Aspergillus nidulans FGSC A4 uid13961

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|67903410|ref|XP_681961.1| PM20_ASPFU PROBABLE PEROXISOMAL MEMBRANE PROTEIN PMP20 (ALLERGEN ASP F 3) [Aspergillus nidulans FGSC A4]
    MSGLKAGDSFPADVVFSYIPWTEEKGEITSCGIPINYYASKEWADKKVILFALPGAFTPVCSARHVPEYIERLPEIRAKG
    VDVVAVLAYNDAFVMSAWGKANGVKNDDILFLSDPEAKFSKSIGWADEEGRTKRYAIVLDHGKVTYAALEPAKNHLEFSS
    AETVIKHL

    >gi|67903720|ref|XP_682116.1| hypothetical protein AN8847.2 [Aspergillus nidulans FGSC A4]
    MPQETPPPIQQETDKHDLSDDDDALFKALEEEDNTGYRAHRLEQLSAEFATAQKSSSQKTTLVEDSLYPTLKGDQVLLDY
    TTQTQRCVIHFAHPEFVR
    CATMDNHIRALAARHQDVRFARVDVRETPFVVEKLKIRILPCVIGFLDGVAVERVLGFEGLG
    PGGTAGLEGFNTASLEKRLLGKGILSQARFSADDEEESDRDSDEDNDARQGRRGIRTGITRAYKDDDDSDWD

    >gi|67902718|ref|XP_681615.1| hypothetical protein AN8346.2 [Aspergillus nidulans FGSC A4]
    MDEIRDRSSPYPQMLPSATQFAESMTKMGLHPDDILVVYDALEVGLYSSPRVAWACRHFGQRDVHVLNNFPRYVAEGLPL
    STGPLSTLPPAALEYPIKNPDSKEVISYDELRGLLLSDKKSDIQIIDARIPGRFSGAEPEMNPALRSGHMPSALNVPLAS
    IMDKDKVILPAEELKARFQAAGVDGQLPVVLT
    CNSGVTAAALDLALQLSGYRMERRLQVASAARAVATHRGFATASPVAA
    TARNHKVVVIGGGTAGLAISHQLLRSGRFVKDDIAIVDPAIWHNYQPGWTLVGGGLKTREQLRQPLAGLMDPKLKFYNES
    VGSFAPEENYITLGNSDKLNYDHLVVAPGIALNFGSVQGLSEALAAPDSKVSTIYSYDTCSKVFPTIEKLKKGQAIFTQP
    AGVIKCAGAPQKIMWLALDYWKKAGLYDPSNPAGSAIKIAFATGTPSMFGVPKYNAKLEELRKERGVEGLFQHDLVAIDG
    KKATFARPNGESSVTREFDLLHVVPKMGPHAFVKNSALANEAGYVDVDDGTTRHKKFANVWSAGDASSLPTSKTAAAITA
    EAPVLVQNLLRSMDGKEIDATYDGYTSCPLTTEYGKVLLAEFKYGGVPKETFGKWFGIDQGTPRKEFYFLKKHFFPWVYY
    ESMVGIVLDNRYGARAALPRWTNNPGDNADRQEYGHCRYQPVRLDPRALADHSGVGHGWPLLPRAEHPPFCSIPK

    >gi|67903168|ref|XP_681840.1| hypothetical protein AN8571.2 [Aspergillus nidulans FGSC A4]
    MALTTEETALVETATVTINSIPVSEDYSVASAALSSDGRIFTGVNVYHFTGGPCAELVVMGVAAAAGVTHLKHIVAVGNN
    DRGVLSPCGRCRQVLLDLQPGVRVIIGKKGSEQSVPPSELLPCSYLYADPVIFKALVSSGPVVVDFFATW
    CGPCKAVAPV
    VGKFSETYTGVKFLQVDVDKARSIAQEHQIRAMPTFVLYKDDYQTAMRKPKANQKRN

    >gi|67902186|ref|XP_681349.1| hypothetical protein AN8080.2 [Aspergillus nidulans FGSC A4]
    MAPLKAGDPFPSDVSFQYIPWSEDKGEVTACGIPIKYDASKEWADKKVVLFSVPGAFTPTCSVNHLPGYIKNLPELKKKG
    IQIVAVVASNDPFVMSAWGKANQVTGDDIVLHLF

    >gi|67902462|ref|XP_681487.1| hypothetical protein AN8218.2 [Aspergillus nidulans FGSC A4]
    MLLSRLLPLALSLAGTTLSAVIPETDYDVIVVGGGPAGLSVLSGLARVRRKAVVFDSGHYRNDPTREMHDVIGNDGTPPA
    VFRAAARSQISNYSTASFIDNEITSIVPVNNTNLTTFFRATDSTGAEYTARKVVLATGVVDILPSTPGLIEGFGKGIFW
    C
    PWCDGYEHRDQPFGILGTLPHIVSSVLEISTLNSDIIAFVNGSYTDEYVSALEEDYPDWQAQMAAYNVSIDNRTITSFER
    MQDGGENRNDVGQQFDIFRVHFTEGEPVVRNAFLTNFETAQRSSLPYDLGLVMKDGKIDTSINPGMRTSRAGVFAVGDAN
    SDGSTNVPHAMFSGKRAAVFGHVELAREEMAAAISKRSLSTRALHKEAERAMGNELETLWEKVNA

