Aspergillus niger CBS 513 88 uid19263

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145228757|ref|XP_001388687.1| hypothetical protein An01g02500 [Aspergillus niger]
    MSHKVHDITSKAEFAEKVTNSTDAIVLDCFATWCGPCKAISPKVEEFSNTYPNAKFYKIDVDELSEVAAELGIRAMPTFL
    LFKDGKKFDDLTGANPKGLEQKIQALLA

    >gi|145228817|ref|XP_001388717.1| hypothetical protein An01g02830 [Aspergillus niger]
    MASLLPLRRAPTSLLSSTSKQSTLLVRSLRASTTIPSTRTFTTRSSTLLPNTITKRTTITPISRPHHHLLISSTSIRQKS
    TKDNDAPTFRQWGFEDINASLPNSPTEKPIILIDVREPAELSSTGIIPSAVSVPLASQPDALFLTPEEFETRFGFPKPGV
    KGDEEGAEIVFY
    CKAGVRARAAAQLAEQAGYEASRLGVYDGSWLDWAKKGGRVERWEGNDN

    >gi|145229125|ref|XP_001388871.1| hypothetical protein An01g04440 [Aspergillus niger]
    MHNHLPRITIKYCTQCKWLLRAAYFAQELLSTFSTQLGEVALVPATGGTGGEDVDITGTILWDRKTNGGFPEVKVLKSLV
    RNVVDPSRDLGHTDRALRAANVPVQSRDGDEKVVGKSQEQESTTAAAATATKGEEKCEECQ

    >gi|145229157|ref|XP_001388887.1| PDI related protein A prpA-Aspergillus niger
    MLQPSSALLFVTSLLAALPVNADGLYTKKSPVLQVNQKNYDQLIANSNHTSIVEFYAPWCGHCQNLKPAYEKAATNLDGL
    AKVAAVNCDYDDNKPFCGRMGVQGFPTLKIVTPGKKPGKPRVEDYKGARSAKAIVEAVVDRIPNHVKRATDKDLDTWLAQ
    DEESPKAILFTEKGTTSPLLRALAIDFLGSIQVAQVRNKETEAVEKFGITEFPTFVLLPGGGQDPIVYDGELKKKPMVEF
    LSQAAAPNPDPAPKGSTAPRDNNKKKSTEPSPDSKIVSDEAKPASVPIPAPPIGTLPTAEALEAACLMPKSGTCVLALLP
    EPSEPDAELPAPAKDALLSLAEISHKHAVRKSKLFPFYSVPAINSGAKTLRAGLGLPEDNSVEIVAVNGRRGWWRRYDSV
    EGAEYGQERVEAWIDAIRLGEGEKQKLPDGVVVEEVVEEKVEEKVEEVVEEPVEEKPAVDHDEL

    >gi|145229651|ref|XP_001389134.1| hypothetical protein An01g07100 [Aspergillus niger]
    MATQNQIQKQYHTKATGLAAQTVAHRSQDNELKLYGSCFCPFVQRVWVGLEIKGIPYQYIEVDPYKKPQSLLDVNPRGLV
    PALRHGDWGSYESSVLLEYLEDLNVGTPLLPPGDAKLRAHCRLWTDFINRYIVPNFYRVLQEQDTHKQITNAQELRDAFN
    TLVGAADAQGPFFLGAQISFVDVQVAPWIIRLRRALKPYRGWPDPEPGSRWGAWVDAIENNEHIQATTSTDELYLDSYER
    YAQNRPNTSQVANAINSGRGLP

    >gi|145229855|ref|XP_001389236.1| hypothetical protein An01g08110 [Aspergillus niger]
    MAASSSALLGAGNHGASSDRSAAHMATTTVNVEGMTCGACTSAVEGAFKGVEGAGEVTVSLMMGRAVVHHDPTLLPAEKV
    AEIIDDCGFDATVVSTDSASTPADGSRGARDKVFQLSTTTLAVEGMT
    CGACTSAVEGGLKDTPGVHSVNVSLLSERAVVE
    HDPSLVAPDQIAEIIEDRGFGAKVLETSTEESAVRTSEDLPGSTSGLMVTTVSIDGMT
    CGACTSSIQNAFSGVDGVVQFN
    ISLLAERAIITHDPTTLTSKQIVSIIDDAGFDTTVLSSEAQAPMSRGLSRVTLSLHGLRDAASASALEDTLLQNPGISSA
    SVKMANSQITLSYESSKIGIRSIVELIEKAGYNALLSQSDDTNAQLESLSKTKEVREWKRSFLFSASFAVPVFLINMLLP
    MYLPVLDFGRVRLCSGLYLGDVACLLLTIPVQFGIGKRFYVASYKSLKHRSPTMDVLVMLGTSAAFFYSVFTMVVSLLSD
    NDIRPSTVFDTSTMLITFITLGRWLENRAKGQTSAALSRLMSLAPSMTTIYDDPIAAEKLAEEWGNPNEKPKEHSSSTTE
    ERAGPGHKLIPTELIEVGDVVLLHPGDKVSADGIIIRGESYVDESMITGEAMPIHKAKGSVVIAGTVNGTSSMDFKVTRA
    GKDTQLSQIVKLVQDAQTSRAPIQRMADVVAGYFVPAIISLGLVTFFGWMFMSHILPHPPKIFLSENNGGKFMVCLKLCI
    SVIVFACPCALGLSTPTAVMVGTGVGAQQGILVKGGAVLEAATKINHVVFDKTGTLTTGKMSVAEAKIEPHWTSNDWRRR
    LWWLIVGLAEMSSEHPIGRAIFSAAQSESGHPGEGGLPGSLGDLEACVGKGISALVEPTSSAERIRYRVLVGNLAFLRSR
    DVLVPETAESDDSDIAPKSKVPAGITQIHVAIDGQYAGSILLRDTVKVTAPAAVAALHRMGITTSLITGDAHATAVSIAS
    AVGIPTEAVHASVSPSDKQSIVASMQDSGDRVAMVGDGINDSPALATASVGIALASGTDVAVEAADIVLMRPDDLLSVPA
    SLSLSRSVFNRIKLNLMWACLYNVIGLPFAMGLFLPFGFMLPPMAAGAAMALSSVSVVVSSLLLKFWQRPGWMDAEKLQK
    DIELSSDGSFNASKKSWWEATLSVTGSSSHRRSSSSSWVREFVSDTWSFMTGRKRRGSNADEGLYVPLQTVEPPV

    >gi|145229941|ref|XP_001389279.1| hypothetical protein An01g08570 [Aspergillus niger]
    MVHTNVVIIGSGPAAHTAAIYLSRAELKPVLYEGMLANGTAAGGQLTTTTDIENFPGFPDGIGGGELMENMRKQSVRFGT
    EVITETITKVDFSQRPFKLWTEWSDGPTDEPAHTADAVIIATGANARRLNLPGEEKYWQNGISA
    CAVCDGAVPIFRNKPL
    FVIGGGDSAAEEAMFLAKYGSSVTVLVRRDKLRASKAMANRLLSHPKVTVRFNSVATEVLGEEKPNGLMTHLKVKNVVSG
    EEEVVDANGLFYAVGHDPATTLVKGQIKLDEDGYIVTQPGTSYTSVEGVFACGDVQDKRYRQAITSAGSGCIAALEAEKY
    IAERESGEEPATSTEKAAIKPATQEVNGEVKQDAQGAAAEYKSNPLL

