATNNKGKEKIYSAERFLIA
    TGERPRYLGIPGDKEY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
    QEHGIKFIRQFVPIKVEQIEAGTPGRLRVIAKSTDSDQTIEGEYNTVLLAIGRDACTRKIGLENVGVKINEKTGKIPVTE
    EEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYENVPTTVFTPLEYGSCGLSEEKAVEKFGEENVE
    VYHSYFWPLEWTIPSRDNNKCYAKVVCNIKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKDQLDSTIGIHPVCAEVFT
    TLSVTKRSGGNILQTGC
    CG

    >gi|27806369|ref|NP_776633.1| thioredoxin, mitochondrial precursor [Bos taurus]
    MAQRLLLRRFLTSIISGKPSQSRWAPVASRALKTPQYSPGYLTVTPSQARSIYTTRVCSTTFNIQDGPDFQDRVVNSETP
    VVVDFHAQW
    CGPCKILGPRLEKVVAKQHGKVVMAKVDIDDHTDLALEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAF
    LKKLIG

    >gi|29135275|ref|NP_803455.1| thiosulfate sulfurtransferase [Bos taurus]
    MVHQVLYRALVSTKWLAESVRAGKVGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDKASPYEVMLPSEAG
    FADYVGSLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATLNRS
    LLKTYEQVLENLESKRFQLVDSRAQGRYLGTQPEPDAVGLDSGHIRGSVNMPFMNFLTEDGFEKSPEELRAMFEAKKVDL
    TKPLIAT
    CRKGVTACHIALAAYLCGKPDVAIYDGSWFEWFHRAPPETWVSQGKGGKA

    >gi|77735535|ref|NP_001029463.1| 3-mercaptopyruvate sulfurtransferase [Bos taurus]
    MASKQLFRALVSAQWVAEALRAPQAGQPLRLLDASWYLAKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPSAA
    HFSEYAGRLGVGAATHVVVYDASDQGLYAAPRVWWMFRVFGHRTVSLLDGGLRNWLRQGLPLSSGKSRPQPAEFHAVLDP
    AYIKTYEDIKENLESRRFQVVDARAAGRFRGTEPEPRDGIEPGHIPGTINIPFTDFLTEDGLEKSPEEIRRLFQDKKVDL
    SLPLVAT
    CGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRAQPEDIISEGRGKIH

    >gi|94966897|ref|NP_001035641.1| phosducin-like protein 2 [Bos taurus]
    MQDPNEDTEWNEILRDFGILPPKEEPKDEIEEMVLRLQKEAMVKPYEKMTLAELKEAEDEFDDEDMKAIEIYREKRLQEW
    KALKKKQKFGELREISGNQYVNEVTNAEKDVWVIIHLYRSSIPL
    CLLVNQHLSLLARKFPETKFVKAIANSCIEHYHDNC
    LPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENPKKAIVDVMVSSIRNTSIYGDSDSSNSDSED
    TK

    >gi|134085866|ref|NP_001076907.1| ubiquitin-like modifier-activating enzyme 6 [Bos taurus]
    MEGSLPVAARPGEEASCSSWRTSRANTNFSIMPTESVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNL
    VLAGIKALTIHDTEKCQAWDLGTNFFLCEDDVVNIRNRAEAVLQHIAELNPYVHVTSSSIPLNETTDLSFLDKYQCVVLT
    EMKLSVQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISDITQANPGIVTCLENHPHKLE
    TGQFLTFREINGMTGLNGSTQQITVVSPFSFSIGDTTELEPYLHGGIAIQVKTSKTFCFESLEMQLKHPKYLIVDFSKPE
    APLEIHLAMLALDQFQENYSRKPNIGCQQDSEELLKLATSISETLEEKPEVNYDIVRWLSWTAQGFLPPLAAAVGGVASQ
    EVLKAVTGKFSPLCQWLYIEAADLVESLSKPERQEFLPRGDRYDALRACIGATLCQKLQNLNIFLVGCGAIGCEMLKNFA
    LLGVGTGKQKGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPKSCTAADATLKINPQLKIDAHLNKVCSATEAIYNDEFYTK
    QDIIITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPF
    CTLKSFPAAIEHTIQW
    ARDKFESSFSQKPSLFNKFWQTYPSAEEVLQKIQTGHSLEGCFQVIKLLSRRPRNWSQCVELARLKFEKYFNHKALQLLH
    CFPLDTRLKDGSLFWQSPKRPPSPLKFDLNEPLHFSFLLNAAKLYATIYCIPFTEEDLSADTLLNILSEVKIQEFKPSDK
    VVQTDETARKPDQVPVSSEDERNAIFQLEKAIASNEATTSDLQMAVLSFEKDDDHNGHIDFITAASNLRAKMYSIEPADR
    LKTKRIAGRIIPAIATSTAAVSGLVALEMIKVAGDYPFEAYKNCFLNLAIPIIVFTETSEVRKTEIRNGISFTIWDRWTI
    HGKEDFTLLDFINAVIEKYGIEPTMVVQGVKMLYVPIVPGHAKRLKLTMHKLVKPSAEKRYVDLTVSFAPDVDGDEDLPG
    PPVRYYFSHDTDEQKLS

    >gi|198282123|ref|NP_001094721.1| gamma-interferon-inducible lysosomal thiol reductase [Bos taurus]
    MASSPLLFVLLLLLPLEVPAATRWSLLEALPEGAAPCQVGELCLQASPQKPDVPLVNVSLYYEALCPGCREFLIRELFPT
    WLMVLEILNVTLVPYGNAQERNVSGKWEFTCQHGERECLLNKVEACLLDQLEQKIAFLTIVCLEEMDDMEQNLKPCLQIY
    APKVSADSIMECATGNRGMQLLHINAQLTDALRPPHKYVPWVVVNGEHMKDAEHLLHLVCRLYQGQKPDVCQLTAELSKE
    VHFK

    >gi|27807469|ref|NP_777188.1| peroxiredoxin-2 [Bos taurus]
    MACVCKAHVGKPAPEFQATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIVAFSDRAAEFHKLNCEVLGVSVDS
    QFTHLAWINTPRKEGGLGPLNIPLLADVTRKLSSDYGVLKEDEGIAYRGLFVIDGKGVLRQVTINDLPVGRSVDEALRLV
    QAFQYTDEHGEVCPAGWTPGSDTIKPNVDDSKEYFSKHN

    >gi|76623090|ref|XP_602222.2| PREDICTED: thioredoxin domain containing 15-like [Bos taurus]
    MAPSAAASCQDGDAGPRPRSRPLLPQPSSAGERESRRCAPVALRPGCTGRCPPRTMRLIGWWQVLLWVLGSPARAEEIAE
    KRSHLWSEEQPAYPFQVGAVYMNEEVPSPDPVGQDPSAEETEAVLGLDADGNHMVMLSVIPGGAEDKLSPESSSGTCGAG
    GEEGSRCNLRESLFSLDRAGARFSEREEEYYTEPDVAESDPTPTEDANTTESLKSPKVNCEERNVTGLENFTLKILNMSQ
    DLMDFLNPNGSDCTLVLFYTPW
    CRFSASLAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARF
    NHTDRTLETLKIFIFNQTGIEAKKNVVVTQADQIGPLPSTLIKSVDWLLVFSLFFLISFIMYATIRTESIRWLIPGQEQE
    HAE

    >gi|27806537|ref|NP_776539.1| peptide methionine sulfoxide reductase [Bos taurus]
    MLSVTRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKF
    WTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIY
    PTSAEHVGAALKSKEDYQKVLSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK

    >gi|297458622|ref|XP_002684288.1| PREDICTED: endoplasmic reticulum resident protein ERp44-like [Bos taurus]
    MIPGIFLSLPDLRCSLLLLVTWVFTPVTAEIISLDTENIDDILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEEYP
    NANQVVFARVDCDQHLPKSLRFVVLLHCVLVVSPIVMSVLQRQELLALFLNLSFVTKWRPN

    >gi|77735891|ref|NP_001029642.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor [Bos taurus]
    MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

    >gi|115497672|ref|NP_001069904.1| hypothetical protein LOC616897 [Bos taurus]
    MAAPSEAPVTRQVSGHAAPAPVPSGPASWQPLAAAVAELPVLDASGRPVLFGELFRERRAIVVFVRHFLCYICKEYVEDL
    AKIPKSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHVKSNILSGSIRSL
    WRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHHDRNRLDHKPINSVLQLVGVQHVDFTSRPSVIHV

    >gi|194669674|ref|XP_608747.4| PREDICTED: nucleoredoxin-like 2-like [Bos taurus]
    MVDVLGGRRLVTCDGAWVEAEAALQNKVVALYFAAGRCAPSRDFTPLLCDFYEELVDEARPPAPFEVVFVSADGSAQEML
    EFMKELHGAWLALPFHDPYRHELRTRYHITAIPRLVILKPSGEVITDKGRKQIRERGLACFQNWVEAADIFQNFSS

    >gi|27806783|ref|NP_776393.1| thioredoxin [Bos taurus]
    MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVAAECEVKCMPTFQFF
    KKGQKVGEFSGANKEKLEATINELI

    >gi|118151438|ref|NP_001071628.1| thioredoxin domain-containing protein 8 [Bos taurus]
    MVQNIRDMDELKAFLKAAGNKLVVIEFSAKWCGPCKRIYPVFHAMSVQYRSVMFANVDVDNARELAQTYHIKAVPTFQLF
    KQTKKIFEL
    CGADAKKLEEKIREFM

    >gi|158519819|ref|NP_001103564.1| hypothetical protein LOC782657 [Bos taurus]
    MVLQRLLPWSTCRTIFGSAEAVLWGLKSIKRSCLNFCTAICEGVTYKELKNLLKSKKIMLIDVREPWEIYESGKIPGSVN
    IPLDDVGEALQMNPKDFKEKYKEVKPSKSDSLVFS
    CLAGVRSKVAMVTAISLGFNNAQHYAGGWKEWATYEISEKKQGN

    >gi|157074206|ref|NP_001096818.1| ERO1-like protein alpha precursor [Bos taurus]
    MGRRWGFLIGFLVAVGLLGLGHGEQQPSETAAQRCFCQVSGYLDDCTCDVETIDKFNNYRLFPRLQKLLESDYFRYYKVN
    LKRPCPFWNDINQ
    CGRRDCAVKPCHSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDD
    SSDNFCEVDDIQSPDAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGKSEENTFYSWLEGL
    CVEKRAFYRLISGLHASINVHLSARYLLQDTWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVVP
    FFERPDFQLFTGNKDQDAENKMLLLEILHEIKSFPLHFDENSFFAGNKKEANKLKEDFRLHFRNISRIMDCVGCLKCRLW
    GKLQTQGLGTALKILFSEKLIANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH

    >gi|115494922|ref|NP_001068853.1| thioredoxin-related transmembrane protein 1 precursor [Bos taurus]
    MAPSGSLRIPVAVLLLLLWGAPWAHGKRSDVRIITDENWRELLEGEWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNV
    AKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSILMSSMSALFQLSM
    WIRTCHNYFIEDLGLPIWGSYTVFALATLLSGLLLGLFMIFVADCLCPSKRRRPQPYPSRKLLPESSQPLKKVEEEQEAD
    VEDVSEEESESKEGANKDFAQNAVRQRSVGPSLATDKS

    >gi|84579857|ref|NP_001033772.1| iron-sulfur cluster assembly 2 homolog, mitochondrial precursor [Bos taurus]
    MAAVRGLTAVALRVVTPWQRSRLLAASRGPRALREVSFSSPEAGEGQIHLTDSCVQRLLEITEGSEFLRLEVEGGGCSGF
    QYKFSLDTVINPDDRVFEKGGARVVVDSDSLAFVKGAHVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSVKL

    >gi|115496802|ref|NP_001069154.1| maleylacetoacetate isomerase [Bos taurus]
    MAESSKPILYSYFRSSCSWRVRIALALKNIDYETVAINLTKDGGQQFSGEFQALNPMKQVPALKIDGITIGQSLAIIEYL
    EETRPTPRLLPWDPKKRAQVRMVSDLIASGIQPLQNLSVLKQVGQENQLTWAQQAITSGFNALEQILQSTAGRYCVGDEV
    SMADLCLAPQVANADRFKVDLTPYPTISRINKSLLALEAFHVSHPCRQPDTPPELRA

    >gi|297460111|ref|XP_589324.4| PREDICTED: PDIA6 protein-like [Bos taurus]
    MARLVLGLMSCTLFITVNRLYSSSDDVIELTPSNFNREVIQSYSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGA
    VDADKHQSLGGQHGVQGFPTIKIFGSNKNKPEDYQGGGTGEAIVDAALSALCQLVKERLGGRGRGYSSGKQGRGDSSSKK
    DVIELTDDNFDKNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDASVNQVLASRYGIRGFPTI
    KIFQKGESPVDYDGGRRRSDIVSRALDLFSDNAPPPELLEIINEDVAKKTCEEHQLCVVAVVPHILDTGAAGRNSYLEVL
    LKLADKYKKKMWGWLWTEAGAQSEPENTLGIGEFGYPAMAAINAREMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGG
    GAFPTISTREPWDGKDGELPVEDDIDLSDVELDDLEKGEL