    >gi|67900898|ref|XP_680705.1| hypothetical protein AN7436.2 [Aspergillus nidulans FGSC A4]
    MRSFGPWALSLLGAAAAVSAADSQSETPSDVISLTKETFNDFLVEHDLVLAEFFAPWCGHCKALAPQYEEAATELKAKNI
    ALVKVDCTAEEDVCREQEVTGYPTLKVFRGPDNVKPYQGARKTEAIVSYMVKQSLPAVSTVTEETLEDFKTMDKIVIVGY
    FAEDDKESSEAYTAFAESQRDNYLFASTNDAAVASAENVKQPSIVLYKDFDEKKAIYDGSLDSEALLSWVKTASTPLVGE
    VGPETYSGYIAAGIPLAYIFAETQEERAKFAEEFKPIAEKHRGAINIATIDAKAFGAHAGNLNLDPKTFPAFAIQDPAKN
    AKYPYDQTKELSAKDVSKFIQDVLEGKVEPSIKSEPVPETQEGPVTVVVAHSYKDLVIENDKDVLLEFYAPW
    CGHCKALA
    PKYDELAELYAKSKDFASKVTIAKIDATANDVPDSITGFPTIKLFPAGAKDAPVEYSGSRTVEDLANFVKENGKYGVDAF
    AAQAEEAEEVAEDATETASDAEPSAEKPEHDEL

    >gi|67901160|ref|XP_680836.1| hypothetical protein AN7567.2 [Aspergillus nidulans FGSC A4]
    MSTLFEVTSEESFGPHLASIPSDTLIVLYFHAPWAAPCAQMRAVLSALASQYPATTPPTVSFISVNAEELPDISEEYDVT
    AVPYVVLLRNGQVLETISGSEATKVRDAVERYAGAGSAGASANGAASAIPPALTAVPREDVNTPTTATQAPVAGAASGAG
    AAPALTPEQSKEALFARLSELVKAAPVMLFMKGTPSAPQ
    CGFSRQLVGILRERSVKYGFFNILADEDVRQGLKEFADWPT
    FPQLWVNGELVGGLDIVKEELENDPNFLDSFSINK

    >gi|67542023|ref|XP_664779.1| hypothetical protein AN7175.2 [Aspergillus nidulans FGSC A4]
    MVPDALPGSIPTGIPRSGRAAARPDSDASLPIGTRRDVLLQFPLQSNDLLPISEWLICRAANGALLSDAGRPGSQLDLSG
    LHVNYCCWGGSSRCLRYPVNDADDGDIDSRIFYLYIFEYGMEVAVPSSPLDRTPRQTSPTSAPFVQTLFLPVPRSDDLAT
    DLITTRRMTTYTTNHAPSVLQTHSWRTAQNSAPHLLPHLQPGLKILDIGCGPGSITVDLARLVGPTGHVTGIEYVSDPLD
    SAAALAASSGITNVTFQVGDIHALQFDDDTFDVVHVHQVLQHIRDPVQALREMRRVVKQGGIVSVRESDTMSWYP
    CNQGI
    QDWLDLTGRMASAKGGNPHPGRKIHVWAVEAGFERERIERSAGTWCFSTPAEREYWGESMARRMESSGFSEGAVRDGFSS
    QEELRAIARGWREWVAHEDGWFGLLHGQILCWK

    >gi|67900764|ref|XP_680638.1| hypothetical protein AN7369.2 [Aspergillus nidulans FGSC A4]
    MAVISIEIISDVICPWCFIGYRTLQKAIALYKKTYPGGSENEFVIEWKPYFIDQVAPETSVLINDRMARRMTRSQIEAAQ
    KRLKRIGSTVGISFKFGGYIGSSRLAHRALHLALDKGGSQMQCTVADTLFQYQFELEKDVSQMHTVVEAAEKAGMDGDLV
    REYLEGDGGKEEIETAERKARKRGVKGVPCLCIGVGGRVGEQVVDGAGDMEEVFEALVRAQPRGSVKATLHHTPRVYPSS
    LGDYNLPSTTHVTRSLRTSSTRKSNRNVRPCIIMDSSSTISCGFSSESPSLSRSRSQSFSESLSSIGPDSNPGTKLQLVE
    RIIEPLAYYSTRRFHPVHLMDTFKDSRYRVIRKLGYGSFSTVWLARDTKLGRYVALKVGQAEDQSSSAPIEETRIYQLLA
    KTKFPSHPGRDHYLPLLDQFRYTGPNGTHQALVYEPMSASVTEVKEALFPNGPFPFQMAKAILWQTLLGLDFLLANGVVH
    GDVQPRNLLFTLEDLKDVPEDQLVQDKDKSITLCVDTELKGGVKGPEYLVPAHSLMQYLNISKPFTVKVSDLGGSFLTSH
    PPSAPSPPLHLRGPETLFQRCISANQDMWSFGCLIFEFITGFALFDLSDHPVTGITDDMHFIDMYNILGFPKDEALRNQH
    WPNWRRFFRSNGEPIDHFIRRRDRDFDITGRPTSHTLEELLEEAVGEGLSPEEINITKQLLRGLLEFEVEKRFTTKDVLR
    HQWALCKTYDYIIVGGGTSGIPLAVRLAQSHSVAIVEAGTYYEISYPFAKTPGADVLPVGSDPDTSCKADWGFVTTPQKG
    ANGRRVHFARGKCLGGSPTKEALDTWAEAVDDLSYAFDNIFPYYQRSVAFTPPDHVQRLANATALYNSSAFDPAGGPLQV
    SFADFVQPFSTWVARGMKAIGLHQTSAFNSGELNGYHYCTSTIRPQDQSRSTSESSFLPGLSTLNPNIYQKTMAKRILFD
    ENKNAIGVEVNSFGISKTLMASREVIVSAGVFQSPQLLMVSGIGPREHLEQHNITVVSELPGVGQGMLDHPFFGPSYRVG
    VETLTRLANDPKSQVKEYIRWLTKHEGVLTSPVAEFLAWERIPDSLRAGFSEDTRRNLSLFADGWPEVEYMSGAGFLGNI
    SNFYSIQPDDGYEYASILGVLIATTSRGTVTLASNDTSDPPIINPNWLDTESDQQLAVAAFKRIRQAFASEEMRPVVIGE
    EYYPGPQVQSDEEILDWIRNNMMTLWHPSCTCKMGRADDRMAVVDSQARVFGVNRLRVVDASAFPFLPPGHPQSTCYMLA
    EKIAEDILEQSGKTEETVRMDLRR