    >gi|145231403|ref|XP_001399183.1| hypothetical protein An02g00450 [Aspergillus niger]
    MEGKHLEPLAVVGISLRFPGEAVTPGAFWDLILSGRAAAKEVPPDRYDIEAWYDPDYSHLDRVSQRKANFLEGDIGHFDA
    GFFSISAAEAEAMDPQQRLALEAAYHALENAGYPIESITGSRMAVFTGAFGNDYQRLHAKDLMTLPKGHATGTSMNMLAN
    RVSWFFNLRGPSANVDTACSSSLMALHLACQSIWNGESSMGMAIGCNAILGLDTVMALDNLGILSKDGRSYSFDQRGNGY
    SRGEGVGALVVRPLREAIKNGDSIRALIRSTGSNQDGKTPGITQPSMQRQEDLYRDTYERAGLSLDVTRYVEGHGTGTAV
    GDPIEARAIGNIFLLSGSVKSTIGHLEGASGIAGVLKGILAVEKGIIPPNTDLQTLNPRIHEEFLHVKVPRKAIPWPVDG
    TRRASVSSFGFGGTNVHIVLDNAPGGLVSDDPDRQRNINGPAISTPGRTVMESSNVTRVLVWSFADKDGITRLPETWKPF
    FSGLNIKPDERSDYLARLAHTLSTRRSCLEWRAYAVTQPSDDWATIPDNIVSPGQSTPSPNIAYIFSGQGAQWYAMGREL
    LAAYPTFRNSIQEANDYLQTLGCQWNLLDALQESELESSVNLTDHSQTLCTALQVALVDLLEQLGIYPKKVIGHSSGEIA
    AAYSTRAISRRDAWRIAFYRGLWSSNLEKHSYVQGRMLAVALNEKEVITYFDKVIKNHILLRLTVACINSPNSTTVSGEE
    SQIEDLKSLLDADQIFCRRLKVQVAYHSFQMHEIAAQYEAAIGPLEKMTDELEGYDTLRTSKYWARNLVSPVRFSEALGV
    ACASAVSPPNKLDGSHCKSLQIHHVVEIGPHSALQGPTKSILTALKRTSVHYLSVLKRDVSATSTLLDAVGYLWASGHDV
    DLAVLNQVSQTKSTKLGNKSLCLNDLPEYPFNHTKSYWHESQISRNIRMPPFGKHELGTPDPSWNPHQPRWRHIIRTSSI
    PWVQDHQVNGSVVYPGAGMILMAVEAGKQLCRDGRQIYSFEVLDTTLHAAIQIPGHGDVETSFSMQPVSSRRAKNSDFFE
    FGLYTALVSSWTTNCTGSIRVTYEAQEPDPIKNSQVHQMLNTQHQQSLLQAQQNCGSTMDISTLYKNLRQCGYEYGESFQ
    GITALSYNPKDTKMVVGAVHHRLITPPSTLHPTALDAMFQTLLCANAGCGDKTVPTYVPTHIKSLQLLKDGLPDASETFQ
    ILAKGDFASSTEVVGSITAFGADSRHPLVLVDGLKCTMLDGVRSSSEVATTGGTICSEIEWKPDVRLLENAAVEDYCRGK
    LTESASHNLLIELDFVVLARVLEAYRLFTLQKKQPAKPYLEKYLQWAAHQKHRLEQNELLYSSEPWKSRLQDWKYIHDVE
    SRLLDKAPITRLPVNVGRSLLDFLTGALDPLEFFFSGTMVDDYYEGTMAVADFGTSLPRFMDLMAHTNPGMNILEVGAGT
    GVATGACLRALGASGHTSGSRYTRWDYTDISRSFFGKAATRFAEEGSRIQFKKLNIEEDPEEQGFEAGSYDMIVAGWVVH
    ATHNLQRTLTNIRKLLKPGGKLVLAEVTNPFRSAASFGLLEGWWLSSESYRVYGP
    CVDRARWHDVLRRTGFTGCDVYLPD
    FDGQSFQEHAVFVSTAQESHVPSCWNPSIEIVYEPNEPKQGELARFLEQGCQSLTKSRVARVSVDKASTDTQDMLRIFTL
    DIEKSSLYNMGPTMWPMLQKLFTSSATTLWVSKGSDTLVTNPNLHLIEGIFRVLTHEDGRKIDIFSQGLDTEYVVRDGVI
    LNPRLIDSAQLNREVSLQLAEQIERERKFGDILLCLDSSSSSIADGFRFIEAKSAPVLKDTDVELEIHCAGLNFRDVLLS
    LGQIPYAEAWQEGAGVVTRVGSKCTRFKPGDRVVGFVPQPFQARTVFREDTPVVHIPPGLSYAEAAGIPTSFLTAWFSLI
    EVGRIKTGESVLIHSGAGGTGQALIQIALYHAEIYTTVGTEEKKRLIMDRYPIPEDHIFSSRSTDFAPTIMQLTDGKGVD
    IVVNSLSGEGLVQSWECTASYGRFVELGKKDILANAKLPMRRFLKNVTYSCFDLALLQQNHQRGSRASLETVMSLMNEGK
    LTPQDPTHVYGVGEIEKAYRHMQSGKNFGKIVIEMRKEDIVKTLLKSKPNSSFDSNATYLVAGGLGGLGQSMLTWLVNRG
    ARNLLLLSRSGGKDADAQEFLSQLRGDGVNAQVRACNVADEGAVRAAIDDAALNMPPIKGYVGFEDMSYSDWQTAINPKA
    QGSWNLHKLLPRGLDFFLMLSSMNGIVGHVGQANYAAGNTFQDALAHHRVQCGENAASLDLGLFTFSGRVARDPRLLKIM
    LDVFPHKPITEPEFHALLDVYCNPTLCKEKGLPCQPSFGMRPHEGAATKAYWLERPMFRYMAQQRSSEGNRERQGQSINL
    ASAFRGAESLADATAAVTKALTVKLARTLSVEEGSLDENKALHQYGVDSLVAVELRTWFSKEVQADVATFDIIGRATITS
    LAGVAASRSKLPRGWS

    >gi|145232474|ref|XP_001399682.1| hypothetical protein An02g05450 [Aspergillus niger]
    MAATGAPQRWKHLYSVLTKSGPFSDEDWVPGQETISALESSKILGAGGLGCEILKNLALSGFKDIHVIDMDTIDISNLNR
    QFLFRQSDIGKPKAEVAAAFVERRVKGVKITPYVGKIQDKDEDYYMQFKIIVCGLDSIEARRWINSTLVGMVDFEDPESL
    KPLIDGGTEGFKGQARVILPTLSSCIECQLDMHAPRPAVPL
    CTIATIPRQPQHCIEWAHQIAWQEQRKDDAFDSDDMEHI
    GWVYNAALERAKQFNIPGVTFQMTQGVVKNIIPAIASTNAVIAAATTSEALKIATSCNPYLENYMMYAGEEGVYTYTFEA
    EKKPDCPVCGNLARKLTVNPNMTLEEFIETLGERPEAQLKKPSMRTEEKTLYQRFPPQLEEQTRANLKLKLKDLIEDGQE
    IAVSDPAYIIDFRFRLAFQ

    >gi|145232565|ref|XP_001399725.1| hypothetical protein An02g05890 [Aspergillus niger]
    MRVSLLAWSLLSLLSIPALAAPSDNVSPSHHLVKRGDSDVKSEGQSTTFNGIEVPPMKALTPDNFDDTIKDGYWFVKQYS
    PS
    CPHCQKIAPTWQTLYEFYYTSDPLSSPSSKSSNTDSLNSFHGFYNFHFAEMNCLAHGDLCRKLDVKYFPTFALYHNGE
    LVEQYTGKKSMEGISEFVEEKLEQIKPGSRPAQGLHLPKPGDKGVDTQAQPEAPVAKDKDREAGTKAGEKHNEQAAQLAE
    DETPADKASIKSKTKPKPAPANPQGISVPLTAESFQKLVTTTQDPWFIKFYAPW
    CHHCQALAPNWREMAKEMQGVLNVGE
    VNCDAESRLCKDARVSGFPTMYFFRGGERVEYTGLRGLGDLVSYAKKAVDVGSGVQDVDATTFKELEEKEDVIFLYFYDH
    ATTSEDFEALERLTLSLVGHARLVKTNSAALAERFKISTWPRLLVSRDGRPSYYNALAPKDMRDFRQILNWMRTVWLPIV
    PELTASNAREIMDGKYVVLGILSRKHSDEFLQSKRELKNAALEWMDKQTQLFQLERAELRDAKQLRIEEAEDRNDQRALR
    AAKNMRITIREDDKKQVGFAWIDGDFWERWLRTTYGIDVENGERVIINDQDNRRYWDTSSSGASIMASRTSILETIPLVI
    ANPPKLTPKSTVGTFESVFFFTRTFISGHPIIFFILLTLSVAGATIVARGRSLRRGARGGILGVTGNTGGGFFNLDGKEG
    LLNGGSTGKVD