    >gi|115497424|ref|NP_001069617.1| thioredoxin domain-containing protein 9 [Bos taurus]
    MEANASVDMFSKVLENQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLEALKKAQQQKQEWLSKGHGEYREIPSER
    DFFQEDKESKKVVCHFYRDSTFR
    CKILDRHLVILSKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDFVVG
    FSDLGNTDDFTTETLEWRLGCSDILNYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

    >gi|115497192|ref|NP_001069113.1| phosducin-like protein 3 [Bos taurus]
    MQDPNADTEWNDILRKKGILPSKEDLKDLEKEAEEEEQRILQQSIVKTYEDMTLEELEDNEDEFNEEDERAIEMYRQQRL
    AEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPL
    CALINQHLSALARKFPDVKFIKAISTTCIPSYP
    DRNLPTVFVYLEGDIKAQFIGPLVFGGMNLTLDELEWKLSESGAIKTSLEENPKKPVEDVLLSAVRCSVPAKRDSDSEDD


    >gi|168693644|ref|NP_001068725.2| ethanolaminephosphotransferase 1 [Bos taurus]
    MASYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTVVKVFPTWLAPNLITFSGFLLVVFNFLLLAYFDPDFYASAP
    GHKHVPDWVWIVVGILNFMAYTLDGVDGKQARRTNSSTPLGELFDHGLDSWSCVYFVVTVYSIFGRGSSGVSVFVLYLLL
    WVVLFSFILSHWEKYNTGILFLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIFGCALCVTLPMSLL
    NFFRSYKNNTLKHNSVYEAVVPFFSPCLLFILSTAWILLSPSDILELHPRVFYLMVGTAFANSTCQLIVCQMSSTRCPTL
    NWLLLPLFVIVMVVNVGVTPYVESILLFTLTAAFTLAHIHYGVRVVKQLSNHFHIYPFSLRKPNSD
    CLGVEEKNIGL

    >gi|119903961|ref|XP_879975.2| PREDICTED: protein disulfide isomerase family A, member 6 isoform 7 [Bos taurus]
    MKEGKGLVRSEWGKDRTVRIREKNNTNDFTPKKNKYGKAGLWVREAQGWGAGRTAGLPRPPASPSFRPSPPPPQKPKPVT
    STRPPLIGYANERSLPGPISRGHGLASVFRPASAAPPRAYLASRGRYEGRWGRGAAVRRRLECVAARALSMARLVLGLMS
    CTLFITVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPW
    CGHCQRLTPEWKKAATALKDVVKVGAVDADKHQSLG
    GQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNF
    DKNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPV
    DYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKK
    MWGWLWTEAGAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTISTRE
    PWDGKDGELPVEDDIDLSDVELDDLEKDEL

    >gi|262118224|ref|NP_001160026.1| prostaglandin E synthase 2 [Bos taurus]
    MAHAVRALWPHGRALAWRLGDRPALGLHAQSRAGFTGAAGGSGPAATARKGGPRLLGAAALALGGALGLYHTARWHLRAQ
    DLRAERSATQLSLSSRLQLTLYQYKT
    CPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPIVMAQEGESLQQLN
    DSSVIISALKTYLVSGQPLADIITYYPPMKAVNDQGKEVTEFCNKYWLMLDEKEAQRMYGGKEARTEEMKWRQWADDWLV
    HLISPNVYRTPAEALASFDYIVKEGNFGTVEGAMAKYMGAAAMYFISKRLKRRHHLRDDVREDLYEAANKWVAAVGKDRP
    FMGGQKPNLADLAVYGVLRVMEGLEAFDDLMRHTHIQPWYLRVEKAIAEAPQ

    >gi|297460188|ref|XP_002700926.1| PREDICTED: quiescin Q6 sulfhydryl oxidase 2 [Bos taurus]
    MTCSQGSARPGPLGSSCSGTALLPCVCPTASPPASPAGCPQARRGASEDWAAAIRVAALDCAEEKNQEVCRAYDIHFYPT
    FRYFKAFTKDFTTGENFKGPDRELQTVRRTMINFLQNHTDGNRPPACPSLDPIRPSDVLSLIDKRGDRYVAVLLEDDSSY
    VGREVILDLIPYESIEVRRALGSDTAFLQKLGVPSLPSCYLIYPNGSHGPVTVGKPLRSFFSSYLRSLPGVRKKPGSLPG
    RPSRDESSEAVVWRDFDRSKLYTADLESGLHHLLRVELAAHRSLAGAELKTLKDFITVLAKLFPGRPPVRKLLEMLQEWL
    ASLPLDRIPYDAVLDLVNNKMRISGIFLTNHIKWVGCQGSRPELRGYSCSLWKLFHTLTVGAGTHPKALDGTGLEDDPQA
    VLQTIRRYVHVFFG
    CKECGEHFEEMAKESIDSVKTPDQAILWLWKKHNLVNSRLAGHPSEDPKFPKVPWPSPDLCPACHE
    EIKGLGTWNEGQVLLFLKQHYGRDNLVDTHSADLGGPGEGAPAPGEKQEGSQAPPEQPPADHGAESLRPPSLLPPRAHLS
    ERSQPGLDLLLGSXGRGARAAGGAEAAAAFLGMGFSSLDMSLCVVLYVASSLFLMVMYFFFRVRSKRWKVKHHHPSV

    >gi|154152117|ref|NP_001093771.1| chloride intracellular channel protein 3 [Bos taurus]
    MAEAGKLQLFVKASEDGESVGHCPSCQRLFMILLLKGVPFTLTTVDTRRSPEVLKDFAPGSQLPILLCDGDAKTDTLQIE
    EFLEETLGPPEFPSLAPRYRESTAAGNDVFHKFSAFIKNPVPAQDDALYQQLLRALAKLDSYLRAPLEHELGREPQLRES
    RRRFLDGDQLTLADCGLLPKLHVVNTVCAHFRQAPIPAELRGLRRYLDCALQEKEFKYTCPHSAEILAAYRPVVRPR

    >gi|119920795|ref|XP_596258.3| PREDICTED: ATPase, Cu++ transporting, beta polypeptide-like [Bos taurus]
    MERAGDQTPGNPEPSSLATLGDPQVTLLSVHKQWSFKRSPGTGGSSRPVISEEECPPPSEEGEFSQKVLNGSEEISSKQI
    LSKLSQPAMKQSFAFDNNGYEDDLDGVRPSHTATGTINIVGMTCQSCVKSIEGRVSSLKGIVSIKVSLEQGSAEVRYVPS
    VVSLVQICHQIEDMGFQASVAEGKATSWPSRVSPASEAMVKLRVEGMTCQSCVSSIEGKIGKLQGVLRVRVSLSNQEAVI
    TYQPYLIQPQDLRDHITDMGFEAVIKNKVAPVSLGPIDVRRLQSTLSAAPPAPVNQNDNNSETPGGQGIPLHLRVDGMH
    C
    KSCVLNIEDNIGRLPGVQSIHVSLESRTAQVQYDPSLVSPGALQRAIEALPPGNFKVSLPNGVEGSGPDSRSPPASSAPC
    TVMLAIAGMTCKSCVQSIEGLISQRAGVHQISVFLAEGTAVVLYDPSRTHPEELRAAVEDMGFEASILAENCSSNHIGNH
    SSGSAVGHVAAGTPVPVQGGTPQPGELHTNHIPRQSPKSLPASTTVAPKKCFLQISGMT
    CASCVSNIERNLQKEPGILSV
    LVALMAGKAEVKYNPEAIQPLEIAKLIQDLGFEAAVMEDYTGSDGDLELMITGMT
    CASCVHNIESKLRRTEGITYASVAL
    ATSKAHVKFDPEIIGPRDIVKLIEEIGFRASLAQRIPNAHHLDHKVEIKQWKNSFLCSLVFGIPVMGLMIYMLIPSHEPQ
    STVLDHNVIPGLSILNLIFFILCTFVQFLGGWYFYVQAYKSLRHGMANMDVLIVLATSVAYVYSLVILVVAVAEKAERSP
    VTFFDTPPMLFVFIALGRWLEHVVKSKTSEALAKLMSLQATEATVVTLGEDNVIIREEQVPMELVQRGDIIKVVPGGKFP
    VDGKVLEGNTMADESLITGEAMPVTKKPGSMVIAGSMNAHGSVLVTATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRF
    SGYFVPFIIIISTVTLVVWIGIGFTDFGVVQKYFPVPSKGISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMVGTG
    VAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVSRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVTRYCK
    EELGTETLGCCTDFQAVPGCGISCKVSSVESILAQGERLQGPLTTHLNRVGSNPTETDAATQTFSVLIGNREWMRRNGLT
    VTSDVRDAMTDHEMKGQTAILVAIDGVLCGMIAIADSVKQEAALAVHTLKSMGVDVVLITGDNRKTARAIATQVGINKVF
    AEVLPSHKVAKVQELQNQGKRVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSRRTVWR
    IRLNLVLALIYNLIGIPVAAGVFIPIGVVLQPWMGSAAMAASSVSVVLSSLQLKCYRKPDLARYEAQAHGSMKPLSASQV
    SVRVGMDDRRRDSPRASAWDQVSYVSQVSLSPLKSDKLSRHSGAADDRGDKWSLLLNDRDEEQGI

    >gi|149642897|ref|NP_001092640.1| thioredoxin-related transmembrane protein 4 [Bos taurus]
    MAGGRRGPLFAALLAAWVVAVAEAEADLEQAALPPERSLVRPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWETFAK
    NGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGVYEDLQNYILEKKWQSVEPLTGWKSPASLTMSG
    MAGLFSISGKIWHLHNYFTVTLGVPAWCSYFFFVIATLIFGLLMGLVLVVISECFYLPLPRNLSEHSEQNLRSEEVHLTE
    QLQDVEEEKDDSNEEENKDSLVDDEDEKEDLGYEEEAEEEEEDGPAAGGDEEKSDARDPEPPREAREDEGSSEVGDDSLE
    QPRPAGTEALGDSLRQRRSQHADKGPSA

    >gi|119905252|ref|XP_869391.2| PREDICTED: methionine sulfoxide reductase B2-like [Bos taurus]
    MARLLRALRGLTLREAPGWAVRGRADCGGFRAGAGSPQAGCLIKRQPALSKSEWQKKLTPEQFHVTREKGTEPPFSGIYL
    NNKEPGMYHCVCCDSPLFSSEKKFCSGTGWPSFSEAHGTSGSDESNTGILRRADTSLGPARTEVVCKQCEAHLGHVFPDG
    PGPAGQRF
    CINSVALRFKPRKH

    >gi|115496754|ref|NP_001068784.1| selenide, water dikinase 1 [Bos taurus]
    MSARESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|126165218|ref|NP_001075203.1| adenylyltransferase and sulfurtransferase MOCS3 [Bos taurus]
    MAAREEVLALQAEVAQREEELSSLKQRLAAALSTGQESARSVPVSPLPPRAALSREEIRRYSRQLVLPELGMQGQLRLAA
    AAVLVVGCGGLGCPLAQYLTPATALDLVRRYDVVADCSDNAPTRYLVSDACVLAGRPLVSASALRFEGQLTVYHYGGGPC
    YRCVFPRPPPAETVTS
    CADGGVLGAVTGVLGCLQALEVLKTAAGLGPSYSGRLLLFDALRGDFRCIRLRRRRPDCAACGE
    RPTVTDLQDYESFCGSSATDKCRSLRLLSPEERISIMDYKRLLDSRSPHLLLDVRPQVEVDICRLPHALHIPLKSLERRD
    AESLKVLGEAIREGKQGAQEGASVPIYVICKLGNDSQKAVKILQSWADLDSLTVKDVVGGLMAWAAKIDGTFPQY

    >gi|255760061|ref|NP_001157564.1| selenoprotein H [Bos taurus]
    MASRGRKRKAEAALAAAAEKREKPAGGQEGGVEGPSVVIEHCTSCRVYGRNAAALSQALRLQAPELTVKVNPARPRRGSF
    EVTLLRADGSSAELWTGLKKGPPRKLKFPEPHVVLEELKKYLS

    >gi|94966843|ref|NP_001035613.1| glutaredoxin-2, mitochondrial precursor [Bos taurus]
    MYWRRAALVGTRLIPVRSSSAGRLEGPAGISGSGMGNSTSSSLGNAATAPVNQIQETISNNCVVIFSKTSCSYCTMAKNL
    FHDMNVNYKVVELDMLEYGSQFQDALHKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCHLKNSKREEL

    >gi|94966984|ref|NP_001035688.1| hypothetical protein LOC617001 [Bos taurus]
    MSTVDLARVGACVLKHAVTGEAVELRNLWQEQACVVAGLRRFGCMVCRWIARDLSNLKGLLDQHGVRLVGVGPEALGLQE
    FLDGGYFAGELYLDESKQFYKELGFKRYNSLSILPAALGKPVREVAAKAKAVGIQGNLSGDLLQSGGLLVVAKGGDKVLL
    HFVQKSPGDYAPLESILQALGISAEVGPSELPQCDEEACSR