    >gi|67541490|ref|XP_664519.1| hypothetical protein AN6915.2 [Aspergillus nidulans FGSC A4]
    MDIELYVYDLSQGLARMYSMALTGVQIDAIYHTSLVFNNTEYYFGQGIQTAQPSSTHHGQPMEKIHIGTSELPLEVVEEY
    LQSLSSIYTPESYDLFLHNCNNFTQDLAMFLVGKSIPEHIRNLPTTFLSTPFGQMLKPQIESALRGVTQAPGQGLPAPRS
    GPAGSHTQAQAQSQGKVRVVGSLNELEQHLSSASKSCAVIFFTSAT
    CPSCKMMYPVYDELAAEAGSKAVLLKVDTSMAHD
    VAVRYGVHATPTFMTFLRGEKLDTWAGADAGKLRGNVRLLLEMAYPTHPHRELRLPSFQRTITNYVTYNKTPPLEKLMQK
    LKPHDQDPTLLAIIDFIKHRTTSSSADTPLPSDLPTFATYLAQTFHSTPQENRFALVDLVRVLFVDPRVAAYFGEDTSHT
    LLLTFFSTSEDEATSYSLRIVTLQLACNLFKTPVYTNHLSSPSNPLRPALLSLVTSSLLNAQSNLRVVAASLAYNLAALN
    HNARFANTGSEPLTEEEQVALTASVAEALAQESSSTEALHGLLFSLGLLIYEVPMDGAVIDLCRALNLKEAVEGKKELIT
    NGDQGKDKGDSLFREVGRELLAKGL

    >gi|67541599|ref|XP_664567.1| hypothetical protein AN6963.2 [Aspergillus nidulans FGSC A4]
    MALRTLLTFCIILTCSMAQFNTQYDVLIIGGGPSGLSAASGLARVLRKIALFDSGEYRNKPTRHMHDVIGSDHVDPAEFR
    AAARAQISFYNVTTFIDTKVVSINATGTANRTTSFTATLANGTTYTGRKVILGSGVKDALPDQVPGLREAFGKGLYW
    CPW
    CDGFEHRDQPVGVIGNFSDSYDSVRELYPTLNRQIRVLSNGTANDTAQLERIDKKDSNWRAVFEAYNVTINDRTIQNITR
    VQDGGEVQEEVIRKELDIFRVYMDDGTFEECGAIMANYGTYQASTLPAQMGLRILGGKIDTTAPGLRTSMKGVWGVGDAN
    SDNSTNVPHAMASGKRAAVYCHVEMAREELALITSNSTKRRAVPEELVVDREMGTVIGDIYDALRMK

    >gi|67539566|ref|XP_663557.1| hypothetical protein AN5953.2 [Aspergillus nidulans FGSC A4]
    MSRPAVSSAARQMLWARRAVPATPHVSCSSPTLNFASFCHASYRTLAISTSPAPARNIRPRISKQFLSRTQPRSAFSSTT
    ATSAAQVTQNPRTDDDGNTLMVEISERAANCCWVSWRILRQRRGKSMAVMLREETCIFLSARYGCGKQGFPSAQPYLSHT
    PVDPSSSPSATKDENPYHHLRITVTSGG
    CHGFQYLMSLEPASKIDPEEDTIFEAEPPEQGSDVAGNGTAKIVMDEPSLEL
    LSGSTVDYTTELIGSQFKIVDNPRATSSCIMFDKAS