    >gi|145233143|ref|XP_001399944.1| hypothetical protein An02g08110 [Aspergillus niger]
    MSSATTFYDFEPVDKKGSPFPLIDLKGKVVLVVNTASKCGFTPQFQGLEKLYQDIKAKHPEDFTIIGFPCNQFGSQDPGS
    DDEIQSFCQINYGVTFPVLGKSDVNGDKAAPVWTWMKEQQPGLLGLKRIKWNFEKFLISADGKVVGRWASLTKPESLEEP
    ILKEIEKAKKEGSLASLKKEEAKAEEATA

    >gi|145233267|ref|XP_001400006.1| hypothetical protein An02g08720 [Aspergillus niger]
    MSPTAADTNSRVPAGQDSRLLRSIFFVSNIHCSSCVAYINEVLSDIDGVRDIDVSVLTHEVRVFHSTETDPSRLASALVE
    AAFEVHHVTTYEPRGSVISELDTTSWLPRDSVLFSTQPNINRVPALGSRHVDNCDACRKEELDSLAAGEDLADAARRPRD
    RYSGLRTGGKPGPSQSEVQSLVARESVEDVTPVESPKTPHHPEEKERFNARVSIGGMS
    CASCANSITNEVKELDFVEDIT
    VNLLTNSATVVFTGPQSNIDKVVEQIEDIGFEASLDEVNMIKTAPARKEAPSTFVAELAIGGMTCGSCSGAVTRGLEELP
    FVTTVSINLLTHSGRVEFEGRDHIDEIVEKIEDLGYDASVDNVTALVADSHDEPLEERTLSIRVDGMFCHHCPDKVVKSL
    EAFPDVKVEGNLSVKNPILAVTYTPKPPSLTVRSILRTIESAHDAFTATVYRPPSVEDRSRAMQRHERRRLFTRFIFVLL
    VAIPTFILGIVFMSLVSSNNKVRKFLEQPMWAGDASRLEWALFIMTTPVMFYGADIFHVRAMKEIYSLWRPGSRAPLLRR
    FYRFGSMNLLISAGTTVAYVSSLAVLIMDAAMGSASNTHSSTYFDTVVFLTMFILAGRFMEAYSKAKTGDAVASLGKLRP
    TEALLRISASDADQPGDENTHAEDGYERINIDLLEIGDVVSIPHGASPPADGVVVGSASYQFDESSLTGESKPVHKSAGD
    QVYTGSVNVGQPVEVKVTAIGGSSMLDQIISVVREGQSRRAPLERVADLLTSHFVPIITLIAILTFVIWLALGLSGTLPD
    DYLDVARGGWTFWALEFAIAVFVVACPCGLALAAPTALFVGGGLAAKQGILVKGGGEAFQEASRLDAIVFDKTGTLTEGG
    SLQVSEHEALISDTDVIQVAWTLARKLEESSNHPIARAISAFCKEKPSVTITSADIEERSGQGMKGTFAVSMPNPNEKSN
    TPTQYEAAIGNQRLLHSLATSDYDESHLSKTLSKYQAAGKSTAILSLRSQNEPSFTPAIVFAISDTIRPDTVEVISKLQK
    RKVNVYMCTGDNQTTAHAVADMVGIPRSNVMANVMPAGKADFVRQIQDSNNNFTPQTDSEAESQRAPTNNRSIVAFVGDG
    VNDSPALAAADVSIAMASGSDVAMNSASFILLNSELDTILQLVLLSRRVFNRVKLNFGWALVYNCCLVPVAAGVFYPIVS
    GHKQEMVGGELVVTDTHWRFSPVWAALAMALSSISVVCSSLALGISRRSIKRVFGLGA

    >gi|145234192|ref|XP_001400467.1| hypothetical protein An02g13360 [Aspergillus niger]
    MASTMRSMRRILTRASRSAVSPIEHTAALRTPAGLFSANLRAANNSSTSNVGVRRSFSTSPLCLRARTMGQLKARHSTGP
    FSWKAALLFVLTGGGMIIYFRVEKERLERKRIAEMSKGVGKPKVGGLFTLKDLDGKEFTAEDLKGKYSFVYFGFTH
    CPDI
    CPDELDKMAEIIDKVKEATKGENIFLPVFITCDPARDTPEVLRTYLKEFHPGIIGLTGTYDEVKHVCKQYRVYFSTPRDI
    KPGEDYLVDHSIYFYLMDPDNDFVECIGRQDTPESATRTIMEHINDWKREGKPLKKD

    >gi|145234476|ref|XP_001400609.1| protein disulfide isomerase A pdiA-Aspergillus niger
    MRSFAPWLVSLLGASAVVAAADTESDVISLDQDTFESFMNEHGLVLAEFFAPWCGHCKALAPKYEEAATELKAKNIPLVK
    VDCTAEEDLCRSQGVEGYPTLKIFRGVDSSKPYQGARQTESIVSYMIKQSLPAVSSVNEENLEEIKTMDKIVVIGYIPSE
    DQETYQAFEKYAESQRDNYLFAATDDAAIAKSEGVEQPSIVLYKDFDEKKAVYDGEIEQEAIHSWVKSASTPLVGEIGPE
    TYSGYIGAGVPLAYIFAETKEEREKYTEDFKPIAQKHKGAINIATIDAKMFGAHAGNLNLDSQKFPAFAIQDPAKNAKYP
    YDQAKELNADEVEKFIQDVLDGKVEPSIKSEPVPESQEGPVTVVVAHSYKDLVIDNDKDVLLEFYAPW
    CGHCKALAPKYD
    ELAALYADHPDLAAKVTIAKIDATANDVPDPITGFPTLRLYPAGAKDSPIEYSGSRTVEDLANFVKENGKHNVDALNVAS
    EETQEGGDVTEAAPSATEAETPAATDDEKAEHDEL

    >gi|145234502|ref|XP_001400622.1| hypothetical protein An02g14930 [Aspergillus niger]
    MKLFNLLLSFLCMISSASCGLADTDKFERYRSLSRSAPIELNDSSYEEITSKPRDYHVAVLLTAADARYGCILCREFQPE
    WELIARSWNKGPKPDGLQMLFGTLDFSDGKGTFQKLMLQTAPVLLVFPPTVGPFAKIDDAPLRFDFSGPISAEQLYTWMN
    RQLPEGPKPPLVRPINYMRLVSGITILMGAVTLFTVLSPYVLPIVRNRNLWAAFSLIAILLFTSGHMFNHIRKVPYVAGD
    GRGGISYFAGGFSNQFGMETQIVAAIYAVLSFATIALAMKVPRIADNKAQQVAVIIWGSVLLDEEWGISVFSSAILEDFL
    LTWWINSSSKRRESA

    >gi|145235091|ref|XP_001390194.1| hypothetical protein An03g02980 [Aspergillus niger]
    MSHGKVIEVDNPVIFKALTSNGPVVVDFFATWCGPCKAVAPVVGKLSETYTNVRFIQVDVDKVRSVAQELEVRAMPTFVL
    YKDGQLQEKRVVGGNMKELEAAIKEITA

    >gi|145235197|ref|XP_001390247.1| hypothetical protein An03g03660 [Aspergillus niger]
    MAPTEVKQYDYIVIGGGSGGSGSGRRAAGWYGAKTLIVESGRSGGTCVNVGCVPKKMTWNFASINETLHVAKHYGYDVSE
    NVDKNYRHFKEIRDSTIKRLNGIYERNWGREGIDLVHGRAGFVEPKTIEVTLEDGSKARYTAPHILIAVGGRPSIPDVKG
    AEHGITSDGFFEIEELPPKIAVVGAGYIAVELAGVMGAVGCETHMFIRGETFLRKFDPMIQKTMTERYEASGIHIHKQHP
    GLKEVQLIRDGKGKDKLLKLISNDGSEMEVNELLWAVGRLPEVEDLNLDVPGVKLNKSGHIEVDEYQNTSVNGVYALGDV
    TGHAELTPVAIAAGRQLGNRLFGPDEVRDSKLSYENIPTVVFSHPEVGTVGLTEPEARERYGDDQIKIYHTRFTAMYYDV
    MPAEEKKKNPTEFKLICAGPEEKVVGLHILGLGVGEMLQGFGVAVKMGATKKDFDSCVAIHPTSAEELVTLR