    >gi|27807167|ref|NP_777068.1| peroxiredoxin-6 [Bos taurus]
    MPGGLLLGDEAPNFEANTTIGRIRFHDYLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKMIALSIDSVEDHL
    AWSKDINAYNGEEPTEKLPFPIIDDKNRDLAIQLGMLDPAEKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEI
    LRVIISLQLTAEKRVATPVDWKNGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

    >gi|119908611|ref|XP_001253172.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVDITAAGNTSEIQDYLQQLTGARTVPRVFIGQECI
    GGCTDLVNTHERGELLTRLKQIGALQ

    >gi|156120795|ref|NP_001095544.1| sulfhydryl oxidase 1 [Bos taurus]
    MGWCGRGSGPPPSRLLMLLSLLLAVRGAGAAPRSALYSSSDPLTLLRADTVRSTVLGSSSAWAVEFFASWCGHCIAFAPT
    WKALANDVKDWRPALNLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFSKTGSGTTLSVAGADVQTLRERLIDALESHSD
    TWPPACPPLEPARLEEITGFFARNNEEYLALIFEKEGSYLGREVTLDLSQHQGIAVRRVLNTERDVVNRFGVTNFPSCYL
    LSRNGSFSRVPALTESRSFYTTYLRKFSGSTSGAVQTTAAPATTSAVAPTVWKVADRSKIYMADLESALHYILRIEVGKF
    SVLEGQRLVALKKFMAVLAKYFRGRPLVQNFLHSMNDWLKKQQRKKIPYGFFKNALDSRKEGTVIAEKVNWVGCQGSEPH
    FRGFPCSLWILFHFLTVQAAQEGVDHPQERAKAQEVLQAIRGYVRFFFG
    CRECAGHFEQMASGSMHRVGSLNSAVLWFWS
    SHNKVNARLAGAPSEDPQFPKVQWPPRELCSACHNELRGTPVWDLDNILKFLKTHFSPSNIVLDFPSAGPGPWRGAERMA
    VIPKQLI

    >gi|262073120|ref|NP_001159999.1| phosducin [Bos taurus]
    MEKAKSKSLEEDFEGQASHTGPKGVINDWRKFKLESEDSDSVAPSKKEILRQMSSPQSRDDKDSKERFSRKMSVQEYELI
    HKDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELESGEQFLETIEKEQKITTIVVHIYEDGIKG
    CDALNSSLICLAA
    EYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELLSNFISVTEQLAEEFFTGDVESFLNEYGLLPEKEMHVLEQSNM
    EEDME

    >gi|253683497|ref|NP_001156643.1| selenoprotein M precursor [Bos taurus]
    MHLPLPPPPLLLLLAAVAAATTTFRPDWNRLQGLARARVETCGGCQLNRLKEVKAFVTQDIPLYHNLVMKHLPGADPELV
    LLGHRFEELERIPLSDMTREEINALVQELGFYRKASPDEPVPPEYLRAPARPAGDAPDHADL

    >gi|297461668|ref|XP_002701787.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 [Bos taurus]
    MGGCFSKPKPGSHAPRLPTVELKIEVVLPEKDRGKEELSTGSRGSPRAYQGNGAARHFHADERLPTAHPYPGAQDCVEAA
    VCHVKDLENGQMREVELGWGKVLLVKDNGELHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLDSL
    HKFQVKIEKEKVYIRASKQALQLQRRTKVMATCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHL
    PYDRPKLSKSLDAQPEQLALRPKEFFRAHGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSSPKTLSCKGKDV
    ENVFTIRTPEDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVEVEETPFRRFLGERVGHTLMKMFENNRVKF
    YMQTEVSELRAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGISLDSRGFIPVNKMMQTNIPGVFAAGDAVTF
    PLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEISTVPFLWTAMFGKSLRYAGYGEGFDDVIIQGDLDELKFVAFYTK
    GDEVISVASMNYDPIVSKVAEVLASGRTIRKREVETGDMSWLTGKGS

    >gi|194674710|ref|XP_001789131.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 isoform 2 [Bos taurus]
    MGGCFSKPKPVELKIEVVLPEKDRGKEELSTGSRGSPRAYQGNGAARHFHADERLPTAHPYPGAQDCVEAAVCHVKDLEN
    GQMREVELGWGKVLLVKDNGELHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLDSLHKFQVKIEK
    EKVYIRASKQALQLQRRTKVMATCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSK
    SLDAQPEQLALRPKEFFRAHGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSSPKTLSCKGKDVENVFTIRTP
    EDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVEVEETPFRRFLGERVGHTLMKMFENNRVKFYMQTEVSEL
    RAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGISLDSRGFIPVNKMMQTNIPGVFAAGDAVTFPLAWRNNRK
    VNIPHWQMAHAQGRVAAQNMLAQEAEISTVPFLWTAMFGKSLRYAGYGEGFDDVIIQGDLDELKFVAFYTKGDEVISVAS
    MNYDPIVSKVAEVLASGRTIRKREVELFVLHSKTGDMSWLTGKGS

    >gi|194674712|ref|XP_001789124.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 isoform 1 [Bos taurus]
    MGGCFSKPKPVELKIEVVLPEKDRGKEELSTGSRGSPRAYQGNGAARHFHADERLPTAHPYPGAQDCVEAAVCHVKDLEN
    GQMREVELGWGKVLLVKDNGELHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLDSLHKFQVKIEK
    EKVYIRASKQALQLQRRTKVMATCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSK
    SLDAQPEQLALRPKEFFRAHGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSSPKTLSCKGKDVENVFTIRTP
    EDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVEVEETPFRRFLGERVGHTLMKMFENNRVKFYMQTEVSEL
    RAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGISLDSRGFIPVNKMMQTNIPGVFAAGDAVTFPLAWRNNRK
    VNIPHWQMAHAQGRVAAQNMLAQEAEISTVPFLWTAMFGKSLRYAGYGEGFDDVIIQGDLDELKFVAFYTKGDEVISVAS
    MNYDPIVSKVAEVLASGRTIRKREVETGDMSWLTGKGS

    >gi|27807131|ref|NP_777051.1| thioredoxin reductase 2, mitochondrial precursor [Bos taurus]
    MAALRGAAARFRGRAPGGARGAAGRQCYDLLVIGGGSGGLACAKEAAQLGKKVAVLDYVEPSPQGTRWGLGGTCVNVGCI
    PKKLMHQAALLGGMIRDAPHYGWGVAQAPHSWATLADAVQNHVKSLNWGHRIQLQDRKVKYFNVKASFVDTHTVCGVSKG
    GEETLLSAEHIVIATGGRPRYPTHIEGALEYGITSDDLFWLKESPGKTLVVGASYVALECAGLLTGLGLDTTVMIRSVPL
    RAFDQQMASLVTEHMAGHGTRILRGCAPEKVEKLPGQQLRVTWVDLTSDRKDAGTFDTVLWAIGRVPETASLNLEKAGVH
    TNPVTGKILVDAQETTSVPHIYAIGDVAEGRPELTPTAIMAGRLLAQRLSGRTSDLMDYSSVPTTVFTPLEYGCVGLSEE
    AAVARHGEEHVEVYHAFYKPLEFTVPQRDASQCYIKMVCLREPPQLVLGLHFLGPNAGEVIQGFALGIKCGASYQQLMRT
    VGIHPTCAEEVAKLRISKRSGLDPTVTGC
    CG

    >gi|134085829|ref|NP_001076850.1| SUMO-activating enzyme subunit 2 [Bos taurus]
    MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESV
    LQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYE
    CHPKPTQRTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEASWEPMEAEARARASNEDGDIKRVST
    KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETSASDQQNEPQLGLKDQQVLDVKSYAC
    LFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVL
    EGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDAPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
    QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAE
    DAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNNADISEEERSRKRKLDEKESVSAKRSRIEQAEELDEVIALD


    >gi|253735733|ref|NP_001156716.1| selenoprotein V [Bos taurus]
    MNNQPRTPAPTPARASTPVRGSTLHRTSIQVRTPTPGPDSGPTRITTLLRTPALIRTLTPIRTPTPVRTPTPVPPSTPVR
    SPIPVRTPTPVPPSTPVRTPTPVPLSTPVRPPTPVRPPTPVRPPTPVRPPTPIGTPTLIRSPTPVQIPIPEPIPTPIPSR
    VLIPPLESFPDSALPSGPPLELEPTLTVSPAKNLEPSPAKNLEPSPRVKQVSSAANGFPPIQEPLPALTPLATDLRSPSL
    GSPLRTDTSTTNLIASSSGHVPGTPILGAIQAILPVPATALASISGNLKEENKIMIRVVYCGL
    CSYSLRYILLRKSLEQQ
    FPNSLIFEEEISAQATGEFEVFVDGKLIHSKKNGDGFVDEVKLQTIVNLLNEEFKKKVAGN

    >gi|297462131|ref|XP_002701986.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MSQAFMNSRVQSGKVVVFIKPTCPYCRRTQKLLSELPFKQGLLEFVDIQILYLIGANGDTDEIQDYLQQLTGARTVPRVF
    IGKDCIGGCTDLVNIHERGELLTRIKQIGALQ

    >gi|119924704|ref|XP_001251133.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MAQTFVNSKIQSGKVVVFIKPTCPYCKRTPELLNQLPFKQGLLEFVSITANSDTNEIQDYLQQLTGARTVPRVFVGKECI
    GGCTDLVNIHERGELLTRIKQIEALQ

    >gi|156120919|ref|NP_001095606.1| nucleoredoxin [Bos taurus]
    MSGFLEELLGEKLVTGGGEEVDVHSLAARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGPGAGASAEP
    EPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDATSGKVVCRNGLLVIRDDPEG
    LEFPWGPKPFREVIAGPLLRSNGQSLESSSLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAGQKFEIIFVSADRSE
    DSFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCRGFPWHPKPVLELSDSNA
    VQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDM
    SARAKYVMDVEEITPAIVEAFVNDFLAEKLKPEPI

    >gi|134085853|ref|NP_001076876.1| spermatogenesis-associated protein 20 [Bos taurus]
    MLGARALRCRGFLLPGAGPVLALSYRGSSARDKDRSVTVSSSVPMPAGGKGSRTNCSQSTPQKVPNRLINEKSPYLLQHA
    YNPVDWYPWGQEAFDKAKKENKPIFLSVGYST
    CHWCHMMEEESFQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQA
    TSSGGGWPMSVWLTPDLQPFVGGTYFPPEDGLTRVGFRTVLMRIRDQWKQNKSTLLENSQRVTTALLARSAISMGDRQLP
    PSAATMNSRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGF
    HRYSTDRQWHVPHFEKMLYDQAQLTVAYSQAFQISGDEFYSEVAKGILQYVVRNLSHRSGGFYSAEDADSPPERGMRPKE
    GAFYVWTVKEVQHLLPEPVLGATEPLTSGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAV
    RTLLNSGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGFAVTGAVLGQERVINYAINGAKFLKRHMFDVASGRLMRTCYA
    GSGGTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWALRLQDTQDRLFWDSRGGGYFCSEAELGAGLPLRLKDD
    QDGAEPSANSVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAHQQTLKQIVICGDPQAKDTKA
    LLQCVHSIYIPNKVLILADGDPSSFLSRQLPFLNTLRRLEDRATAYVCENQACSMPITEPCELRKVLHQ

    >gi|115497810|ref|NP_001068689.1| hypothetical protein LOC505710 [Bos taurus]
    MSGDTGTTSVAPPPGETEPGHGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLEN
    GGFPYEKDLIEAIRRASNGEPLEKITNSRPPCVIL

    >gi|27806501|ref|NP_776560.1| protein disulfide-isomerase precursor [Bos taurus]
    MLRRALLCLALTALFRAGAGAPDEEDHVLVLHKGNFDEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIR
    LAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAASTLSDGAAAEALVESSEVAVI
    GFFKDMESDSAKQFFLAAEVIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKEKLLDFIKHNQLPLVI
    EFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLSNFKKAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLI
    TLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPW
    CG
    H
    CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
    GDDDDLEDLEEAEEPDLEEDDDQKAVKDEL

    >gi|114052907|ref|NP_001039553.1| probable glutathione peroxidase 8 [Bos taurus]
    MEPLTAYPLRCSGPKAKAFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDANGRVVSLEKFKGKVALVVNVASDCQ
    LTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSKEVVSFARNNFGVTFPIFHKIKILGSEAEPAFRFLVDSSKK
    EPRWNFWKYLVNPEGQVVKTWRPEEPIEVIRPEIAALIRQMIIKKKEDL