    >gi|67539600|ref|XP_663574.1| hypothetical protein AN5970.2 [Aspergillus nidulans FGSC A4]
    MRVSLLTWSLLSLFSLPTFASHSEGSTPAQRLVKRADSDDSTPTLFNGVEVPPMKELTPENFAETVKDGYCWSLNSFEGF
    YNFHFAAMNCLAYGDLCKKLEIDGYPTFSLYHDGKQVERYDGAKTMEAFSEYIEEKLEAIKPGSRPAKGLKLPEPGDKAV
    DTKANPDTAASKDKDPEAGVKAGEKHNEKAAQHAAEMALENPANERDATSKSKQKAKAPVNPQGISVPLTAESFQKLVTP
    TDEPWFIKFYAPW
    CHHCQALAPNWAQMAKEMQHTLNVGEVNCEVERRLCKDARVTAFPTMYFFRGTERVEYNGLRGLGDL
    VSYANRAVEIRNGIQDVDAESFKALEETEDVIFLYFYDHATVSEDFEALERLALPLIGHAKLVKTDSAALAERFRISTWP
    RLLVSRSGRANYYNPIAPRDMRDIRQILNWMQTVWLPIVPELTASNARELMDGKFVVLGILSRSRANEFVEAKRELKNAA
    LEWMDKQVQLFQLERQELRDAKQLRIEEAEDRNDQRALRAAKNMHVSIREDDKKQVRFAWVDGDFWERWLRTTYGIDVSK
    GERVIINDQDNRRYWDTASSGASIMASRTSILETIPLVIANPPKLTPKSTIGTFESIFFVSHAFITGHPILFVILLILSI
    AGVTYVARGRAHKRGIRGGILGIAGNAGGFLQLDGKEGLLNGGSTGKVD

    >gi|67537880|ref|XP_662714.1| hypothetical protein AN5110.2 [Aspergillus nidulans FGSC A4]
    MASQFSKADMGAGLSLAELPKSNVFTSKLPPDPAFDTPEASHKAQRERLYPRTVKGAAFTFVRPETTEDPELLGVSPRAM
    KDLGLKPGEENTAQFKAVVAGNEFYWDEENGGVYPWAQCYGVVLAFRHEGTEAEHQQRAISLFESTNPSTNVRYEVQLKG
    AGRTPYSRFADGKAVLRSSIHVVAISNTCIFGTFDLPHSRGDRNMVRKLATYVAEDVFNGWESLPGAVSVGKDQQADSVE
    DPPRGLLGDKIQDHHGVEENRFARLYREIARRNAKTVAAWQAYGFMNGVLNTDNTSVYGLSLDYGPFAFMDNFDPQYTPN
    HDDHMLRYSYKNQPSVIWWNLVRLGECLGELIGAGPQVDDENFVKQGVTEDAAPALIKRAETIIERTGDEYRTVFLNQYK
    CLMSKRLGLRTQKESDFQELYSELLDTLEALELDFNHFFRRLSSVPIVDLETEAGRKDIAHIFFHIEGHGGIGYTEDSAR
    ERIAKWLDRWRQRVLEDWGTEADADIKRQEAMKKVNPKFVPRGWILEEVIERVERRGDRDILGRVMNMALNPFNEEWGLN
    REEEERFCGDVPRFQRAMMCS
    CSS

    >gi|67537946|ref|XP_662747.1| hypothetical protein AN5143.2 [Aspergillus nidulans FGSC A4]
    MRYGKTLRNSIYPPWSKSYIDYNKLKRLLRERDVIGDDSDTDATWTEQDEEAFVQELLNVQLDKVNAFQVQTSQQLRERT
    SACEDKLRPLAQTEGDTPAVAEEDRIRIASEVLAELDSITKEVSELEKYSRINFTGFLKAAKKHDRKRGARYRVKPLLQV
    RLSQLPFNSEDYSPLVRRLSVVYSFVREILSTKSPEPEPGFGQDNYSSYKFWVHPDNMLEVKTLILRKLPVLIYNPKSSK
    ELETHANDPTITSLYFDNPQFDLYTQKVARSPEAGSLRLRWTGNLIEKPPIYLEKKIVTSDNFSNEVKVQLKQKHVKEFL
    DGEYHLEKQVHRMEDMGNGEMEHAESLKRDVEALQSFIKENNLQPMLRANYTRTAFQIPGDDRIRISLDTNLALIREDSL
    DKERPCRDENEWHRTDIDNAAMEYPFPAIRNGEIVRFPYGLLEIKLRGSAAHNSEWVKDLMVSHLVKEAPRFSKFVHGVA
    QLFEDHVNSFPFWLSELDNDIRRDPETAFHEEQERQAKNAEEDLAVGSFLGARSPPTRPLVGSPITRFADAESPRAQRTS
    QATLSQLTPAAAPDRPRDGEREQQGEPALLQRQEEPVTQSRLAALFPSFTGRRRSVVLPPGVKEPGWWIKDTGPVRVETK
    VWLANQRTFIKWLHVSILLSSLSLGLYNAAGKHNDIARALSIVYTAFAIFAATWGWYMYEKRARLIRARSGRDLDNTFGP
    IILTKHKACVGDRSRMTNFNIQIISDSV
    CPWCYVGYRRLSRAITTHKLTNPLDTFTITWSPFYLNASSPGYPGVNKRQFY
    ENKFGAARTGAIFERLAAVGEGEGIKFSFGGQTGKTRDSHRVIWLAGKKEREQREKGEGVAGKIENGVIGGLQTRVVERL
    FRAYFEEEKNITERAVLVEAAVGGGLDKSEVEGFLDSDVGGVEVDRDAEGARRQFVTGVPYFMVQGQYAIEGADEPETFL
    EVFGKIKADGQ