    >gi|145235643|ref|XP_001390470.1| hypothetical protein An03g05910 [Aspergillus niger]
    MNPFSSPLITPAEYHHNATTYNATGSRRIIPLAAYRPTLHSSFESFHLPGSKFFNLDQIRDTASPYPSMLPSPSLFAAGM
    TALGIRKDDILVIYDADEIGTYHAPRLAFMCELFGHKDVHILNNLRRYVRMGLPVGSGSEGIEVPVVGTGREQGDEYVVE
    EGDIDTGRVISFEDVKNSVLGKDQEKGRIVDARIPGRFQGVQPEMDPSLRSGHIPGAVNVPLARLLEDGDAVILATEKLR
    SVLMDAGALAEEDEGMLYILT
    CNSGVTAASLDLALRLVGAKGSRRVYDGSWMEWTRRVGDELIEVS

    >gi|145236086|ref|XP_001390691.1| unnamed protein product [Aspergillus niger]
    MARDTYNLVQSRYGDIAKYSLNTQQSKVEDNIARAFGYTAEDLKVLPEKANLALSCGNPVGFANLKEVWLSSLVPRRHKL
    SPNLLMIELAKKNIQKAGLSNARVIEANINCIPLPDSSVDCIISNCVINLVPAADKERVFKEIARLLKPGGRVAISDILA
    RQPLPNTITQSMALYVG
    CVAGASQIGTYDEYLRQAGFEGVFIVDTKSDLNLYKQSSYLHQSSCCSGACGFDTTSAIEELD
    FNEWVGQLLPSIPG

    >gi|145236679|ref|XP_001390987.1| hypothetical protein An06g01660 [Aspergillus niger]
    MFAARRLTAGVPRALSQRALFHSTAPAFVQKGDAIPDLDVLVENSPGNKVNLAKELKGKGVIIGVPAAFSPACSSTHVPG
    FINHPKLKEAGQVFVVAVNDPFVTKAWATSLDPEGKSGIRFLGDPSGKFSEALDVTFDSASIFGNNRSKRYALLVENGKV
    KEAFVEPDNIGLDVSAAEKVLA

    >gi|145236996|ref|XP_001391145.1| hypothetical protein An07g00520 [Aspergillus niger]
    MTLKLYGFVHSTCTRRVRTALAEKGLDVEIVPVDLAQGEQKTSSYLNDLQPFGKVPVLQDTETGIQIYESRAIAQYIATK
    YRGQGTDLAPPESDLKAFAYYQQALSIEQSYFDPLVSQIAYEKVFKARKGHGQTDEARVQSLFSQLELTLEGYERVLSKQ
    PYLAGQQLTLADLAHLPYGVFIEQFGFTDVVSKFPHVQKWWEGLKARESWKKVTA

    >gi|145237074|ref|XP_001391184.1| hypothetical protein An07g00940 [Aspergillus niger]
    MGPISSLLVSPAELHHLLKAASTAFRIVPVAAGNHSTLPSFESRHVPNSVFFNMDAVKDTNSPYPMMLPSSAQFATYMAE
    RGIRRDDVLVIYDTFETGLRLSPRVAWTCQHFGHKNVHVLNNFANYVKEGFPVASGQMRTPVSSTTSEMDEATSIDPDPE
    ADNKGKFQIIDARPNDLFSGRAAANGASASVRLGHMPSAINVPFDSVLGLDKTFLPPAELRDQFVKWRGREDVPAVLT
    CN
    SGVTAAVVDLALRVAGLNVKTSLYDGSWSEWADRVDEDGLIVI

    >gi|145237106|ref|XP_001391200.1| hypothetical protein An07g01100 [Aspergillus niger]
    MSSPKIVLYTNRTCPWAHRAHIVLQELGLPFQEVTIDLDTPREPWYLEVNPRGLVPSLSYNGEVITESGIVAQFLADAYP
    SHLVPPSNTPEGALQRARIAFFVDTYSSKAAPHYNAALRGATEADRKAGVESYVAAIKKEIEPLLYQGLEGKQHGPFFGG
    SDKLTLVEVLLGSFLIRLHAFADKEADLIDPAIWEGLAEAKNFSRWAQATREHPSVNGIFDAKACADRTKKKLLANRK

    >gi|145238056|ref|XP_001391675.1| hypothetical protein An07g05970 [Aspergillus niger]
    MVNRQSNPATVLTDTGVIFIMVIGVTPEATFVRHRNLKPLCPCLSDQLPNLYPFITELCSLSSELSDTKQRRTVITIHSY
    SPPNTTYQQRTEPVTMALPQVQHQPQEQQQKPTPQPIATTTTTTTTADTKTKMIKKITTHPTLPSHRREIYLALLSVPAG
    RWTTYAALAKHIGTSPRAVGAAMRLNPFAPEVP
    CHRVLGGNGKLLVGYSGAEASGGGKKKAKDGVGMKKRMLEEEGVEFT
    TEGMAKGLCFEGFGLVVFGANITHSPLAQICQKYTMYFDLTLPEALTSLSAIYTVLVTTMTTSLWARALSALPDKDQRMF
    RTSGTASAPVSKTLADIITAIETQRDRCKRHKWSTISIGGKELIIRDVCAKIAACVNKFASVVDVVVSYDPVHAALPWAG
    VRFVLQLFLNGIDTFGAIVEGLETSVRVIARGGILEGLYYQKNSALSEARQALQDEIVKCYTAVLKFLSLARKYYQCSRM
    KRAVNFISKDDLRHCTKEIQSAEQQFLIQKGLADSEDLGNIETNVLHTILIATSTADQVNDMKTKLEKTLLDLDKPLIRV
    VDQVSDLHRALKDNERGQILRWISPVPAQEHYREASASLMPGSGEWLFRHPEFQAWRDSSSSEVLWFWLRKIQDRISAAV
    IRHLRLQASKVQHSLPIVHFFCSTNPAEPERSDAREILRSLIKQLSLSVSKDLMRTPVVEEYRKRLQEATYYGEGPAALS
    VERCTELLCELGQSAPIMLIIDALDECDSQQRTILQQSLEEMRQSCRDLVKIFVSSRYEEDIATGFRHKRTLCVTPHDTE
    DDLRHFIDLHVSRFVSRWAVLHSEASDKLQQLEKSLKETLNTGAQGMFLWVSLQLECISDTSRVKDLESIYEALESLPAT
    LGRSYAAIHCRIESMKETAREVARFTFYWLLGAKRMLPIPDFLIAVARSAKCLSNLQPRTIIDYCCGLVVIDNETNTFRL
    AHPTVREYLESLEIYRGKEVSYSIALACLDAYLGENCVENEFLKYATNYWPSHVEDLGFAPQRAKVVPSLTDFFTKEEHF
    VDWLDNFELQQREGGSSWKSTNERKLDASISTPRTPLFLICCFGFVEILEDDDVVEDLDVNQTNKDGSSGLYLAARGGHI
    MVVQKLLDMGASIDAPGFKYGDALQAACFEGWTGIVQLLINHGASSSVPRRGEYSSPLQAALASDNKSVAEVLLHAGVKL
    TTQQQFDDAIETAAFKGNVPIFQRLMAGEAGDFAPKIRPDPLQVALAGGKMRRAKLLLQSCTDINEEKGLFGNALAAAIA
    SERLSIVQLVLDAGANIELRGRYGFPLRAAVIINNFEITKCLLEKGADPNVIDEELGDALQAAASRGSLEIMSLLLAYKA
    HVRGRGGYFGDTLQAAAFGGHEKAVELLIHHGAKDSLEKPRGRYHSALRAAVYVGHQSIVERLLGAGAKLKAEVICFADC
    CAMITSSLTARMKPRDALPNVIKELRGLDTLSHLGPLELAAQRGNVILLEMLLVEAAHINSSKADSGLLETSTLALQIAA
    FGGRTPAVRCLLAHGVNVNAVQHKTGTALQAALEGEQYHIADLLLSHGADIDEHWTKFGSCLQVFSERGKLEVVQFLLDR
    GANVNDKGGVNGTALQVACDAGHVEVVQLLLQKGADMNAQGKAIGTALHAASANGHLGIVEMLLHHDAKADTVGWNVDTN
    THIALQVACANGRREVVESLLDRGAGVRNTLLCRASENGDTSLMQLMLDNGSLVNPETGPPDSKQLEGRSPTDDSSLTAT
    PLHLAAYRGHESAVTFLLDNGADLHVQGILYPMQEQGHHNSDFDFETNTSSPMQAACYKGNSHIAKLLFTRDPWGHIKHQ
    TFTVALKTSLDRGQHEVQRILLLQAVRSGFRAEQFHEAFCHACLKGYTQFVELIFEHFTVDNWPDAILQAAEDGRAGIVK
    ALLLHGADPKMRNESGDTAISLAIRKMSPYCCGFYDGDPPHYRKTLAALVEAGHVLDKSLSADIPHKILRIIIWGNLELL
    VQLQRSGICLFQEPGTYHEALHLASLGARTEVLRYLWSIRATISSEALCDPPSQTTRQKIWTNRQRLSVSKHMSRRRKRW
    YSRLHIHCEHEIRELGQSESVEYADVISMLVQNDAQAAHLIRKPFEAAIDLEVVESIRVLIELFAKNDMHRTEICTGILS
    QILPLSMELLSFLLSQGGDVNTRYPKNNTTLLHRAAARGDEDALRILISYGAQVSLQSGDQGTALHAAVVGGFHGSVNLL
    LTENAEVDASCTLIGTPLAAVMPRKWKSCCGRYHRSCAEQLIAWGADIDRIDERLGTPMDIAYKAGNNEGVELLLENGAL
    DPKSTAYPLNSDN