    >gi|148230374|ref|NP_776758.2| protein disulfide-isomerase A3 precursor [Bos taurus]
    MRLRRLALFPGLALLLAAARLAAASDVLELTDDNFESRITDTGSSGLMLVEFFAPWCGHCKKLAPEYEAAATRLKGIVPL
    AKVDCTANTNTCNKYGVSGYPTLKIFRDGEESGAYDGPRTADGIVSHLKKQAGPASVPLKSEEEFEKFISDKDASVVGFF
    KDLFSEAHSEFLKAASNLRDNYRFAHTNVESLVNKYDDDGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKRFIQENI
    FGICPHMTEDNKDLLQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGKKLHFAVASRKTFSHELSDFGLESTT
    GEIPVVAVRTAKGEKFVMQEEFSRDGKALERFLEDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIE
    FYAPW
    CGHCKNLEPKYKELGEKLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYL
    KREATNPPVIQEEKPKKKKKAQEDL

    >gi|154152001|ref|NP_001093773.1| glutaredoxin-related protein 5, mitochondrial [Bos taurus]
    MSGSLGRAAATAASALLRWGRGAGGGLRGPGVRAAGSGGSGSSEHLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRL
    HGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALLDDTKDQDSK

    >gi|115497546|ref|NP_001069042.1| NEDD8-activating enzyme E1 catalytic subunit [Bos taurus]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRIPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRILQWPKEQPFGEGVPLDGDDPDHIQWIFQKALERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSP
    AITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|27805879|ref|NP_776701.1| chloride intracellular channel protein 5 [Bos taurus]
    MNDENYSTTIYNRVQTERVYEDSDPAENGGPLYDEVHEDVRREDNLYVNELENQEYDSVAVYPVGRQGRTSASLQPETGE
    YVLPDEPYSKAQDPHPGEPTADEDISLEELLSPTKDHQSDSEEPQASDPEEPQASDPEEPQGPDPEEPQENGNEMEADLP
    SPSSFTIQNSRAFSTREISPTSYSADDVSEGNESASASPEINLFVKAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVD
    LKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPRLAAKHRESNTAGIDIFVKFSAYIKNTKQQSNA
    ALERGLTKALKKLDDYLNTPLPEEIDADTRGDDEKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDFPAEMTGL
    WRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

    >gi|62751970|ref|NP_001015608.1| chloride intracellular channel protein 1 [Bos taurus]
    MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI
    EEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPDEVDETSAEDE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFSIPDVFRGVHRYLRNAYAREEFASTCPDDEEIELAYEQVAKAL
    K

    >gi|253314494|ref|NP_001020506.2| epididymal secretory glutathione peroxidase [Bos taurus]
    MTIQLRASCLFLFFLAGFVQTNSNLEKMDCYKDVKGTIYDYDAFTLNGKEHIQFKQYAGKHVLFVNVATYCGLTAQYPEL
    NALQEELKPFGLVVLGFPCNQFGKQEPGENSEILPGLKYVRPGGGYVPNFQLFEKGDVNGETEQKVFTFLKQSCPHPSEI
    MGSIKHISWEPIMVRDIRWNFEKFLVGPDGIPVMRWFHRTPVSTVKTDILAYMKQFKTK

    >gi|119915902|ref|XP_869561.2| PREDICTED: CG1837-like isoform 1 [Bos taurus]
    MPPPLLLLLLLLLDAGGGRGGARAQEPGSAAADGPPAAGGGGGQDPHAKHLYTADMFAHGIQSAAHFVMFFAPWCGHCQR
    LQPTWNDLADKYNSLEDAKVYVAKVDCTADSEVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFQALEKWMLQTLNEEPPT
    PEPAVEPPRTPELKQGLYELSAGNFELHVAQGDHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELC
    SGNQVRGYPTLLWFRDGKKVDQYKGKRDLDSLREYVQSQLQSAGPAAPEPTQPSEAPALAAEPAADQGTVLALTERNFDD
    AIAEGVTFIKFYAPW
    CGHCKDLAPTWEDLSKKEFPGLAEVTIAEVDCTAERNLCSKYSVRGYPTLLLFRGGEKVGEHSGS
    RDLDSLHRFVLRQAKDEL

    >gi|156121223|ref|NP_001095759.1| protein disulfide-isomerase TMX3 [Bos taurus]
    MAARRRGPALRFWAAVFLLDLAFCKGHVEDLDDSFKENRKDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSLGSPVKVG
    KMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYIGGE
    SPLKEKYIDAASELIVYTYFFSASEEVVPAYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYLTMDGFLLY
    ELGDTGKLVAIAVIDEKNTSVEHTRLKSIIQEVARDYRDQFHRDFQFGHMDGNDYINTLLMDELKVPTVVVLNTSNQQYF
    LLDRQIKNAEDMVQFINNILDGTVDAQGGDSILQRLKRIVFDAKSTVVSIFRSSPLMGCFLFGLPLGVISIMCYGICTAD
    ADGGYIEERYEVSKNEPDDSPEPAERPEPPQPRGAASPLPAPQEPKDVLEKKKD

    >gi|118150882|ref|NP_001071354.1| thioredoxin-like protein 1 [Bos taurus]
    MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNKISATPTFL
    FFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDMTFLESD
    CDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
    VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|149642789|ref|NP_001092331.1| protein disulfide-isomerase A2 [Bos taurus]
    MDGQFLPVLVLLLGASGLCGQGLGPRGPLEEPPEEKPPEEKPPEEEPPEEDGVLVLSRQTLGQALQEHPALLVEFYAPWC
    GH
    CRALAPEYSKAAALLAAESARVTLAKVDGPAEPELAEEFAVTEYPTLKFFREGNRTHPEEYTGPREAEGIAEWLRRRV
    GPSARQLEDEEDIRALTDTRDVVVVGFFQDLQDRDVATFLGLAQDALDMTFGLTDRPQLFQKFGLTKDTVVLFKKYDEGR
    ADFPVDKELGLDQGDLSRFLLTHSMHLVTEYSSETSSKIFEAKILNHLLLFINQTLDAHRELLAGFREAAPPFRGQVLFV
    VVDVGADNDHVLQYFGLKAQEAPTLRFINIETTKKYAPEHGAPVTAATITDFCRTVLGGGVKPYHLSQEVPPDWDQRPVK
    TLVGKNFEQVAFDETKNVFIKFYAPW
    CAHCKEMAPAWEELAEKYRDHEDVIIAELDATANELEAFPVHGFPTLKYFPAGP
    GRKVIDYKN

    >gi|168480134|ref|NP_001029982.2| methionine-R-sulfoxide reductase B1 [Bos taurus]
    MSFCSFFGGEIFQNHFEPGIYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRPGAIKVSCGRCGNGLGH
    EFLNDGPKRGQSRF
    CIFSSSLKFIPKAEETSASQGQ

    >gi|119916613|ref|XP_875845.2| PREDICTED: erv1-like growth factor [Bos taurus]
    MAAPGERGRFGAGILFSFLPGGARSEVTDDLVTDARGRGAGRREATASARAPSAGPASDPPVSEFSPRRPCRACVDFKSW
    MRTQQKRDSKFREDCPQDREELGRNSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYP
    CEECAEDIRKRIYRDQPDT
    RTRVSFTQWLCRLHNEVNRKLGKPDFDCSLVDERWRDGWKDGSCD

    >gi|76653022|ref|XP_596915.2| PREDICTED: Protein Disulfide Isomerase family member (pdi-2)-like [Bos taurus]
    MELLCMSLLLVASCVGTVQGSPEMNGKKESINMSQPLHILVEENLMVLTPAGLTQMLNETRFLMVLFHNPSSKQSRSLAE
    ELGKAVEIMGKGKNGIGFGKVDVTVEKELQKEFDVKKAPELKLFFEGNRSQPISCEGVVESTALVVWLRRQISQKAFLFS
    NSNEIAEFVNSRPLVIIGFFQDLEEEVAELFYDMIKDFPELTFGAISIRHAIGRYHVTLDSVIVFKKGRIVNRQELINDN
    VNKQILNKLIKEQLTDLVIEYNTESRDLIYELNILNHMLLFVSKSSESFRIIMQHYKLASKIFQNKILFILVDTDVPRNR
    RVFKYFQIREVDVPCIQIINLSSDARYKMPFEEITYENLRNFGQSFLNRKAKKHLSSEEIPNYWDQGLVKQLVGKNFNVV
    VFDKERDVFVMFYAPWSQK
    CMVLFPVLEELGRKYQNHSTVTIAKIDITANDIELTYQDRYPFFRLFPTDSQKAVLYNGEH
    TLKGFSDFLESQIKIQIEDEDELLSVEQSEETEKKVLAEEKEEHFMKKELPEQNLPELENVTKLEGPTEQKEKAEEEKVA
    EPKEPPTQAEKPRMKEEL

    >gi|78042514|ref|NP_001030195.1| arsenite methyltransferase [Bos taurus]
    MATPRDAEIRKDVQTYYGQVLKKSADFQTNACVTAARPVPQHIREALQNVHEEVSLRYYGCGLVIPECLENCWILDLGSG
    SGRDCYALSQLVGEKGHVTGIDMTEGQVEVANKYIEYHMEKYGFQAPNVTFIHGYIEKLEEAGIKNESYDIVISNCAINL
    VPDKQQVLQEVYRVLKHGGELYFSDVYASLELPEEIRTHKVLWGE
    CLGGALYWKDLSILAKKVGFCPPRLVTANFITVQN
    KELENVIGDCRFVSATFRLFKLPKTGPTQKCQVIYNGGIRGHEKELIFDANFTFKKDEVVEVDEETVAILKNSRFAQDFL
    IGPDGEKFPTCGAYTALEVKDVVTDPFELAGRSDSAESRSFPAVGGCCSTKKCS

    >gi|297464495|ref|XP_001253013.3| PREDICTED: glutathione-S-transferase omega 1-like [Bos taurus]
    MSGGTVRSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLRAKGIRHEVININLKNKPEWFFKKNPLGLVPVLETSLG
    QLIYESAITCEYLDEAYPGKKLLPGDPYEKACQKMVFESFSKVPSLMVSFLRKQNKEDCSGLKEELHKEFSKLEEVLTNK
    KTTFFGGSSLSMIDYLIWPWFEWLEALELNECVDHTPNLKLWMASMKNDPIVSSLPTDVKTLQGFFNLYLQNSPEACDYG
    L

    >gi|164420719|ref|NP_001068682.2| glutathione-S-transferase omega 1 [Bos taurus]
    MSGGSARSLGKGSAPPGPVPEGLIRVYSMRFCPYAQRTRLVLTAKGIRHEVININLKNKPEWFFKKNPSGLVPVLETSQG
    QLICESAITCEYLDEAYPGKKLLPGDPYEKACQKMVLESFSKVPPLILKILRTQNKEDCSGLKEELHKEITKLEEVLTDK
    KTTFFGGNSLSMIDYLIWPWFERLEALELNECVDHAPTLKLWMAAMKKDPTVSSLLTDVKTFQGFFNLYLQNNPEAYDYG
    L

    >gi|194678798|ref|XP_870203.2| PREDICTED: glutathione-S-transferase omega 1 [Bos taurus]
    MTDDATRTLGKGSIPPGPVPEGVIRLYSMRFCPYAHRTRLVLRAKGIRHEVININLRNKPEWYFTKHPFGQIPVLENSKC
    QLIYESVIACEYLDDAYPGRKLYPYDPYERARQKMLLELFYKVPHLTKECLVALRCGRDCGDLKLALRQEFCNLEEILGY
    QNTVFFGGDCISMIDYLFWPWFERLEVYGIADCVNHTPALRLWIAAMKQDPTVCSLLTDKNTFLGFLNLYFQNNPGAFDY
    GLSC

    >gi|119917734|ref|XP_870092.2| PREDICTED: glutathione-S-transferase omega 1-like, partial [Bos taurus]
    MSGGTVRSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLRAKGIRHEVININLKNKPEWFFKKNPLGLVPVLETSLG
    QLIYESAITCEYLDEAYPGKKLLPGDPYEKACQKMVFESFSKVPSLMVSFLRKQNKEDCSGLKEELHKEFSKLEE

    >gi|139949007|ref|NP_001077192.1| NHL repeat-containing protein 2 [Bos taurus]
    MAAPGARSCNLSGLLPAQTSLEYALLDAVTQEEKDGLVYQYLQKVDGWEQDLLVPEFPEGLEWLNTEEPISVYKDLCGKV
    VILDFFTYC
    CINCIHLLPDLHALEHTYSDKDGLLIVGVHSAKFPNEKVLDNIRSAVLRYNITHPVVNDADASLWQELEVS
    CWPTLIILGPRGNMLFSLIGEGHKEKLFLYTSIALKYYKDRGQIRANKIGIKLYKDSLPPSPLLFPGKITVDHVSNRLVI
    ADTGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESSFNSPQGVAIMNNIIYVADTENHLIRKIDLEAEMVSTVAGIGIQ
    GTDKEGGAKGDEQPISSPWDVVFGRSGPEVQRDNILWIAMAGTHQIWALLLDCGRLPKKNELKKGTCLRFAGSGNEENRN
    NAYPHKAGFAQPSGLSLASEGPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNLFAFGDVDGVGINARLQHPLGV
    TWDQKRNLLYVADSYNHKIKVVDPKTKNCTTLAGTGNASNMIGSSFTDSTFNEPGGLCIGENGQLLYVADTNNHQIKVLD
    LETKTVSVFPVFRSENAVVDGPCLAGKPKTLPKLPKSAPGIRLAPVAASPGQTLQFKLRLDLPSGTKLTEGASSCWFLSA
    EGNEWLLQGQIPSGEIESISNQPTISLQIPGDCLSLEAILSISVFLYYCSSDSSACMMKGILFSQPLQITDTQQDCIPPV
    ELKYIF