    >gi|67538780|ref|XP_663164.1| hypothetical protein AN5560.2 [Aspergillus nidulans FGSC A4]
    MDDLGLRSPDSLRPLQPLLSSVAENASNLAASVKHQQYNDHEDHQHEHNLEVAVEARSLQPLQSAIADYDHYELHQQKHQ
    HQNQDQSEERQFRPEDAYGSLTNQSASLRIQRPQNTSESIFSSKEHGYLRDVASIANPPDLEAWRDRLFDVDEMIVMSEE
    EFRTYFPHVDNVYSHRSTQHYKRKPLVSHYWDCRLKGRPPGTPKSDDPNKKKRKRTARQRDLCDVKIKITEYFPGYAVGL
    GTGAGAGVGGAEGLGSAEQQQQFSLPFSPNGVGVDTPITTGESLPGVNTLLQFPSSAGSGSFVPGNPAGRGELHNQNASQ
    SQNQPFGVLTPNPPLPEGHPGAGGQRFFTIQRVNGNGANGKNDGVSGGHRHTLEESDRVKKNSVQRFLLKEARERKKALS
    VTTRTMSAPKSYHTQATGAAAETVANHSKESDLKLYGSCF
    CPFVQRVWIALELKGLPYQYIEVDPYKKPQSLLDVNPRGL
    VPALRHGEWGSYESSVLLEYLEDLEVGPPLLPPGDAKLRAHCRLWTDFVNRHIVPSFYRVLQEQDQQKQIEHAHELHSSF
    NTLIEVADPEGPFFLGPDLSFVDVQVAPWIIRLNRVLKPYRGWPDPEPGTRWSAWVNAIEANDSVKATTSLPDLYLDSYE
    RYAGECP

    >gi|67528190|ref|XP_661905.1| hypothetical protein AN4301.2 [Aspergillus nidulans FGSC A4]
    MVELRKRKTTAAPPEQSAKRTKTKVPATTLKPSGNTTALTCESILRVGDVVNLNGFGGDFETNDGRKTTLKILVDESKAG
    VVLFTYPKASTPG
    CTKQACLFRDGFDKLTSTGLAIYGLSADSPKANTNFKSRQNLPYSLLCDTASTLISAIGFKKSPRGT
    IRGVCVIDKAGKILLLQPGGPDATVEAVQQLVLSMPKEVQGSIAET

    >gi|67528196|ref|XP_661908.1| hypothetical protein AN4304.2 [Aspergillus nidulans FGSC A4]
    MFSRTAISFTLRRSLFRPQLSPQFPNQLPSVLQARLLSTETKAAIDKAVASAPVVLFMKGTPETPQCGFSRASIQILGLQ
    GVDPKKFVAFNVLEDPELRQGIKEYSDWPTIPQLYLNKEFIGGCDILMSMHQNGELSKLLEEKGVLVAE

    >gi|67536687|ref|XP_662118.1| hypothetical protein AN4514.2 [Aspergillus nidulans FGSC A4]
    MTSSSTQTATLAAGCFWGVEHLFRKQFGQGKGLLDAKVGYCGGNTASPNYRAVCTGDTGHAEALKITFDPSLVSYRSLLE
    FFYRMHDPTTKNQQGPDVGTQYRSAIFTHGDEQHKIAESVTEKVSKEWYKQPLSTEIIPAGQWWDAEEYHQLYLHKNPSG
    YECPAHFVRSFPPLSDHSSHLDRLQSSLVMHKWLPRGVGNWTLASQFFMRRYTGVDTVSGPANSIYQTVKAGQLSPRKLE
    QARMLYHYRVSYLICPLPRRYISTWTPAAHTHIQSTAISSTMASAVVVAMREALRHLKHVENHLRHHNQPNAANKVGKLS
    VEISQAVQEAMAYIPQCDVFDNMQDANGAVANRVAQQHANGGHQAMTNHPPPGGPIQQQAVVALLNEVQKEQNKPAHFES
    CPLQRLPPPPAAALQPHSWAQVAGSITSGSSHEIMQLMSPTLVTSCPGSKEGQNSDDGRSNDDLITFIPSSIPVLPEEKA
    GIIRILGRMNEASIAHITARIHEGPLQDIRIEAPDRARVVFQHLSHAEAFCEADKEMVVRLGFGRLGKGYRVEIAEIVDW
    TDDHRAMNQPIRERRRLSFARKGLFSYYKNIPGVLSPEAWKQDMRSIAGVGNIERLFVFNNGNGEWELVAMWWDQSLMLS
    KALATAIFTSTIIARRVLETVNRWKETKAVYRGVSVTYSSDPCEKELILTDDKCVLMRRHEKFRPNHPSYRPGKIRQGQP
    GRR

    >gi|67536834|ref|XP_662191.1| hypothetical protein AN4587.2 [Aspergillus nidulans FGSC A4]
    MTLLCSRMGNGLAEADTYKKIDKRQEYEAVPVDQTQILAKKVIQHPALTPFRKSLYLALLQIPPGQWTTYAALAKHTNSS
    ARAVGTAMRLNPFAPGVP
    CHRVLASDGTLGGYMGTPSASVSARSKGSGKGIEKGGNLERKRRMLEEEGVKFDLKGRVIGT
    AFVAFRS

    >gi|67536910|ref|XP_662229.1| hypothetical protein AN4625.2 [Aspergillus nidulans FGSC A4]
    MIQDTYSEVQSRYGSIAKQTNADTNENKDDTEDKLAQAFGYTAAELSSLPGKANLGLSCGNPIAFANLKPGETIVDLGSG
    GGIDVFLAARKVGPEGRAIGVDMTEEMITLATTNAKKANFPNNQVQFIKAPITSIPLPDSSADCIISNCVINLVPKDAKP
    IVFAEIARLLKPGGRVAISDILARKPLSPAFVSDIALYVG
    CVAGASLVEEYEDWLGRAGLKDVLIVDTKADINLYKQTLD
    SSPADSCCAPKESVQIPAANFSDVDFNEWVGSFQIYAVKGGF