    >gi|145238226|ref|XP_001391760.1| hypothetical protein An07g06840 [Aspergillus niger]
    MFRSLLPRATPRVALRCAGPKAVPSTFVAAPSLASFGRTQRGYASESGEHDLVIIGGGVAGYVAAIKAGQEGLKTACIEK
    RGRLGGT
    CLNVGCIPSKSLLNNSHLYHQILHDTKKRGIEVGDVKLNLEQMMKAKDTSVEGLTKGIEFLFKKNGVDYIKGT
    GALVDQNTVKVNLLEGGEQTLRGKNILIATGSEATPFPGLNIDEKRIITSTGALSLKEVPKKMIVIGGGIIGLEMASVWS
    RLGSEVTVVEFLNQIGGPGMDADIAKQAQKILQKQGIKFKTGTKVTKGDDSGATVALSVEAAKGGKEETLDADVVLVAIG
    RRPYTEGLNLESVGVEKDERGRLVIDQEYRTKIPNIRVIGDCTFGPMLAHKAEEEAVAAIEYIKKGYGHVNYGCIPSVMY
    THPEVAWVGQNEQEVKAAGIKYRVGTFPFSANSRAKTNLETEGQVKFIADAETDRILGVHIIGPNAGEMIAEATLAVEYG
    ASCEDIARTCHAHPTLAEAFKEAAMATYSKAIHF

    >gi|145238368|ref|XP_001391831.1| hypothetical protein An07g07560 [Aspergillus niger]
    MSSTSASTPQTATVAAGCFWGVEHLFRKHFGNGKGLLSAKVGYSGGHSASPSYRAVCTGETGHAEALQMTYDPSIVSYRS
    LLEFFYRMHDATTLNRQGPDVGTQYRSVIFTHGDEQEKIAKEVTEKVGKEWFKQPVSTVVVPAGQWWDAEEYHQLYLNKN
    PEGYECPAHFVRSFPPLSE

    >gi|145238772|ref|XP_001392033.1| hypothetical protein An07g09590 [Aspergillus niger]
    MAVPDADVHPEATGAAKALVDRHQAEQPLKLYAGWFCPFVQRVWLVLEEKQIPYQYIEINPYHKEPSFLALNPRGLVPTI
    SVPDPSTNTSKPLYESTVILEYLEEAYPNHRPLLPSDPYQRARSRIWIDYVTSRIIPTLHRFLQYQPSTRGIEGLHQARQ
    EFLSTLKEWAKEIDSSGPYFWGSEVSLPDLVLAPWAFRLWVFDEFKGGLGIPKPGEGGEDEEVWGKWRKWQEAVEGRRSA
    KETTSEAEHYLPIYKSLDNLYRACYYS

    >gi|145238912|ref|XP_001392103.1| hypothetical protein An07g10280 [Aspergillus niger]
    MASQLSDTNEGLSLAELPKSNIFTSKLPPDPAFETPEASHRAPRETLGPRLVRGALYTFVRPEPAEESELLGVSQKAMKD
    LGLKPGEELSPKFKALVAGNDFYWDENEGGIYPWAQCYGGWQFGSWAGQLGDGRAISLFETTNPKTSTRYELQLKGAGRT
    PYSRFADGKAVLRSSIREYIVSEALSALGVPTTRALSITLLPQSKVLRERIEPGAIVARFAESWLRIGTFDLLRARGDRE
    LIRHLATYIAEEVFQGWEALPAMLPLDQSQSSEVVDNPPRHVSWDQVEGPPGSEENRFARLYREIARRNAKTVAAWQAYG
    FMNGVLNTDNTSIYGLSLDYGPFAFMDNFDPQYTPNHDDHLLRYCYKNQPTIIWWNLVRLGESLGELIGAGEDVDKEEFV
    KDGVTEEVAPAIIQRAEKVIDRTGKEFRMVFLNEYKRLMSNRLGLRSQKETDFQVLFSELLDTLEALELDFNHFFRRLSS
    VSLSDIETKEMREKTASIFFHNEGHGGIGYTEDSARQRVGDWLDKWRQRIIEDWGVDQDMERQKIMKNTNPKFLPRGWIL
    DEVIERVERRGDREVLGRVMHMALNPFNEEWGQNHDEEERFCGDVPRFKRAMMCS
    CSS

    >gi|145239063|ref|XP_001392178.1| hypothetical protein An08g00600 [Aspergillus niger]
    MLSQRRIRLLAIAVVVIIIMTFYYSSEARSVQNQQFYRSTVAAMEAQKQAKEAGTAANIPPHKDEPKQNPIKEETKPAMD
    NDKEEPAIPKANNNDADDVEEIPIAGRTKMTVPKNRNDPEKETSEQPQEQKPETDDHAAAVAELNGILKRAPIIIFSKSY
    CPYSAKAKSILLDKYSIVPAPFVVELDKHELGRPLQALLGENTGRRTVPNVLVNGKSIGGGDDVTALDQKDELASTLRSL
    GGKWVQEVHRKE

    >gi|145239789|ref|XP_001392541.1| hypothetical protein An08g04240 [Aspergillus niger]
    MASPSAAMQLSSLSRRSLSTRPQLLRSARPLRQQQFQRSTRRSYADAAPAAPTPKPKKRFRFLRWTWRLTWLSTIGAAGA
    LAYSVYELRHPVEQIKPDPTKKTLVILGTGWGTVSLLKKLDTENYNVVVISPRNYFLFTPLLPS
    CTTGLIEHRSIMEPIR
    NILRQKTAHVNFYEAEATKIDYEKRVVYISDDSEIKGDISHTEVPFDMLVVGVGAENATFGIPGVRENSCFLKEVDDAQK
    IRKRIMDCIETAMFKDQTEDEVKRLLHMVVVGGGPTGVEFAGELQDFFEDDLKKWVPEIQENFKVTLVEALPNVLPMFSK
    QLIDYTESTFKEEKISIRAKTMVKNVTDKYIEAMVTNPDGSKSIERIPYGLLVWATGNAVRPVVRDLMNQLPAQKDSRRG
    LAVNEYLVVNGAENVWAVGDCAITNYAPTAQVASQEGAFLARLFNTMAKTEAIEKELKQLSEAQAQAKGEERDQVFDAIR
    ERQKQLRRTKQIGPFQYSHQGSMAYIGKERAVADISWLSGNIASGGTMTYLFWRSAYLSMCFSTRNRVLVAVDWIKAKLF
    GRDVSRE