    >gi|61842931|ref|XP_590020.1| PREDICTED: DnaJ (Hsp40) homolog, subfamily C, member 10-like isoform 2 [Bos taurus]
    MGVWLNKDDYVRDLKRVMLFFLVMYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKV
    NRAYEVLKDEDLRKKYDKYGEKGLADNQGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CSH
    CHDLAPTWRDFAKVVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLMNFAMQHVRSTVTEL
    WTGNFVNSIQTAFAAGIGWLITFCSEGSDCLTSQTRLRLSGMLDGLVNVGWVDCATQDNLCKSLDITTSTTAYFPPGATL
    NNKEKSGILFLNSLDAKEIYLEIMHNLPDFELLSANSLQDRLAHHRWLLFFQFGQNENSNDPELKKLKTLLKNEHIQIGK
    FDCSSAPDVCSNFYVFQPCLAVFKGQGTKEFEIHHGKKILYDILALAKESVNSHVTTLGPQNFPANEKEPWLVDFFAPW
    C
    PPCRALLPELRKASKHLYGQLKFGTLDCTIHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFVEDLMNPSVIS
    LTPTTFNELVKQRKHDEVWMVDFYSPW
    CHPCQILMPEWKRMARTLIGLINVGSIDCQQYHSFCAQENVRRYPEIRFFPQK
    SNKAYEYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVLQGKNHWVVDFYAPW
    CGPCQNFAPEFELLARTLKGK
    VKAGKVDCQAYAQTCQKAGIRAYPTVRLYPYERAKRNTWGEQIDSRDAKEIATLIYEKLEKLQNHEKRDKDEL

    >gi|27806083|ref|NP_776857.1| thioredoxin-dependent peroxide reductase, mitochondrial precursor [Bos taurus]
    MAATAGRLFRASLIRHVSAIPWGISASAALRPAASRRMCLTNALWSGSDQAKFAFSTSSSYHAPAVTQHAPYFKGTAVVS
    GEFKEISLDDFKGKYLVLFFYPLDFTFV
    CPTEIIAFSDKASEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIA
    LLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVEAHGEVCPANWTPESPT
    IKPHPTASREYFEKVNQ

    >gi|297464560|ref|XP_001249418.2| PREDICTED: O-6-methylguanine-DNA methyltransferase-like isoform 1 [Bos taurus]
    MLPPGTARAGGEAGPTLGPAPARRGPAPAAARVPSGGPGAQASPPAPDPAPNLGLVPPLRVLAALPPNPGSRGPRTHCQV
    PPPGLGPAPAPRPSPGLPGLHRRCVVLRSELLAVGGLGSASERAVSSEHLPGQPPVNTGAIVLRAELNCTVSVLGRMDET
    CEMKYKVVDSPLGKLEISGCERGLHGIKLHGGKTPDTGPAEAAAPAEQLGGSGAVLEPLLQCAAWLDAYFREPAVLEGLP
    VPALHHPIFQKESFTRQVLWKLLTLVKFGETVSYQQLAALAGNPRAARAVGGAMRSNPIPILIP
    CHRVVCSSGAMGNYSG
    GVGVKEWLLAHEGRPAGKAARGGGSRATGSWRGALGSTASSQPAGRD

    >gi|78042550|ref|NP_001030273.1| glutaredoxin-3 [Bos taurus]
    MAGGAAEAAAAVVEVGSSGQFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHQQVSFVKLEAEAVPEVSEKYE
    ISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFSPSGSEHPKEDLSLRLKKLTHAAPCMLFMKGTPQEPR
    CGF
    SKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSSWPTYPQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKV
    LTNKASVMLFMKGNKQEAK
    CGFSRQILEILNSTGIEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKEL
    KENGELLPILKGEN

    >gi|124249256|ref|NP_001074383.1| tumor suppressor candidate 3 [Bos taurus]
    MGARGAPSRRRQAGRRPRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSVFRMNGDKFRKFIKAP
    PRNYSMIVMFTALQPQRQ
    CSVCRLANEEYQILANSWRYSSAFCNKLFFSKVDYDEGTDIFQQLNINSAPTFMHFPPKGRP
    KRADTFDLQRIGFGAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
    AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQVQFVAESHIILVLNAAITMGMDLLNEAATSKGDVGKRRIICLVGLG
    LVVFFFSFLLSIFRSKYHGYPYSFLIK

    >gi|166795315|ref|NP_001107662.1| glutathione reductase [Bos taurus]
    MALLARTLIASAGHCWLRVARAFPSSAPPPARAARAFSRAMACKQEPQPPCPPLSAGAEISYDYLVIGGGSGGLASARRA
    AELGARAAVVERHKLGGT
    CVNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCESKFNWRIIKEKRDAYVSRLNTIYQNNLT
    KSHIDIIHGHAAFTCDPQPTVEVNGKKYTAPHILIATGGVPSVPQESQIPGASLGITSDGFFQLEELPRRSVIVGAGYIA
    VEIAGILSALGSKTSIMIRHDKVLRTFDSIISSNCTEELENAGIEVLKYSQVREVKKTSSGLELRMVTSIPGREPTFTTI
    ADVDCLLWAIGRDPNSWGLNLNKLGIQTDDKGHIIVDEFQNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKED
    SKLDYDNIPTVVFSHPPIGTVGLTEDEAIYKYGKENVKTYSTTFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGIG
    CDEMLQGFAVAVKMGATKSDFDNTVAIHPTSSEELVTLR

    >gi|194679313|ref|XP_592198.4| PREDICTED: ERO1-like beta (S. cerevisiae) [Bos taurus]
    MTVTGVLDDCLCDIDSIDNFNTFKIFPKIKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAG
    NSNKYSKVANNTKELEDCEQASKLGAINSTLSNQSKEAFIDWARYDDSQDHFCELDDERSPAAQYVDLLLNPERYTGYKG
    SSAWRVWNSIYEENCFK

    >gi|77736145|ref|NP_001029771.1| hypothetical protein LOC534049 precursor [Bos taurus]
    MGMWSIGAGAIGVAALALLLANTDMFLAKPEKAALEYLEDIDLKTLEKDAVTFKAKALWEKNGAVIMAVRRPGCFLCREE
    ATDLSSLKPKLDELGVPLYAVVKEHIKNEVKDFQPYFKGEIFLDENKKFYGPQRRKMMFMGFVRLGVWQNFFRAWNGGFS
    GNLDGEGFILGGVFVMGPGKQGILLEHREKEFGDKVNLTSVLEAARKIRPQTSASEKQ

    >gi|27807445|ref|NP_777174.1| peroxiredoxin-5, mitochondrial precursor [Bos taurus]
    MRLGWLRVLGCRPGSVVSRATIVEGASTTAAGTRGCLEGILEWTFGGVRGFRSAAVAMAPIKVGDAIPSVEVFEKGPGNK
    VNLAELFKGKKGVLFGLPGAFTPG
    CSKTHLPGFVEQADALKAKGIQVVACLTVNDVFVTEEWARTHKAEGKVRLLADPSG
    TFGKETDLLLDDSLLFLFGNHRLKRFSMVIEDGIVKSLNVEPDGTGLTCSLAPNILSQL

    >gi|156523068|ref|NP_001095947.1| ubiquitin-like modifier-activating enzyme 1 [Bos taurus]
    MSSSPLSKKRRVSGPDPKPGSNCSPAHSVLSEVPSVPANGMAKNVSDADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGL
    RGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVSAYTGPLVEDFLSDFQ
    VVVLTNSPLEDQLRVGEFCHSHGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARH
    GFESGDFVSFSEVQGMIELNGSQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLAEPDFVMTDF
    AKYSRPAQLHIGFQALHHFCAQHGRSPRPHNEEDAAELVTIAQAVNARSLPAVQQGSLDEDLIRKLAYVAAGDLAPINAF
    IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEALTEDKCLPRQNRYDGQVAVFGSDLQERLGKQKYFLVGAGAIG
    CELLKNFAMIGLGCAEDGEIVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIY
    DDDFFQNLDGVTNALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSN
    NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVSNPLHLDYVIAAANLFAQTYGLTGSQDRAAVATLLQSVQVPEFT
    PKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPEKLPGFKMYPIDFEKDDDTNFHMDFIVAASNLRAENYDIPPADR
    HKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLNSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
    QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCC
    NDESGEDVEVPYVRYTIR

    >gi|27806085|ref|NP_776858.1| peroxiredoxin-4 [Bos taurus]
    MEAPPPPPPLPATTLAPGRSRKLLLLPLLLFLLRAEAVRGFEAEERPRTREEECHFYAGGQVYPGEVSRVSVAEHSLHLS
    KAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIDEFRSINTEVVACSVDSQFTHL
    AWINTPRRQGGLGSINIPLLADLNHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQY
    TDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|119920548|ref|XP_001250328.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVGITAAGNTSEIQDYLQQLTRARTVPQVFIGQECI
    GGCTDLVNMHERGELLTRLKQIGALQ

    >gi|119920550|ref|XP_001250373.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVDITAAGNTSEIQDYLQQLTGARTVPRVFIGQECI
    GGCTDLVNTHERGELLTRLKQIGALQ

    >gi|119908583|ref|XP_001252820.1| PREDICTED: peroxiredoxin-6-like isoform 1 [Bos taurus]
    MLGDLLLGDEAPNFEANTPIGRIRFHDYLGDSWGILSSHPRDFTTVCTTELGRAAKLAPEFAKRNVMMIALSIDSVEDHL
    AWSKDINAYNGEGPTEKLPFPIIDDKNRDLAIQLGMLDPAEKDKKDMPETSRVVFIFGPDKKLKLSILYPANTGRNFDEI
    LRVIISLQLTAEKRVATPVDWKNGDSVMVLPTVPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

    >gi|253735679|ref|NP_001156697.1| selenoprotein W, 1 [Bos taurus]
    MAVVVRVVYCGAUGYKPKYLQLKKKLEDEFPSRLDICGEGTPQVTGFFEVFVAGKLVHSKKGGDGYVDTESKFLKLVAAI
    KAALAQA

    >gi|126165276|ref|NP_001075196.1| chloride intracellular channel protein 2 [Bos taurus]
    MAGPRPSSEADPEIELFVKAGSDGESIGNCPFSQRLFMILWLKGVKFNVTTVDMTRKPKELKDLAPGTNPPFLVYNKELK
    TDFIKIEEFLEQTLAPPRYPHLSPRNKESFDVGCNLFAKFSAYIKNTQKEANKTFEKSLLKEFKRLDDYLNTPLLDEIDP
    DSTEELTVSRRLFLDGDQLTLADCSLLPKLHIIKVAAKKYRDFDIPVEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
    SVAKQKS

    >gi|83035079|ref|NP_001032693.1| glutaredoxin-1 [Bos taurus]
    MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVDITAAGNISEIQDYLQQLTGARTVPRVFIGQECI
    GGCTDLVNMHERGELLTRLKQMGALQ

    >gi|297468885|ref|XP_001255468.2| PREDICTED: arsenic (+3 oxidation state) methyltransferase-like [Bos taurus]
    MATGTPDSQARFGQSVKGLLTEKVNTCGTDVIALTKQVLKGSRSSETYYGQVLKKSADFQTNACVTAARPVPQHIREALQ
    NVHEEVSLRYYGCGLVIPECLENCWILDLGSGSGRDCYALSQLVGEKGHVTGIDMTEGQVEVANKYIEYHMEKYGFQAPN
    VTFIHGYIEKLEEAGIKNESYDIVISNCAINLVPDKQQVLQEVYRVLKHGGELYFSDVYASLELPEEIRTHKVLWGE
    CLG
    GALYWKDLSILAKKVGFCPPRLVTANFITVQNKELENVIGDCRFVSATFRLFKLPKTGPTQKCQVIYNGGIRGHEKELIF
    DANFTFKKDEVVEVDEETVAILKNSRFAQDFLIGPDGEKFPTCGAYTALEVKDVVTDPFELAGRSDSAESRSFPAVGGCC
    STKKCS

    >gi|119927193|ref|XP_001249853.1| PREDICTED: mercaptopyruvate sulfurtransferase-like isoform 2 [Bos taurus]
    MASKQLFRALVSAQWVAEALRAPQAGQPLRLLDASWYLAKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPSAA
    HFSEYAGRLGVGAATHVVVYDASDQGLYAAPRVWWMFRVFGHRTVSLLDGGLRNWLRQGLPLSSGKSRPQPAEFHAVLDP
    AYIKTYEDIKENLESRRFQVVDARAAGRFRGTEPEPRDGIEPGHIPGTINIPFTDFLTEDGLEKSPEEIRRLFQDKKVDL
    SLPLVAT
    CGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRAQPEDIISEGRGKIH

    >gi|119927197|ref|XP_001249946.1| PREDICTED: thiosulfate sulfurtransferase-like [Bos taurus]
    MVHQVLYRALVSTKWLAESVRAGKVGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDKASPYEVMLPSEAG
    FADYVGSLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATLNRS
    LLKTYEQVLENLESKRFQLVDSRAQGRYLGTQPEPDAVGLDSGHIRGSVNMPFMNFLTEDGFEKSPEELRAMFEAKKVDL
    TKPLIAT
    CRKGVTACHIALAAYLCGKPDVAIYDGSWFEWFHRAPPETWVSQGKGGKA

    >gi|119920263|ref|XP_615430.3| PREDICTED: ATPase, Cu++ transporting, alpha polypeptide [Bos taurus]
    MDLSVSVNSVTISVEGMTCSSCVWTIEQQIGKLNGVHHIKVSLEEKNATVIYDPKLQTPKTLQEAIDDMGFDAILHNPKP
    LPVLTETVFLTVTASLVPPWDHIQSTLLKTKGVTDIKISPQQRTAVVTIIPSIVNANQIVELVPDLSLDTGTLEKKSGTC
    EDYSMAQPGEVMLKMKVEGMT
    CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATVVYQPHLITAEEIKKQIEVVGFTAFIKK
    QPKYLKLGAIDIERLKNTPVKSSEGSQQKSPSYTSNSTVIFTIDGMHCKSCVSNIESALSTLQHISSVVVSLENKSAIVK
    YNASLVTPETLRKAIEAISQGQYRVSSASEIESTSNSPSSSSLQKSPLNIVSQPLTQETVINIDGMTCNSCVQSIEGVIS
    KKAGVKSIQVSLANGKGTVEYDPLLTSPETLREAIENMGFDASLSDTNEPLVVIAQPSSEMPLLTSTNEFHTKMMTPIHD
    KEEPKTSSKCYIQVTGMT
    CASCVANIERNLRREEGIYSILVALMAGKAEVRYNPALIQPPVIAELIRELGFGSTVIENAD
    EGDGVLELVVRGMT
    CASCVHKIESTLTKHRGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSASH
    LDHKREIRQWRRAFLVSLFFCIPVMGLMIYMMVMDHHLASLQHNQNMSQEEMINIHSSMFLERQILPGLSIMNLLSFLLC
    VPVQFFGGWHFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPVTFFDTPPMLFVFIALGRWLEHV
    AKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMP
    VAKKSGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVIVSIATLLVWIIIG
    FLNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKV
    VVFDKTGTITHGTPVVNQVKVLVESNRISRNKILAIVGTAESNSEHPLGAAITKYCKQELDTETLGTCIDFQVVPGCGIN
    CKVTNIEALLHKNNWKIEENNIKNASLVQIDESNEQSSTSSSMIIDAQFSNALNAQQYKVLIGNREWMIRNGLAINNSVN
    DSMTEHERRGRTAVLVAVDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPS
    HKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFV
    FALIYNLIGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHARNQMGQKSPSEISVHVGI
    DDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVGTSEPDKHSLLVGDCREDDDSAL

    >gi|78042524|ref|NP_001030204.1| endoplasmic reticulum resident protein 44 precursor [Bos taurus]
    MIPGIFLSLPDLRCSLLLLVTWVFTPVTAEIISLDTENIDDILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEEYP
    NANQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQELHDLAEITTPDRSK
    RNIIGYFEQKDSENYRVFERVANILHDDCAFLAAFGVVSKPERYSGDNIVYKPPGHSAPDMVYLGSMTNFDGTYNWIQDK
    CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPV
    IAIDSFRHMYVFGDFRDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEEVQDVASSPPESSFQKLAPSEYRYTLL
    RDRDEL

    >gi|297470603|ref|XP_002684631.1| PREDICTED: chloride intracellular channel 6-like [Bos taurus]
    MAGVAELDGGAPRPRSPSGGPALQAERRDEPEAAGPKAQREEAREGPAEAPGGEGAGAAATAAGPEGEGPGPAGGRAGGL
    EPGSGGGPGAETRGGSGAQGQAEAGEDAREGEGPTSGAEPEEEASPGPGAQGEEPGEVQAGPRDPAALNAKEEAGNGPGE
    PAGSAPGASGARVDAPESVGESVVAEGSMGALVDAPESVGNSVDSEGSVGARVDAEGPAGESVGAEESMADSTDVGGPTG
    ASTDVGVPTAGAQGSEGESRDGGDSKSQSQAEAIEAPAPESAECTPGELARGPRGSAEETGDPEGEEAGEAAPGDARAEA
    SEEADQDGPSGQEEEAEEERPEQGLQGPGEEATAGGEEESPDGTAAGEAIQPAEVGEPQADLSNHLADERSAERGGGIVP
    ENGGQEGGEASEEGAPGQDHDITLFVKAGCDGESIGN
    CPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPF
    MTFDGEVKTDVNKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYERNLLKALKKLDSYLNS
    PLPDEIDAYSTEEAAISGRKFLDGNELTLADCNLLPKLHIIKIVAKRYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPAD
    QEIEHAYSDVAKRMK

    >gi|297472427|ref|XP_002685900.1| PREDICTED: KAT protein-like [Bos taurus]
    MLPVPKGRAGAEFLKLTFAVRTMAGEPTVSLPELRSLLASGGARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAA
    FKALYSTEKPKLEENLIFF
    CQMGKRGLQATQLAQRLGYKEARNYEGAYREWLQKEG

    >gi|297473383|ref|XP_002686521.1| PREDICTED: similar to magnesium transporter 1 [Bos taurus]
    MEECWWLRHVSLTVVALMFMTPEASAHPDQGQKVLEEKVRQLMDWTKRDRVMRMNTAAFNHFVLEKPRNYSVIAMFTALQ
    RFRS
    CAPCKLAVEEFQVLAGSWQFSSAFSNKVFFAMLDFDESPEVFKTLQVKGGPVVLHLPAKSEFTADDIYNFQVRDIS
    AQHMFTWVDDRTGRWMGNFTTRQPIHFHYPFKLGISVALIGGLVYVLKWKRTFIFSKNFWAVLALCFVILMSSGRMWIHI
    RGAPFAESKTHTGQTHYIQDTYFFQYVAEMYIISLFYMCITLGMVLLSTAATSRMNIIRRKIMSVTGMCLLVIFFSWLLS
    LVRLKYHVYPFRILMN

    >gi|297473639|ref|XP_002686727.1| PREDICTED: anterior gradient homolog 3-like [Bos taurus]
    MMSHSVLVLCLLSITVSSNLAIAIKREKRPPQTLSRGWGDDITWVQTYEEGLFHTQKSNKPLMVIHHLEDCQYCQALKKV
    FAQNKEIQEMAQNNFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPLLIENMKKALK
    LIQSEL

    >gi|297473762|ref|XP_002686825.1| PREDICTED: dihydrolipoamide dehydrogenase [Bos taurus]
    MQSWSRVYCSLVKRGHFSRISHGLQGVSVVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTC
    LNVGCIPSKALLNNSHFYHLAHGKDFASRGIEMSEVRLNLEKMMEQKSNAVKALTGGIAHLFKQNKVVHVNGYGKITGKN
    QVTATKADGSTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVT
    AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTQ
    NLGLEELGIELDTRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVA
    WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
    ARVCHAHPTLSEAFREANLAASFGKSINF

    >gi|297473905|ref|XP_002686917.1| PREDICTED: 3-mercaptopyruvate sulfurtransferase-like [Bos taurus]
    MVLQRLLPWSTCWTIFGSAEAALWGLKSIKRSCLSFCTAICEGVTYKELKNLLKSKKIMLIDVREPWEIYESGKIPGSVN
    IPLDDVGEALQMNPKDFKENYKEVKPSKSDSLVFS
    CLAGVRSKVAMVTAISLGFNNAQHYAGGWKEWATYELSEKKQGN

    >gi|297473967|ref|XP_002707788.1| PREDICTED: peroxiredoxin-6-like [Bos taurus]
    MLGDLLLGDEAPNFEANTPIGRIRFHDYLGDSWGILSSHPRDFTTVCTTELGRAAKLAPEFAKRNVMMIALSIDSVEDHL
    AWSKDINAYNGEGPTEKLPFPIIDDKNRDLAIQLGMLDPAEKDKKDMPETSRVVFIFGPDKKLKLSILYPATTGRNFDEI
    LRVIISLQLTAEKRVATPVDWKNGDSVMVLPTVPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

    >gi|297474691|ref|XP_002687588.1| PREDICTED: methionine sulfoxide reductase B3-like isoform 2 [Bos taurus]
    MSPRRTLPRPFLLCLCLSLCLAAAAARGAVQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKD
    PGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CIN
    SASLSFSPAESSGAQGDSAGGSPAPGDKTEL

    >gi|297474689|ref|XP_002687587.1| PREDICTED: methionine sulfoxide reductase B3-like isoform 1 [Bos taurus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVINSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFS
    PAESSGAQGDSAGGSPAPGDKTEL

    >gi|297474693|ref|XP_002687589.1| PREDICTED: methionine sulfoxide reductase B3-like isoform 3 [Bos taurus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVINSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFS
    PAESSGAQGDSAGGSPAPGDKTEL

    >gi|297474695|ref|XP_002687590.1| PREDICTED: methionine sulfoxide reductase B3-like isoform 4 [Bos taurus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVINSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFS
    PAESSGAQGDSAGGSPAPGDKTEL

    >gi|297477228|ref|XP_002689245.1| PREDICTED: thioredoxin domain containing 15-like [Bos taurus]
    MAPSAAASCQDGDAGPRPRSRPLLPQPSSAGERESRRCAPVALRPGCTGRCPPRTMRLIGWWQVLLWVLGSPARAEEIAE
    KRSHLWSEEQPAYPFQVGAVYMNEEVPSPDPVGQDPSAEETEAVLGLDADGNHMVMLSVIPGGAEDKLSPESSSGTCGAG
    GEEGSRCNLRESLFSLDRAGARFSEREEEYYTEPDVAESDPTPTEDANTTESLKSPKVNCEERNVTGLENFTLKILNMSQ
    DLMDFLNPNGSDCTLVLFYTPW
    CRFSASLAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARF
    NHTDRTLETLKIFIFNQTGIEAKKNVVVTQADQIGPLPSTLIKSVDWLLVFSLFFLISFIMYATIRTESIRWLIPGQEQE
    HAE

    >gi|297478185|ref|XP_002689909.1| PREDICTED: nucleoredoxin-like 2-like [Bos taurus]
    MVDVLGGRRLVTCDGAWVEAEAALQNKVVALYFAAGRCAPSRDFTPLLCDFYEELVDEARPPAPFEVVFVSADGSAQEML
    EFMKELHGAWLALPFHDPYRHELRTRYHITAIPRLVILKPSGEVITDKGRKQIRERGLACFQNWVEAADIFQNFSS

    >gi|297479980|ref|XP_002691152.1| PREDICTED: PDIA6 protein-like [Bos taurus]
    MARLVLGLMSCTLFITVNRLYSSSDDVIELTPSNFNREVIQSYSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGA
    VDADKHQSLGGQHGVQGFPTIKIFGSNKNKPEDYQGGGTGEAIVDAALSALCQLVKERLGGRGRGYSSGKQGRGDSSSKK
    DVIELTDDNFDKNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDASVNQVLASRYGIRGFPTI
    KIFQKGESPVDYDGGRRRSDIVSRALDLFSDNAPPPELLEIINEDVAKKTCEEHQLCVVAVVPHILDTGAAGRNSYLEVL
    LKLADKYKKKMWGWLWTEAGAQSEPENTLGIGEFGYPAMAAINAREMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGG
    GAFPTISTREPWDGKDGELPVEDDIDLSDVELDDLEKGEL

    >gi|297480608|ref|XP_002691574.1| PREDICTED: protein disulfide isomerase family A, member 6 [Bos taurus]
    MKEGKGLVRSEWGKDRTVRIREKNNTNDFTPKKNKYGKAGLWVREAQGWGAGRTAGLPRPPASPSFRPSPPPPQKPKPVT
    STRPPLIGYANERSLPGPISRGHGLASVFRPASAAPPRAYLASRGRYEGRWGRGAAVRRRLECVAARALSMARLVLGLMS
    CTLFITVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPW
    CGHCQRLTPEWKKAATALKDVVKVGAVDADKHQSLG
    GQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNF
    DKNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPV
    DYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKK
    MWGWLWTEAGAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTISTRE
    PWDGKDGELPVEDDIDLSDVELDDLEKDEL