    >gi|67526247|ref|XP_661185.1| TRXB_PENCH Thioredoxin reductase [Aspergillus nidulans FGSC A4]
    MVHSKVVIIGSGPAAHTAAIYLSRAELKPVLYEGMLANGTAAGGQLTTTTDVENFPGFPDGIGGSELMDAMRKQSIRFGT
    EVITETISRVDLSQRPFKLWTEWNDGPDNEPARTADAVIIATGANARRLNLPGEDVYWQNGISA
    CAVCDGAVPIFRNKPL
    FVIGGGDSAAEEAIFLTKYGSSVTVLVRRDKLRASKAMASRLLANPKVTVRFNTVATEVLGEKKLNGLMTHLRVKNVLTG
    EEETLEANGLFYAVGHDPATALVKGQVELDEDGYIATKPGTSFTSVEGVFACGDVQDKRYRQAITSAGSGCIAALEAERF
    IGESESNEEIPPAHANPALVEVNAIYFSNLKDHASR

    >gi|67526459|ref|XP_661291.1| hypothetical protein AN3687.2 [Aspergillus nidulans FGSC A4]
    MFASRRLTAAASVPRAFSQRALFHRTAPAFVQKGDPIPDLDVLVENSPGNKVNLAKELKGKGVIIGVPAAFSPACSSTHV
    PGYISHPKLKEAGQVFVVAVNDPFVTKAWGTTLDPTGKSGIRFLGDPTGKFSEALDVTFDSTTIFGNQRSKRYALLVEDG
    KIKEAFVEPDNTGVKGIISSPAAIPPAC

    >gi|67526603|ref|XP_661363.1| hypothetical protein AN3759.2 [Aspergillus nidulans FGSC A4]
    MANRQITRRILISASILIFFLFVLFIQPYGPPSPSVRAPGHLEKSTPVKDDLIKGDVVMPRLGNETAKAELGRATWKYFH
    TMLARYPEDPTEEQQETLHSYIYLFARLYP
    CGECASHFQGHLKQYPPQVSSRNAAAGWGCFIHNEVNAMLGKPAFDCNKI
    GDFYDCGCGDEEEESEGSGSNSGHKTAPRESSFGDDTISPVEISREPITRGG

    >gi|67527011|ref|XP_661567.1| hypothetical protein AN3963.2 [Aspergillus nidulans FGSC A4]
    MASARIYDVLIIGAGPAGLSTALGLARQTYSAIVFNSNQYRNAFADRMHNILTWDHKPPSDFRAAARDNIESRYSTIHFM
    NATITSAAAKEDGTFEVVDEQENKYQGRKLALATGVTDVLPDIKGFSELWGKNIFH
    CLFCHGFEERGAESAGVLGGGFIT
    EPAMILHMARMVSPLAKKVTVYCDGNEELAAQLQKEFKGKPLEIESRKITALEKQGESVTVRFDSGQSQQEGFLVSAPRV
    RINGPFHEQLGLNVDPMGFIKTNAPFNETNVPGCFAVGDCGSLMKSVPQALATGSFAAAGLVAQLGAEGEL

    >gi|67527031|ref|XP_661577.1| hypothetical protein AN3973.2 [Aspergillus nidulans FGSC A4]
    MASFFSRTTFRTLNTLFKATPCSKTPITAPLAQPLARRFIGTLPREQPRLRLGSTAPNFEALTTQGKIDFHQWMDGCWTI
    LFSHPADFTPV
    CTTELGAFAKLKGEFAKRGVKMIGLSANDLGSHGDWIKDINEVTGSDVQFPIIADADRKVAWLYDMIDE
    SELANLAEKGIAFTIRSVFIIDPAKKIRLVMSYPASTGRNTAEVLRVIDSLQTADKKGIATPIDWQVGDDVIVPPSVSTE
    DAKKKFGEVRELKPYLRYTKY

    >gi|67527309|ref|XP_661643.1| hypothetical protein AN4039.2 [Aspergillus nidulans FGSC A4]
    MASLNPISRQGRIMFLGSRATKYALAGEPTAARALSSTRQLTTLCLSSRPGGYAKPSLRTNPKHIQADRVEYVPALSVRW
    NSTKSNTEDSSSPTFRKWGFDDINAYLPSESPSTPPSNPQKNLILVDVREPAELTRTGIIPSAVAVPLASQPDALFLTPD
    EFETRFGYPKPGADGGKGDIVFY
    CLAGVRAKTAAQLAVQAGYEPERIGVYEGSWRDWAARGGKVEKWEGYEE

    >gi|67527943|ref|XP_661819.1| hypothetical protein AN4215.2 [Aspergillus nidulans FGSC A4]
    MSSAKVKAQQIIDENGVVVFSKSYCPYCKASKSLLSELGAKYYALELDTIDDGADLQNALEEISGQRTVPNIYIAKKHIG
    GNSDLQGIKKDLPALLKDAGAL