    >gi|145239949|ref|XP_001392621.1| hypothetical protein An08g05030 [Aspergillus niger]
    MARPMPVRNLSTDCTRADRLMVRAHMNNPVGWQLWDAEAIDLAKRHNRLIFLSIGYSACHWCHVMEKESFMSQEVASILN
    QSFIPIKVDREERPDIDDVYMNYVQATTGSGGWPLNVFLTPDLEPVFGGTYWPGPNSSTLTGNGTIGFVEILEKLSDVWQ
    TQQLRCRESAKEITKQLREFAEEGTHSYQGDRQADEDLDLELLEEAYQHFVSRYDPLHGGFSTAPKFPTPSNLSFLLHIV
    GRDECAKATAMAVDTLISMARGGIRDHIGHGFARYSVTGDWGLPHFEKMLYDQAQLLDVYVDAFKITHNPELLGAVYDLA
    TYLTTAPIQSPTGAFHSSEDADSLPTPNDTEKREGAFYVWTLKELTQVLGQRDAGVCARHWGVLPDGNIAPENDPHDEFM
    NQNVLSVKVTPSRLAKDFGLGEEEVVRIIRAAKQKLRDYRERTRVRPDLDDKIIVAWNGLAIGALAKCSALFEEIESSKA
    VQCREAAAKAINFIKENLFEKPTGQLWRIYRDGGRGNTPGFADDYAYLIGGLLDMYEATFDDSYLQFAEQLQKYLNDNFL
    AYVGTTPAGYYSTPSTMTSGAPGPLLRLKTGTESATPAVNGVIARNLLRLGSLLEDEGYKTLARQTCRSFSVEILQHPFL
    FVGLLDAIVGLETGTRNVTGVFSTAVTEGSVQASEGVIRKTDEPVCVRDMIVQKIRAEAGLAISTATTTASLVDIRASHV
    GDFVGNQSFWLRTRNPLYRELKASETTKNHLMVCESGRCRIVNIV

    >gi|145242664|ref|XP_001393905.1| sulphydryl oxidase Sox from patent EP565172-A1-Aspergillus niger
    MAPKSLFYSLFSTISVALASSIPQTDYDVIVVGGGPAGLSVLSSLGRMRRKTVMFDSGEYRNGVTREMHDVLGFDGTPPA
    QFRGLARQQISKYNSTSVIDIKIDSITPVEDAAANSSYFRAVDANGTQYTSRKVVLGTGLVDVIPDVPGLREAWGKGIWW
    CPWCDGYEHRDEPLGILGGLPDVVGSVMETHTLYSDIIAFTNGTYTPANEVALAAKYPNWKQQLEAWNVGIDNRSIASIE
    RLQDGDDHRDDTGRQYDIFRVHFTDGSSVVRNTFITNYPTAQRSTLPEELSLVMVDNKIDTTDYTGMRTSLSGVYAVGDC
    NSDGSTNVPHAMFSGKRAGVYVHVEMSREESNAAISKRDFDRRALEKQTERMVGNEMEDLWKRVLENHHRRS

    >gi|145243478|ref|XP_001394265.1| hypothetical protein An11g02640 [Aspergillus niger]
    MRFQGLIPALRTITLPLRSHSVRALQRPPLPIPSATVLKAGPTIPFLGALFGSSAKSDSQSNNMSYPDQRSDDAWQAVLS
    PEQFRILRQKGTERPFTGEYDSHYPSQGVYNCAGCNAPLYKATHKFKSGCGWPAYFDSIPGAVTRHTDRSFGMERTEIVC
    SNCGGHLGHVFKGEGYSTPTDERH
    CVNSVSLRFKEDEGQGN

    >gi|145244929|ref|XP_001394734.1| hypothetical protein An11g07650 [Aspergillus niger]
    MASILPRVGFRALTALPRATPLPRVSLTQLSRVQPRVQPLTRRFLATIPQEQPRLRLGSTAPNFKALTTHGEIDFHEFIG
    NSWAILFSHPADFTPV
    CTTELGAFAKMKNEFEKRGVKMIGLSANDLSSHDQWIDDINEVANTNVQFPIIADADRKVAFLY
    DMVDQRDLDNIAEKGIPFTIRSVFIIDPEKKIRLTMSYPASTGRNSAEVLRVIDSLQTADRKGIATPIDWQVGEDVIVPP
    SVSTEDAKKKFGEVRELKPYLRYTKY

    >gi|145245980|ref|XP_001395239.1| hypothetical protein An12g01520 [Aspergillus niger]
    MSIAQQARQPAQCRQFSFNSYLITPKELDSALKKNPRTKISTSPRVIPLCAAWFMPNDPEGRKGIDIFRKHRIPEARFFD
    LDGVKDHESPYPHMLPTAETFAEAMSELGIRRDDEVVVYDTEELGIFSAPRVGWTLRVFGHPRVHLLNNYRLWVREGYPT
    ETGEPSQPERTNYPVPTYDSKLVIPYRELKEIAKEHRKEGAKEVEILDARSYGRWAGTDPEPRPGLSSGHIPGSQSLAFQ
    QLLDPETKTYLPGPELRKIFEGKDIDESKSIISS
    CGTGVTATIIETALGEAEFGEPNLRRVYDGSWTEWAQLVKPEEGLI
    KKAT

    >gi|145247318|ref|XP_001395908.1| hypothetical protein An12g08570 [Aspergillus niger]
    MSGLNPGDSFPADVTFSYIPWSEEKGEITACGIPINYYASKEWADKKVILFALPGAFTPVCSARHVPEYLEKLPEIRAKG
    VDVVAVLAYNDAYVMSAWGKANQVTNDDILFLSDPEAKFSKSIGWADEEGRTGRYAIIIDHGKVTYAKREPAKNHLEFSS
    AETVLKHL

    >gi|145247508|ref|XP_001396003.1| hypothetical protein An12g09510 [Aspergillus niger]
    TQYDTIIIGSGQGGTPLARALALANHKTALIEREHVGGCCVNDGCTPTKTMIASGRVAYLAGRGGEQRKRDIVDSFRTGG
    EKRLRDAGVDVIMGEASFVDAKTMVIMDGRNGNERVVRGDRIVINTGCRPGKVILDGLERVPNERVLDSTSIMELGEVPR
    HLVVVGGGYIGVEFGQLFRRLGARVTVLQRGKQLLPREDKELADMLLEIFRDDGIKVMLETTPVEIENASEDVFNVAVET
    RQGREAVKGATHILFASGRVPNTERLNAAAAGVKMDKRGYVITNEFLETSSPSIYAMGDVKGPPSFTHISYDDFRVLRPT
    LLGSTSADERLSIRDRIVPYVAYTDPQFGHVGLHEHEARERFPGRKILTAQMPMSYVARALETEETRGAMKAVVDGETGQ
    ILGFTCLGVEGGEIMSIVQTAMMGNLHYQKLQDAVFAHPTFAESLNNLWGFLK

    >gi|145248141|ref|XP_001396319.1| hypothetical protein An13g01810 [Aspergillus niger]
    MDPIRAEAIHNERHVKVVCVGAGASGLCLAYKLQRSFQNYDLTIYEKNPEISGTWYENRYPGCACDVPSHNYVYSFEPKA
    DWSSVYAGSREIRGYFNDFANKYGLRKYIHTSHVVTETNWIEESGQWQVTATDLTTGHTVHDWCHILIHATGYLNKPAWP
    EIPGLADFKGTKLHSAMYDESVSLEGKNVLLIGAGSSAVQILPAIQPIVNRVKIFIRSPTWLLPDISTEAGKFPEEQIEH
    FVNNPESVTALRKDNERTMNSIFRTAMYLKDTVLQEQAKGLLTSVMKNAFQDQEMEDRLIPNFSVGCKRVVPSGFRYLNT
    LKKENVDVVYGGVTAVTPSGCVSEDGNEHQGDIIICATGFDTSYIPRYPVIGPNGRNLQTEWAESIMGYMGIGISEFPNT
    FTMLGPYTPVSNGPTMVAIEAQADYICSFIDRYQTEPIHSMALKGDVCAEFKEHVGSFMEKAVWTDNCRNSHNNHTIGGR
    VPTTWPGSTLHYLEAMREPRADDWDIKYKGNRFSWLGIGVSQTEWDPTADLGYYIRQSDDGPWHSRRKRNLVIAKTGSMA
    PRPLHRQPKLAAKEKAQSIKADVSEQMPRAQAEPVSEATA