    >gi|297480848|ref|XP_002691662.1| PREDICTED: quiescin Q6 sulfhydryl oxidase 2 [Bos taurus]
    MKRSPGAPAAAAAARTRRPPSARPARLPPLLVLLAAAAGPGAGGAARQYRAGEDAVWVLDSGSVRGATANSSAAWLVQFY
    SSWCGHCIGYAPTWRALAADVRDWAAAIRVAALDCAEEKNQEVCRAYDIHFYPTFRYFKAFTKDFTTGENFKGPDRELQT
    VRRTMINFLQNHTDGNRPPACPSLDPIRPSDVLSLIDKRGDRYVAVLLEDDSSYVGREVILDLIPYESIEVRRALGSDTA
    FLQKLGVPSLPSCYLIYPNGSHGPVTVGKPLRSFFSSYLRSLPGVRKKPGSLPGRPSRDESSEAVVWRDFDRSKLYTADL
    ESGLHHLLRVELAAHRSLAGAELKTLKDFITVLAKLFPGRPPVRKLLEMLQEWLASLPLDRIPYDAVLDLVNNKMRISGI
    FLTNHIKWVGCQGSRPELRGYSCSLWKLFHTLTVGAGTHPKALDGTGLEDDPQAVLQTIRRYVHVFFG
    CKECGEHFEEMA
    KESIDSVKTPDQAILWLWKKHNLVNSRLAGHPSEDPKFPKVPWPSPDLCPACHEEIKGLGTWNEGQVLLFLKQHYGRDNL
    VDTHSADLGGPGEGAPAPGEKQEGSQAPPEQPPADHGAESLRPPSLLPPRAHLSERSQPGLDLLLGSRAGGEGRRGAEAA
    AAFLGMGFSSLDMSLCVVLYVASSLFLMVMYFFFRVRSKRWKVKHHHPSV

    >gi|297481055|ref|XP_002691840.1| PREDICTED: ATPase, Cu++ transporting, beta polypeptide-like [Bos taurus]
    MERAGDQTPGNPEPSSLATLGDPQVTLLSVHKQWSFKRSPGTGGSSRPVISEEECPPPSEEGEFSQKVLNGSEEISSKQI
    LSKLSQPAMKQSFAFDNNGYEDDLDGVRPSHTATGTINIVGMTCQSCVKSIEGRVSSLKGIVSIKVSLEQGSAEVRYVPS
    VVSLVQICHQIEDMGFQASVAEGKATSWPSRVSPASEAMVKLRVEGMTCQSCVSSIEGKIGKLQGVLRVRVSLSNQEAVI
    TYQPYLIQPQDLRDHITDMGFEAVIKNKVAPVSLGPIDVRRLQSTLSAAPPAPVNQNDNNSETPGGQGIPLHLRVDGMH
    C
    KSCVLNIEDNIGRLPGVQSIHVSLESRTAQVQYDPSLVSPGALQRAIEALPPGNFKVSLPNGVEGSGPDSRSPPASSAPC
    TVMLAIAGMTCKSCVQSIEGLISQRAGVHQISVFLAEGTAVVLYDPSRTHPEELRAAVEDMGFEASILAENCSSNHIGNH
    SSGSAVGHVAAGTPVPVQGGTPQPGELHTNHIPRQSPKSLPASTTVAPKKCFLQISGMT
    CASCVSNIERNLQKEPGILSV
    LVALMAGKAEVKYNPEAIQPLEIAKLIQDLGFEAAVMEDYTGSDGDLELMITGMT
    CASCVHNIESKLRRTEGITYASVAL
    ATSKAHVKFDPEIIGPRDIVKLIEEIGFRASLAQRIPNAHHLDHKVEIKQWKNSFLCSLVFGIPVMGLMIYMLIPSHEPQ
    STVLDHNVIPGLSILNLIFFILCTFVQFLGGWYFYVQAYKSLRHGMANMDVLIVLATSVAYVYSLVILVVAVAEKAERSP
    VTFFDTPPMLFVFIALGRWLEHVVKSKTSEALAKLMSLQATEATVVTLGEDNVIIREEQVPMELVQRGDIIKVVPGGKFP
    VDGKVLEGNTMADESLITGEAMPVTKKPGSMVIAGSMNAHGSVLVTATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRF
    SGYFVPFIIIISTVTLVVWIGIGFTDFGVVQKYFPVPSKGISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMVGTG
    VAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVSRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVTRYCK
    EELGTETLGCCTDFQAVPGCGISCKVSSVESILAQGERLQGPLTTHLNRVGSNPTETDAATQTFSVLIGNREWMRRNGLT
    VTSDVRDAMTDHEMKGQTAILVAIDGVLCGMIAIADSVKQEAALAVHTLKSMGVDVVLITGDNRKTARAIATQVGINKVF
    AEVLPSHKVAKVQELQNQGKRVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSRRTVWR
    IRLNLVLALIYNLIGIPVAAGVFIPIGVVLQPWMGSAAMAASSVSVVLSSLQLKCYRKPDLARYEAQAHGSMKPLSASQV
    SVRVGMDDRRRDSPRASAWDQVSYVSQVSLSPLKSDKLSRHSGAADDRGDKWSLLLNDRDEEQGI

    >gi|297481472|ref|XP_002692136.1| PREDICTED: methionine sulfoxide reductase B2-like [Bos taurus]
    MARLLRALRGLTLREAPGWAVRGRADCGGFRAGAGSPQAGCLIKRQPALSKSEWQKKLTPEQFHVTREKGTEPPFSGIYL
    NNKEPGMYHCVCCDSPLFSSEKKFCSGTGWPSFSEAHGTSGSDESNTGILRRADTSLGPARTEVVCKQCEAHLGHVFPDG
    PGPAGQRF
    CINSVALRFKPRKH

    >gi|297484331|ref|XP_002694202.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVDITAAGNTSEIQDYLQQLTGARTVPRVFIGQECI
    GGCTDLVNTHERGELLTRLKQIGALQ

    >gi|297485052|ref|XP_002694724.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 isoform 3 [Bos taurus]
    MGGCFSKPKPGSHAPRLPTVELKIEVVLPEKDRGKEELSTGSRGSPRAYQGNGAARHFHADERLPTAHPYPGAQDCVEAA
    VCHVKDLENGQMREVELGWGKVLLVKDNGELHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLDSL
    HKFQVKIEKEKVYIRASKQALQLQRRTKVMATCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHL
    PYDRPKLSKSLDAQPEQLALRPKEFFRAHGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSSPKTLSCKGKDV
    ENVFTIRTPEDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVEVEETPFRRFLGERVGHTLMKMFENNRVKF
    YMQTEVSELRAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGISLDSRGFIPVNKMMQTNIPGVFAAGDAVTF
    PLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEISTVPFLWTAMFGKSLRYAGYGEGFDDVIIQGDLDELKFVAFYTK
    GDEVISVASMNYDPIVSKVAEVLASGRTIRKREVETGDMSWLTGKGS

    >gi|297485048|ref|XP_002694722.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 isoform 1 [Bos taurus]
    MGGCFSKPKPVELKIEVVLPEKDRGKEELSTGSRGSPRAYQGNGAARHFHADERLPTAHPYPGAQDCVEAAVCHVKDLEN
    GQMREVELGWGKVLLVKDNGELHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLDSLHKFQVKIEK
    EKVYIRASKQALQLQRRTKVMATCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSK
    SLDAQPEQLALRPKEFFRAHGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSSPKTLSCKGKDVENVFTIRTP
    EDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVEVEETPFRRFLGERVGHTLMKMFENNRVKFYMQTEVSEL
    RAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGISLDSRGFIPVNKMMQTNIPGVFAAGDAVTFPLAWRNNRK
    VNIPHWQMAHAQGRVAAQNMLAQEAEISTVPFLWTAMFGKSLRYAGYGEGFDDVIIQGDLDELKFVAFYTKGDEVISVAS
    MNYDPIVSKVAEVLASGRTIRKREVELFVLHSKTGDMSWLTGKGS

    >gi|297485050|ref|XP_002694723.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 isoform 2 [Bos taurus]
    MGGCFSKPKPVELKIEVVLPEKDRGKEELSTGSRGSPRAYQGNGAARHFHADERLPTAHPYPGAQDCVEAAVCHVKDLEN
    GQMREVELGWGKVLLVKDNGELHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLDSLHKFQVKIEK
    EKVYIRASKQALQLQRRTKVMATCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSK
    SLDAQPEQLALRPKEFFRAHGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSSPKTLSCKGKDVENVFTIRTP
    EDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVEVEETPFRRFLGERVGHTLMKMFENNRVKFYMQTEVSEL
    RAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGISLDSRGFIPVNKMMQTNIPGVFAAGDAVTFPLAWRNNRK
    VNIPHWQMAHAQGRVAAQNMLAQEAEISTVPFLWTAMFGKSLRYAGYGEGFDDVIIQGDLDELKFVAFYTKGDEVISVAS
    MNYDPIVSKVAEVLASGRTIRKREVETGDMSWLTGKGS

    >gi|297485989|ref|XP_002695287.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MSQAFMNSRVQSGKVVVFIKPTCPYCRRTQKLLSELPFKQGLLEFVDIQILYLIGANGDTDEIQDYLQQLTGARTVPRVF
    IGKDCIGGCTDLVNIHERGELLTRIKQIGALQ

    >gi|297485993|ref|XP_002695289.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MAQTFVNSKIQSGKVVVFIKPTCPYCKRTPELLNQLPFKQGLLEFVSITANSDTNEIQDYLQQLTGARTVPRVFVGKECI
    GGCTDLVNIHERGELLTRIKQIEALQ

    >gi|297488856|ref|XP_002697197.1| PREDICTED: thioredoxin reductase 3 [Bos taurus]
    MRERSWTWRTLLSGEEAVEEAIRAKPLRREKEAEGPARRAWATGVMDAVTREVLTLICQTIKEFQVLLSSITCVPFYPVE
    DIFAGAMEMVDKNHPRSTAWFFFAETSASEKDASGEEPAREALGSREPAPQRGPRTGSPCRGSPRASLQHVAAGAGGPRA
    QWEERGLVQRRHVCHWLRRGRRSGTGLLMAASSRSGPSLDAPAHTGARAGTRCSCVWSLREENAGAFSLQVKELFSSLGV
    DCNILELDQVDEGASVQEALSEITSQRTVPSVFVNRVHVGGCDHTFQAHQSGLLQQLLQQDPAYDYDLIVIGGGSGGLSC
    AQEAAVLGRKVMVLDFVVPSPRGTAWGLGGT
    CVNVGCIPKKLMHQAALLGQALTDSRKFGWEYSQQVRHSWATMTEAIQS
    HIGSLSWGHRLALREKAVTYVNSFGEFVEHHKVKATNEKGQEVLYTAAKFVIATGERPRYLGIPGDREY
    CITSDDLFSLP
    YCPGATLVVGASYVALECAGFLAGLGLEVTVMVRSVLLRGFDQEMAEKVGASMQQLGVRFLRKFVPVEVQQLERGLPGRL
    KVVAKSTEGTETIEGIYNTVLLAIGRDSCTKKLGLEKIGVNVSEKTGKIPVNDEEQTSVSYVYAVGDVLEGKPQLTPVAV
    QAGKLLARRLFGGRSEKCDYVNVPTVVFTPLEYGCCGYSEEKAGEVYQAENLNVYHTLFWPLEWTVAGRDNNTCYAKIIC
    NKLDNDRVIGFHVLGPNAGEITQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKASGLDITQKGC

    >gi|297489525|ref|XP_002697664.1| PREDICTED: plasma cell-specific thioredoxin-related protein-like [Bos taurus]
    MPPPLLLLLLLLLDAGGGRGGARAQEPGSAAADGPPAAGGGGGQDPHAKHLYTADMFAHGIQSAAHFVMFFAPWCGHCQR
    LQPTWNDLADKYNSLEDAKVYVAKVDCTADSEVCSAQGVRGYPT

    >gi|297489527|ref|XP_002697665.1| PREDICTED: hCG2043289-like [Bos taurus]
    MKKPSHVPRLLVQPSQRGSVGSNTSSVERRLVSEKQAPQAFTRKATRQLFGQQEWSCSLKFFKPGQEAVKYQGPRDFQAL
    EKWMLQTLNEEPPTPEPAVEPPRTPELKQGLYELSAGNFELHVAQGDHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSETV
    KIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLDSLREYVQSQLQSAGPAAPEPTQPSEAPALAAEPAAD
    QGTVLALTERNFDDAIAEGVTFIKFYAPW
    CGHCKDLAPTWEDLSKKEFPGLAEVTIAEVDCTAERNLCSKYSM

    >gi|297489962|ref|XP_002697967.1| PREDICTED: erv1-like growth factor-like [Bos taurus]
    MAAPGERGRFGAGILFSFLPGGARSEVTDDLVTDARGRGAGRREATASARAPSAGPASDPPVSEFSPRRPCRACVDFKSW
    MRTQQKRDSKFREDCPQDREELGRNSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYP
    CEECAEDIRKRIYRDQPDT
    RTRVSFTQWLCRLHNEVNRKLGKPDFDCSLVDERWRDGWKDGSCD