    >gi|67524777|ref|XP_660450.1| hypothetical protein AN2846.2 [Aspergillus nidulans FGSC A4]
    MASATTFYDFEPVDKKGEAYPLNQLKGKVILVVNTASKCGFTPQFKGLETLYQSIKAKRPDDFVILGFPCNQFGGQDPGS
    NDQIQEFCQLNYGVTFPVLGKTEVNGDNANPLWTWLKESQPGLLGLKRIKWNFEKFLISADGKVVGRWASTTKPEGLESR
    ILEEIEKAEKQGLLASKAMQPEAAGTDGETAKLA

    >gi|67525139|ref|XP_660631.1| hypothetical protein AN3027.2 [Aspergillus nidulans FGSC A4]
    MADEPQSQPHSRPNPTTLFPHTTTGTPESPSSSSDNKNDGSKLPVIRRDEDGKSYVLDKNGKPCRLCTSAAAWRNLTKKS
    KASTAAASTTTTTQPQSQSNSTGASTECPPDVEALGRSTWTLLHSLTATYPEKASPSEQTEMKSFLTLLSKLYP
    CWVCAD
    DFRNWMAEPSGKNQPRLGGRSEFGNWMCEAHNEVNRKLGKKEFDCRFWEERWKDGWKDGRCD

    >gi|67525319|ref|XP_660721.1| hypothetical protein AN3117.2 [Aspergillus nidulans FGSC A4]
    MAQPAERHRSTFFISNVHCTSCVAYINQVLSETQGIADIDVSIFTHEVHVVHTKGTNPLSIAEILAEAAFEVHHVTTRNS
    AGVIIVDSDTATRFPHDPRFSITSRSSVGQRDKQKHLANCDACRKEGQPTDEKSQHLLSNVQGAEAEDDSVSAQESLPEK
    SQKFHARISIGGMS
    CASCSNSITNEIRQLEFVDDITVTLLSNSATVTFWGPRSNVEQIIEQIEDIGFEASLDEVNQVDTE
    PSQTQNLGYIAEISIGGMTCGSCSGAVTQGLNELPFLTNAVVNLMSHSAQVELDNPDDAQLVVQKIEDLGYDASLVNITP
    KAAELGSGLEKRTVSFRVEGMFCHHCPKKVYDSLKEIPDLEIDDMLSVKYPILKVTYTPRSPSLTVRTIREKIESAHNAF
    KAAVYHPPSVEDRSREMQRHERCRLLYRFLFVLMVAIPEFIVGIVFMSLVSKDNHIRQYLEQSMWSGSVTRMEWALFIMT
    TPVMFYGTDIFHVRAAKEIITLWRPGSRMPLLQRLYRFGSMNFLISAGTTVAYVSSLAILIMDAVTKAHSDAHSSTYFDT
    VVFLTLFILAGRYMEAYSKGRAGDAVAALGKLRPSEALIVVNASSDEAQSIDVDLLEIGDIVQVPHGASPPADGRIAGLG
    SFQFDESSLTGESKPVSKTAGDQVYTGSVNVGQPVEIQITAIGRSSMLDQIIAVVREGQGKRAPLQRVADTLVGHFVPAI
    TLIAVLTFVIWVSLGVSGALPSDYLDVSRGGWPFWSLEFAIAVFVVACPCGLALAAPTALFVGGGLAARYGILVKGGGEA
    FQEASRLNAIVFDKTGTLTEGGSLQVSDHESLITDSSHIEIAWAVARKLEESSNHPIARAIAAFCKAQPSASVVNSEIEE
    KSGQGMQGRFTVSLVDSSNGTATTRHFEAAIGNQRLYESLSSSDQDHYYLCNTLSRYQATGRSTAILSLREICPTEPDSP
    TGSETHFFPAIVFAISDTIKPDAANMISQLQQRKINVFMCTGDNETTAHAVADMIGIPRSNVLANTLPAGKADFVRQIQI
    QPAQAGGGGTTRQIVAFVGDGVNDSPALAAADVSIAMASGSDVAINSASFILLNSELTTILNLVLLSRRVINRIKINFGW
    AVIYNLCLVPVAAGVFYPIVSGHRMAMVMGEMVTVQSHWRLSPVWAALAMALSSISVVCSSLALAIEWKTVAEVWHRVKC
    RLGGRTTRQQE

    >gi|67525683|ref|XP_660903.1| hypothetical protein AN3299.2 [Aspergillus nidulans FGSC A4]
    MAAPKIILYTNHLCPWAHRAHIALKELGLEYEEVIIDLDTPREPWYLEVNPRGLVPTISYNGTAIPESAIVAQLLADAHP
    SHLLPASNTPEGAIQRAHVSFFVDTFIGKVWSQAFAAQKAASEEERAAATESIVAAIEKNNVEGLLYPEGTGSGPFFRGA
    EKLTQVEVLTGSFLLRLLSLHKYGLLSPELPSQLEKRVPKFYKWAQEVVKQESVNYIWDEEKVGTRTAKKFGAAKK