    >gi|145249430|ref|XP_001401054.1| hypothetical protein An14g04300 [Aspergillus niger]
    MNGVEQTCASLRTQIAATEAKLADLKRELEIAEQAAASHKQNAADAEGGSERRWPLLDEEYRRYGRQMIVPQLGIQGQLK
    LRSAKVLIVGAGGLGCPAALYLAGAGVGTLGLVDGDAVESSNLHRQVLHRTRNIGKLKVDSAIEYLKELNPHSKYIAHRE
    HLAPEAAPEIFSNYDLILDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNNPPRPAGDKTGGPCYRCVFPKPP
    PANTVTS
    CADGGIVGPVVGTMGVLQALEAIKVITADETTTPPPPSLHIFSAYSTPLFRTIKLRSRRPNCAVCSAEASVTV
    DTVRSGSTDYIFFCGTTGPENLLSPEERITPLEYRTRHHDKEEKEPTIIDVREKVQYDICSLENSINIPISTILASASSS
    MSNGDSLADGVPALPSWVPPDVASSQSTDPVYVVCRLGNDSQVAVKKLKELGLDQGGKRVVADIRGGFRAWKEQVDPEWP
    EY

    >gi|145249602|ref|XP_001401140.1| hypothetical protein An14g05170 [Aspergillus niger]
    MDVELCTCSVTESWANAEQGLARMYSLALTGTQIDAIYHTSLVLNGVEYYFGQGIQTAIPGSTHHGQPMEKLHLGKTELP
    LDVIEEYIQSLAEIYTPESYDLFLHNCNNFTQDLAMFALGKGIPEHIQNLPQTFLSTPFGQMMKPQIEMALRGVTQGTGA
    GTGTVGTQTPTTSAPTAPAQPAPVTQGSVRIASNLAQLEHHLAAAADSCAVIFFTSAT
    CPPCKMVYPTYDELAEEAGAKA
    TLIKVDISTAMDVSMKYSVRATPTFMTFLKGQKLDEWSGANPAQLRGNVRLLLEMAHPPHRHQQLRLPSLQRPITNYVTY
    KKVPPLDKLVQKLDPHHEDPRLLSMITYLKHRTSSSTPAADTPLPQDLPSFATYLQTTCGFLALDHLFALVDLTRLLFLD
    PRVSGYFAEEPGHTTLLTLLSPSAGLSGCPYNLRIVMLQLCCTLFSTPLYRDQLTTSSSLLPTLLHLTTSSLLDSHTNLR
    VVAASLAYNLAALNHNARFAGHADPLSEESQVELTASLVEAITQEEESQEALHGLLFALGLLVYEASPDSAVVDLCKAMG
    IAETVAAKRNVEKVAKEPLIKEVGEELLMKGL

    >gi|145250693|ref|XP_001396860.1| hypothetical protein An15g03220 [Aspergillus niger]
    MSSLVEVASEAEFPNIISSIPPSCLQVLYFHAPWAAPCAQMRAVISALASQYPATNPPSIAFLSVNAEELPDISEEYNVT
    AVPFVVLVRDNKILETISGSEAIQVRDAVERHAGAAAAASADGAPKTVIPPPLTAVPRENVPATATQAPATNGNAAAPAL
    TPEQSKEALFARLAELVKAAPVMLFMKGSPSAPQ
    CGFSRQIVGILRERSVKYGFFNILADEDVRQGLKEFADWPTFPQLW
    VEGELVGGLDIVKEELENDPEFLDRFSVNKPAA

    >gi|145251235|ref|XP_001397131.1| hypothetical protein An15g06020 [Aspergillus niger]
    MTDAKMQVDNPQETVEAIKQGEIDESLYSRQLYVLGHEAMKRMGSSNVLVVGLKGLGVEIAKNIALAGVKSLTLYDPAPV
    AISDLSSQFFLQPQDVGKPRAEVTAPRVAELNSYVPVTVHEGSNIAENLEELKRYQAVVLTLTPLKDQLAIADFCHKNGI
    YLTITDTFGLFGYLFNDFGKNFTVGDATGEEPVSGIVAAIDENGLVSALDETRHGLEDGDFVTFSEIKGMEGLNGCAPRK
    VTVKGPYTFSIGDVSDLGTYQSGGIYSQVKMPKFMDFAPLSEQIKKPEFIISDFAKFDRPQQLHIGVQALHKFAESHNGD
    LPRPHNDSDAQDVFKIANELASSLEEKVELDEKLIKELSYQARGDLNPLAALFGGIAAQEVLKAVSGKFNPVNQWLYFDS
    LESLPTSITRSEEACKPLGTRYDGQIAVFGKEFQDKIANVRQFLVGAGAIGCETLKNWAMMGLGTGPKGKIIVTDMDQIE
    KSNLNRQFLFRSRDVGKLKSECASAAVQAMNPELNGKIVTLRDRVGPDTEHVFNEEFWEDLDGVTNALDNVDARTYVDRR
    CVFFRKPLLESGTLGTKGNTQVVLPRITESYSSSQDPPEKTFPM
    CTLKSFPNRIEHTIAWARDLFQTYFVGPPEAVNMYL
    SQPNYIQQTLKQAGNEKQTLEHLRDFLVTDKPLTFDDCIVWARNQFEAQYNNAIQQLLYNFPRDSKTSSGQLFWSGPKRA
    PTPLKFDSANPTHLSFIVAGANLHAFNYGIKNPGADKAYYRKVVDNMIVPEFTPKSGIKIQANENDPDPDAPAAGSSFDD
    NQEIQRLVDSLPSPKDLAGFRLNPVEFEKDDDTNHHIDFITAASNLRADNYDIPQADRHKTKFIAGKIIPAIATTTALVT
    GLVALELFKIIDGKDDIEQYKNGFVNLALPFLGFSEPIASPKGKYMGKEGEVTIDQIWDRFEVDDIPLQDFLKHFSDMGL
    EISMVSSGVSLLYASFYGPSKVKDRLPMKMSKLVEHISKKPVPEHQKNVIFEVTAEDQTEEDVEIPYVMVKLRK

    >gi|145251784|ref|XP_001397405.1| hypothetical protein An16g00920 [Aspergillus niger]
    MALKPGDSFPSDVVFQYIPWSEDKGEITACGIPINYNASKEWADKKVVLFSVPGAFTPTCSINHVPGYIQNLPQLKEKGV
    QVVAVIASNDPFVMSAWGKANNVKGDDILFLTDPDARFSNNLGWASGGRTGRFAIVIDHGKVTYAQIETEKGAVKVSGAD
    AILANL

    >gi|145252094|ref|XP_001397560.1| hypothetical protein An16g02470 [Aspergillus niger]
    MPKHLFIHQQQQQPATPSSSTQQQAPATATAAKDDSVPAGMTKLPNGVILDKDGKPCRLCTSAASWRALTKQAKSTPSTT
    TSTASTIPKTLATTPGYTDCPPDSEALGRSTWTFLHSLTASYPAQASSEQQSEMRQFLGIFSKLYP
    CWVCAEDFRAWMAE
    PSGENQPRLGGRKEFGDWMCRAHNEVNRKLGKSEFDCRFWEERWRKGWGDGRCE

    >gi|145252516|ref|XP_001397771.1| hypothetical protein An16g04600 [Aspergillus niger]
    MAAPSLRSYYQSNLHSLSPKALLQSPFLTPTLPSMTTNMSRPILSTAARRISRSHSPRTAVSALSPATLPTLSFSASFCD
    TVSQRSTLRPRFLCPRASSSSSRSVFRFDAFGQRSSFSTTSIRPATKVLQNPRVDEDGKDLLINISPRAAERLREMTDPS
    SSPSITKEENPYHHLRITVTSGG
    CHGFQYLMSLEAASKIDAEEDTIFAAEPEEGEAEAAGAGEAKVVMDEPSLELLSGST
    VDYTMELIGSQFKIVDNPRATSNCGCGTSFDVQD