    >gi|297490155|ref|XP_002698029.1| PREDICTED: Protein Disulfide Isomerase family member (pdi-2)-like [Bos taurus]
    MELLCMSLLLVASCVGTVQGSPEMNGKKESINMSQPLHILVEENLMVLTPAGLTQMLNETRFLMVLFHNPSSKQSRSLAE
    ELGKAVEIMGKGKNGIGFGKVDVTVEKELQKEFDVKKAPELKLFFEGNRSQPISCEGVVESTALVVWLRRQISQKAFLFS
    NSNEIAEFVNSRPLVIIGFFQDLEEEVAELFYDMIKDFPELTFGAISIRHAIGRYHVTLDSVIVFKKGRIVNRQELINDN
    VNKQILNKLIKEQLTDLVIEYNTESRDLIYELNILNHMLLFVSKSSESFRIIMQHYKLASKIFQNKILFILVDTDVPRNR
    RVFKYFQIREVDVPCIQIINLSSDARYKMPFEEITYENLRNFGQSFLNRKAKKHLSSEEIPNYWDQGLVKQLVGKNFNVV
    VFDKERDVFVMFYAPWSQK
    CMVLFPVLEELGRKYQNHSTVTIAKIDITANDIELTYQDRYPFFRLFPTDSQKAVLYNGEH
    TLKGFSDFLESQIKIQIEDEDELLSVEQSEETEKKVLAEEKEEHFMKKELPEQNLPELENVTKLEGPTEQKEKAEEEKVA
    EPKEPPTQAEKPRMKEEL

    >gi|297490950|ref|XP_002698516.1| PREDICTED: glutathione-S-transferase omega 1-like [Bos taurus]
    MSGGTVRSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLRAKGIRHEVININLKNKPEWFFKKNPLGLVPVLETSLG
    QLIYESAITCEYLDEAYPGKKLLPGDPYEKACQKMVFESFSKVPSLMVSFLRKQNKEDCSGLKEELHKEFSKLEEVLTNK
    KTTFFGGSSLSMIDYLIWPWFEWLEALELNECVDHTPNLKLWMASMKNDPIVSSLPTDVKTLQDFFNLYLQNSPEACDYG
    L

    >gi|297490952|ref|XP_002698517.1| PREDICTED: glutathione-S-transferase omega 1-like [Bos taurus]
    MTDDATRTLGKGSIPPGPVPEGVIRLYSMRFCPYAHRTRLVLRAKGIRHEVININLRNKPEWYFTKHPFGQIPVLENSKC
    QLIYESVIACEYLDDAYPGRKLYPYDPYERARQKMLLELFYKVPHLTKECLVALRCGRDCGDLKLALRQEFCNLEEILGY
    QNTVFFGGDCISMIDYLFWPWFERLEVYGIADCVNHTPALRLWIAAMKQDPTVCSLLTDKNTFLGFLNLYFQNNPGAFDY
    GLSC

    >gi|297491003|ref|XP_002698560.1| PREDICTED: DnaJ (Hsp40) homolog, subfamily C, member 10-like [Bos taurus]
    MGVWLNKDDYVRDLKRVMLFFLVMYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKV
    NRAYEVLKDEDLRKKYDKYGEKGLADNQGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CSH
    CHDLAPTWRDFAKVVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLMNFAMQHVRSTVTEL
    WTGNFVNSIQTAFAAGIGWLITFCSEGSDCLTSQTRLRLSGMLDGLVNVGWVDCATQDNLCKSLDITTSTTAYFPPGATL
    NNKEKSGILFLNSLDAKEIYLEIMHNLPDFELLSANSLQDRLAHHRWLLFFQFGQNENSNDPELKKLKTLLKNEHIQIGK
    FDCSSAPDVCSNFYVFQPCLAVFKGQGTKEFEIHHGKKILYDILALAKESVNSHVTTLGPQNFPANEKEPWLVDFFAPW
    C
    PPCRALLPELRKASKHLYGQLKFGTLDCTIHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFVEDLMNPSVIS
    LTPTTFNELVKQRKHDEVWMVDFYSPW
    CHPCQILMPEWKRMARTLIGLINVGSIDCQQYHSFCAQENVRRYPEIRFFPQK
    SNKAYEYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVLQGKNHWVVDFYAPW
    CGPCQNFAPEFELLARTLKGK
    VKAGKVDCQAYAQTCQKAGIRAYPTVRLYPYERAKRNTWGEQIDSRDAKEIATLIYEKLEKLQNHEKRDKDEL

    >gi|297491089|ref|XP_002698630.1| PREDICTED: O-6-methylguanine-DNA methyltransferase-like [Bos taurus]
    MCGDRDSTDVTLEHDGREQCLLSLLLSALPLSPHFDRDPVLRRRGTRMSRGQPVTWRRNDLPVSPGKLGEGVCFISEEAE
    LKGDAVSPALQQADQLTQVSGGVLNGGLLLPLEEPSGTQGGAIRPASLRRGRCRPGRRRRIAHAPTWHGARRRGGRAHPR
    PRPCPPGSRPRRRARPVRRPRSPGLTPAPDPAPNLGLVPPLRVLAALPPNPGSRGPRTHCQVPPPGLGPAPAPRPSPGLP
    GLHRRCVVLRSELLAVGGLGSASERAVSSEHLPGQPPVNTGAIVLRAELNCTVSVLGRMDETCEMKYKVVDSPLGKLEIS
    GCERGLHGIKLHGGKTPDTGPAEAAAPAEQLGGSGAVLEPLLQCAAWLDAYFREPAVLEGLPVPALHHPIFQKESFTRQV
    LWKLLTLVKFGETVSYQQLAALAGNPRAARAVGGAMRSNPIPILIP
    CHRVVCSSGAMGNYSGGVGVKEWLLAHEGRPAGK
    AARGGGSRATGSWRGALGSTASSQPAGRD

    >gi|297491407|ref|XP_002698843.1| PREDICTED: ERO1-like beta (S. cerevisiae) [Bos taurus]
    MSPGVRRAGSGQGAAAAVQLLVTLSFLPSVVEAQVTGVLDDCLCDIDSIDNFNTFKIFPKIKKLQERDYFRYYKVNLKRP
    CPFWAEDGH
    CSIKDCHVEPCPESKIPVGIKAGNSNKYSKVANNTKELEDCEQASKLGAINSTLSNQSKEAFIDWARYDDS
    QDHFCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLC
    LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNMKEFKRRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPY
    FERSIVDLYTGNVQEDADTKTLLLNIFQDTKSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWG
    KLQTQGLGTALKILFSEKEIQKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKVLLQHSR

    >gi|297492966|ref|XP_002700025.1| PREDICTED: ATPase, Cu++ transporting, alpha polypeptide [Bos taurus]
    MDLSVSVNSVTISVEGMTCSSCVWTIEQQIGKLNGVHHIKVSLEEKNATVIYDPKLQTPKTLQEAIDDMGFDAILHNPKP
    LPVLTETVFLTVTASLVPPWDHIQSTLLKTKGVTDIKISPQQRTAVVTIIPSIVNANQIVELVPDLSLDTGTLEKKSGTC
    EDYSMAQPGEVMLKMKVEGMT
    CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATVVYQPHLITAEEIKKQIEVVGFTAFIKK
    QPKYLKLGAIDIERLKNTPVKSSEGSQQKSPSYTSNSTVIFTIDGMHCKSCVSNIESALSTLQHISSVVVSLENKSAIVK
    YNASLVTPETLRKAIEAISQGQYRVSSASEIESTSNSPSSSSLQKSPLNIVSQPLTQETVINIDGMTCNSCVQSIEGVIS
    KKAGVKSIQVSLANGKGTVEYDPLLTSPETLREAIENMGFDASLSDTNEPLVVIAQPSSEMPLLTSTNEFHTKMMTPIHD
    KEEPKTSSKCYIQVTGMT
    CASCVANIERNLRREEGIYSILVALMAGKAEVRYNPALIQPPVIAELIRELGFGSTVIENAD
    EGDGVLELVVRGMT
    CASCVHKIESTLTKHRGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSASH
    LDHKREIRQWRRAFLVSLFFCIPVMGLMIYMMVMDHHLASLQHNQNMSQEEMINIHSSMFLERQILPGLSIMNLLSFLLC
    VPVQFFGGWHFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPVTFFDTPPMLFVFIALGRWLEHV
    AKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMP
    VAKKSGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVIVSIATLLVWIIIG
    FLNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKV
    VVFDKTGTITHGTPVVNQVKVLVESNRISRNKILAIVGTAESNSEHPLGAAITKYCKQELDTETLGTCIDFQVVPGCGIN
    CKVTNIEALLHKNNWKIEENNIKNASLVQIDESNEQSSTSSSMIIDAQFSNALNAQQYKVLIGNREWMIRNGLAINNSVN
    DSMTEHERRGRTAVLVAVDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPS
    HKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFV
    FALIYNLIGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHARNQMGQKSPSEISVHVGI
    DDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVGTSEPDKHSLLVGDCREDDDSAL

    >gi|297493450|ref|XP_002700419.1| PREDICTED: glutaredoxin (thioltransferase)-like [Bos taurus]
    MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVGITAAGNTSEIQDYLQQLTRARTVPQVFIGQECI
    GGCTDLVNMHERGELLTRLKQIGALQ

    >gi|297470521|ref|XP_002684004.1| PREDICTED: arsenate reductase-like [Bos taurus]
    MTDITIYHNPACGTSRNTLALIRNSGAEPTVILYLETPPSRDELKKLIADMGIGVRDLLRKNTEPYEQLGLAEDRFSNDE
    LLDAMLAHPILINRPVVVTPLGTKLCRPSEVVLDILPDPQQGAFTKEDGEAVIDEHGNRVSH

    >gi|115497544|ref|NP_001068714.1| methyltransferase-like protein 2 [Bos taurus]
    MDCSFPEGDPAAVCGKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAEAERKVQENSTQRVCQEKQADYEINANKYWNN
    FYKIHENGFFKDRHWLFTEFPELAPSQNHLKNLLSENKRSEVYEYYRSGEDGPDLTIEEQHRCSSVSLGDKTQPPLTEES
    VTQKLHHLEICANEFPGSSATYRILEVGCGVGNTVFPILQTNNDPSLFVYCCDFSSTAVELVQTNSAYDPSRCFAFVHDL
    CDEDKSYPMPENSLDVIILIFVLSAIVPDKMQNAINRLSRLLKPGGIMLLRDYGRYDMAQLRFKKGQ
    CLSENFYVRGDGT
    RVYFFTQDELDTLFTTAGLEKVQNLVDRRLQVNRGKQLTMYRVWIQCKYRKPLGSSTG

    >gi|62460486|ref|NP_001014897.1| thioredoxin-like protein 4B [Bos taurus]
    MSFLLPKLSSKKAVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTPVYTHYFDISYIPS
    TVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

    >gi|134085769|ref|NP_001076889.1| thioredoxin domain-containing protein 11 [Bos taurus]
    MSECGGRGGGGGSSSSSDDAEDEGGGGGPAGSGSLSPAPAASSEGRLRRGLRGASLMARRRPELLCGAVALGCALLLALK
    FTCSRAKDVIIPAKPPVSFFSSRSPVLDLFQGQLDYAEHIRRDSEVVLLFFYAPWCGQSIAARAEIEQAASRLSDQVLFV
    AINCWWNQGKCRKQKHFFYFPVIYLYHRSFGPIEYKGPMSAVYIEKFVRRVMKPLLYIPSQSELLDFLSNYEPGVLGYFE
    FSGSPQPPGYLTFFTSALHSLKKDYLGTVRFGVITNKHLAKLVSLVHSGSVYLHRHFNTSLVFPREVINYTAENICKWAL
    ENRETLVRWLWPHGGKSLLLNNELKKGPALFVFIPFNPLAESHPLIDEITEVALEYNNCHGDQVVERLLQHLRRVDAPAF
    KSLAPDPPARLPDPPLITASPCCNTVVLPRWHSISRTHNVCELCVNQTAGGLRPSSVSMPQCSFFEMAAALDSFYLKEQT
    FYHVVSDSIECSNFLSFYSPFSYYTACCRTINRGVAGFIDSEQGVFETPPVAFSSLEKKCEVESPGSVPHIEENRYLFPE
    LETSSSSFTGLSCRTNKTLNIYLLDSNLFWLYAERLGAPSAARVKEFATIVDVKEESHYILDPKQALMKFTLESFIQNFS
    VLYSPLKRHLIGSDSTQFTSQRLITEVTTDTFWEVVLQKQDVLLLYYAQWCGF
    CPALNHVFIQLARLLPSDTFTVARIDV
    SQNDLPWEFMVDRLPTVLFFPCNRKDLSVKYPEDLPITLPNLLRFILHHSDPASDPRNLAGPPTAECLQNEAVLQQGHIA
    HLEREIRKLRAEIGTLQRAQVQVEARLASARRDEHRLLRQQHTLERQHDLLRLHSEQLQALYEHKTRELDEVARKLQELA
    DASETLLTENTWLKILVATMEQRLEGRDGADDRVPPSKARSEHPEPPGAPRLPASTPLPANISSTLASEGSPENRTD