    >gi|145253096|ref|XP_001398061.1| hypothetical protein An16g07620 [Aspergillus niger]
    MRSAAKFFYLAVFALSRLSNAETGLHHNQDKCAIDPTAMVSDACVSYATIDHLNDQVYTLLQSITQDTDFFSYYRLNLFN
    KVCPFWSDANSM
    CGNIACSVNTIESEDDIPLTWRAEELSKLEGPKAGHPGRNQRKERPLNRPLQGMLGENVGESCVVEYD
    DECDERDYCVPEDEGASGKGDYVSLVDNPERFTGYAGMGAHQVWDAIYRENCFLKPVPELSPVTPQLGGLQAVNDFRHVL
    QQELKRPDLLPLDNECLEKRVFHRLISGMHASISTHLCWDYLNQTTGQWHPNLQCFKDRLHDHPERISNLYFNYALVSRA
    VAKLQKHLHNYNYCVGDPVQDAMTREKVSKLTSTLADRPQIFDENVMFQDPSSAGLKEDFRNRFRNVSRLMDCVGCDKCR
    LWGKLQVNGYGTALKVLFEYDETKNGENPLLRRTELVALINTLGRISHSIAAVRSFHRAMDVGDGEVFTIPASIASKERG
    GKKKTRRLLKDGGSTFYYEDGDDDNFVYITEKLPWEKVRVRRDTDTVWDDIKAEFSMIWDIYVYVLKSWVNAPKTFFEIA
    VLEVARVWNYWLGLPVPPRSWRIQLPKRPTPPTPPTHEEL

    >gi|145253859|ref|XP_001398442.1| hypothetical protein An17g02130 [Aspergillus niger]
    MSRAFEGNPPARDQDDHDADSDALFDALENEDDTAYRAHRIEQLNAEFASAQNNKNNNDSRTRDHTILEDSLYPTISSDQ
    ALLDFTTQTHRCVIHFAHPDFAR
    CGTMDEHIRALATRHHEVRFARVDVRNTPFVVERLKIRVLPCVIGFKDGVGVERVTG
    FEGLGSGGRDGTDGFSTATLEKRLIWKGILAQEKFRAGDGATDGSEDDDSDDGERRDRGKRSIRTGNARSYRHADDDDDD
    WD

    >gi|145254170|ref|XP_001398546.1| hypothetical protein An18g00810 [Aspergillus niger]
    MALIEITVISDPVCPWCYIGYRRLTKAIRLYQKTYPGGSQDRICISWKPYFLDRDAPMESVPYIERMTQRLGADKVPAAK
    ARLERLGAQEGIYFKFGGRFGNTLRAHQLLLLSEFVSRQGKIDGCGARDTATAVAEGIFRAHFEDELDITDVETLVRVAV
    HASEGYLDEAKVRSWLEQGQGVEEIDDMATRARQEGVHGVPCFQIGGGENAEGAVLTLSGALDVDEFLQALIAHKTGKGL
    DSADKVLGGQEMTSC

    >gi|145254554|ref|XP_001398661.1| disulfide isomerase tigA-Aspergillus niger
    MVRLSNLVSCLGLASAVTAAVVDLVPKNFDDVVLKSGKPALVEFFAPWCGHCKNLAPVYEELGQAFAHASDKVTVGKVDA
    DEHRDLGRKFGVQGFPTLKWFDGKSDEPEDYKGGRDLESLSSFISEKTGVKPRGPKKEPSKVEMLNDATFKGAVGGDNDV
    LVAFTAPW
    CGHCKNLAPTWEALANDFVLEPNVVIAKVDADAENGKATAREQGVSGYPTIKFFPKGSTESVPYEGARSEQA
    FIDFLNEKTGTHRTVGGGLDTKAGTIASLDELIASTSAADLAAAVKKAATELKDKYAQYYVKVADKLSQNAEYAAKELAR
    LEKILAKGGSAPEKVDDLISRSNILRKFVGEEKEAKDEL

    >gi|145254905|ref|XP_001398799.1| hypothetical protein An18g03380 [Aspergillus niger]
    MAVTAIESISDFLTLINSGDVVIIDFWATWCGPCKMISPFFEQLASRPEFSAIKFAKVDVDTQEDISQECGIRAMPTFIV
    FKDGQKLDDMAGAHPGGLQGLVQKYA

    >gi|145255349|ref|XP_001398937.1| hypothetical protein An18g04790 [Aspergillus niger]
    MSAAAKTKAQTLINENGVVVFSKSYCPYCTASKNLLNELGAKYTTLELDQLPDGADLQDALQEISNQRTVPNIFISQKHI
    GGNSDLQSKKNGELKGLLEAAGAL

    >gi|145256027|ref|XP_001402401.1| hypothetical protein An10g00070 [Aspergillus niger CBS 513.88]
    MQCCDSQFDVLVIGGGPAGLAATMALGRACRTVAVFDSQEYRNEEALLMHNVLCHDGQKPSLYRAQAVQEIMDKYDTVCF
    FDREIIALVPGRPIKTTPRFEVTDRTGRTWIGRKLIIASGIKDIFPDIEGYKELWGRGIVH
    CLFCDGYEKRGGRVGVLGQ
    PSMDDLDSVLLAFPLAHNDLTIFTNGAPYLVDPDARQPLDIAIARGVNIDGRAIKLISQIPDGTGVKLCFHDGEDKDLRM
    LLSSPKSINRAASLVEELGLETQPRSRGLVVSKSSMGESSLRGCFVAGDASSSVPKIVPTALASRSLAGIGAAKQLAYDD
    ALEAFQKMAPTGDRP

    >gi|145256409|ref|XP_001401375.1| hypothetical protein An04g00120 [Aspergillus niger]
    MVELRKRKAPAQAPAPERKVKKVQKSTISREPDVPKGSSNDKAPKVGDKLDLDNFGGDIETNDGQKTTLKDLVDASKAGV
    VLFTYPRASTPG
    CTKQACLFRDNYDSITESGLSIYGLSADSPKANTTFKAKQRLPYPLLCNPTATLIAALGLKKSPKGTI
    RGVFAIDKHGKVLIIQAGGPDATLDAARKLVAELKEQSSKDETRHASPPAKAE

    >gi|145256415|ref|XP_001401378.1| hypothetical protein An04g00150 [Aspergillus niger]
    MNRSTLQPRFAGIQLRSNLYARYLSSETRTAIDKAVASAPVVLFMKGTPETPQCGFSRASIQILGLQGVDPKKFVAFNVL
    EDSELRQGIKEYSDWPTIPQLYLEKEFIGGCDILMSMHQNGELAKLLEEKGVLVAAD

    >gi|145257366|ref|XP_001401704.1| hypothetical protein An04g03360 [Aspergillus niger]
    MAQERAPLRLGSVAPNFEADSSNGPITFHDYIGNSWAILFSHPDDFTPICTTELGAFAKLEPEFTARGVKLIGLSANGTE
    SHHAWIKDIDEVNGSNLKFPIISDPERKVAYLYDMVDYQDTTNVDAKGMALTIRSVFIIDPSKKIRLIMSYPASTGRNTA
    EVLRVVDALQTTDKHGVTCPINWLPGDDVVIPPPVSTEDAQKKFGDIRIVKP

    >gi|145257532|ref|XP_001401771.1| hypothetical protein An04g04040 [Aspergillus niger]
    MSTLVQINSREQFSSLLSSSTFVVADFYADWCGPCKAIAPAYEQLASQLSRPNKITFTKVNVDKNQDIARQYGITAMPTF
    VLFERGRPTSTVRGANAKELNDLVRKLATEAEKAPEGNDAGSSSGVGWIGAPAPKNYSDISDQYDPKGLELLNRASEFGT
    AKTLFDSSKPSSLNNAKGKAGAAPDWVESDTDEQLMLFIPFQSTLKVHSLQITSLPPSADEEVEDEDERPMRPRTVSLYT
    NRSHVLGFDEADDIPAVQTVTIQPEDWDPKTGTAKVDLRFVKFQSVTSLVIFFVDGDGDSEKLRVDRVRIFGEAGEKREM
    GKLEKIGDEPEKPSLCSYMDSRHIHTYNDIHIQYQ

    >gi|145258180|ref|XP_001401965.1| hypothetical protein An04g06020 [Aspergillus niger]
    MSLCKATMPSPVTSSATILTWLRQSSSRRSTQTCRLFSSYGNAHRSSKRELQTATAYRPHSLPTSFPPPRNTGNPDTSIA
    ADFPSFREISQPQMPGQQGLSDLSLRESEAQKSKPVPAPAPAEKTAAKPTEKPRRKLRARKAAMKLTPVAIEQLRKLLTQ
    PNPKLIRVGVKNRG
    CSGLAYHLEYVEKPGTFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEQCG
    CGESFMV