    >gi|67525815|ref|XP_660969.1| hypothetical protein AN3365.2 [Aspergillus nidulans FGSC A4]
    MAFAAVRSSFLSPTRFIRPTMPVSQQIRTQAQTRQVSFSSYLVTPKELSDALKKNPSTKISTSPRVIPLCAAWFMPNDPE
    GRTGIDVFRKHRVPQARFFDLDAIKDTESPYPHMLPTAETFAQAMSELGIRRDDEVVVYDTEELGIFSAPRVGWTLRVFG
    HPRVHILNNYRLWVRDGYPTETGEPRQPERTNYPVPSYDSKLVIPFRELKEIAKEHRKEGAKEVEILDARSQGRWAGTDP
    EPRPGLSSGHIPGSMSLPFQELLDPETKTYLPPDQLRKIFESRDIDETKSIISS
    CGTGVTATIVETALGLAEYGDPSIRR
    VYDGSWTFSEQRDQLLSEINLRGNRKARELIRYSFGGFQCPITSAAPYVSRKHKMLPMRILHELGSDLRPFGFDPCLPRH
    PLTPFPALERLHALKKAGSQVAINAREAVRFLDRATSDKGNAASERVILQGPMEQFEDWSEAEKFFLPEFEEEPEAAGRL
    GSADEPTLQDRREEKDSDRRKSNGATDDLSRMLLSKLNFKKDPDAASATSTGTHSGPASRPSSRSSRTSPDCVYINATNG
    DESKDYKSNGHRRTASGCTIPVVPPLPTIRTTQIWAQKFGIAVKNIHQLRTSIQYEEREYKNRCKYVEKTQNNEPKPLLS
    YEDESDEDELVFVPRGRGKGVSKSGGSRGSNNRKTSTTAKPVAPSLESTIEIPTQPIDPNSFSRSLGVPSKQHATVDLST
    QAGASRGFAGASRNNGNNRRGTSRGQTRGGSRGRGKLWVP

    >gi|67522106|ref|XP_659114.1| hypothetical protein AN1510.2 [Aspergillus nidulans FGSC A4]
    MRSAAKFFYLAVFGFMSQANADKHGEKSMHGYDTCACVRFGPNLKEYSEEDIPLTWRAEELSKLEGPKAGHPGRQQQHER
    PRDKPLQGMLGEDVGESCVVEYDDECDERDYCVPEDEGSSGKGDYVSLVDNPERFTGYAGAGANQVWDAIYRENCFLKPV
    PELEQSSFTPLGGLQAIQDFQNVLQKESKRPDLLPLDNECVEKRVFHRLISGMHASISTHLCWDYLNQTTGQWHPNLQCF
    KERLHNHPERISNLYFNYALVARAVSKLRKHLEGYTYCLGDPAQDQDTKEKISLLTSTLAERPQIFDENVMFQDPGAIDL
    KEDFRNRFRNVSRLMDCVGCDKCRLWGKLQVNGYGTALKVLFEYDETKNGENPPLRRTELVALINTLGRISHSIAAVRSF
    HRAMEVTDGQVFAIPAGSTAGQSRAGGKKVRRLVKNGGSTFYYEDDTAEDYQYISQQRPWERQRVKREGDTIIDDFKAEF
    SVVWDTLIFVLKSWVNIPWTFWEIGVLEANRLWSYWLGLPVPPRAWRIQLPQRPPPPIVVRDEL

    >gi|67522364|ref|XP_659243.1| hypothetical protein AN1639.2 [Aspergillus nidulans FGSC A4]
    MGSPIHISSKEQFNNLLTSSTFVVADFHAEWCGPCHAIAPVYDQLSAQLSRPNRITFTKIDVDKQQEIAKAYGVTAMPTF
    IVFERGRPTNTIRGADPTKLNQVIRKLANEASKSEASADSAQGSSSGGTWVGAAVPKGYSDITEEYDVRGLELLNRDSEF
    GVARTLFESSKPSALGNGKGKDGAADWIESDTDEQLMLFIPFKSTLKVHSLHITSLPPAEGEDDDEIPMRPRTIHLYTNR
    SHVLGFDEADDIPPVQTVTIESGDWDSKTGTAKIDLRFVKFQNVFSLNIFVVEGDGDGEKTRIDRIRIFGEAGEKREMGK
    LEKIGDEQGE

    >gi|67522471|ref|XP_659296.1| hypothetical protein AN1692.2 [Aspergillus nidulans FGSC A4]
    MAEGRAAPLRLGSTAPNFTADTSNGPITFHDYIGDSWAILFSHPDDFTPICTTELGAFAKLEPEFTARGVKLIGLSANGT
    ESHKAWIKDIDEVTGSKLTFPIISDPERKIAHQYDMVDYQDTTNVDSKGMALTIRSVFIIDPAKKIRLIMTYPASTGRNT
    AEVLRVVDALQTTEKHGVTTPINWLPGDDVVIPPPVSTEDAQKKFGDVRVVKPAYPYSSQLHRIYTSRFFLASKTPPRTR
    VRTASTGVLGTPISSSTVPPHRIAVAPSADLPDSATGTPAPNSSPNPVNLSGLVCNVRRTSGREPPPLVGATTTILGDKL
    YVFGGRILSKTRPHLTSDIYELDLIRRHWSKIEASGDIPRPRYFHSVCALGDSKLVCYGGMSPIANPPKDSTNGGNEPQP
    EVVVMSDINIFDVPTRTWTRINTHDSPQGRYAHCATILPSSAYFTSATAPLSAIHHNPASANPHQGSIGVDIDGLGGAEM
    VVVGGQDSTNRYIEQISVFNLRSLKWTNTSPLGRSCGAYRSVAAPLTGMRLSDIGSASADQEAQDPIEDVGAPGFPMLIY
    SNYNFLDVKLELQIRLPDGRLVEKPMPSQASPPGLRFPNGAVINGHFVVSGTYLTSSKQEYALWALDLKSLTWGRIDAGG
    SVFGHGSWNRGVLWSRRNTFVILGHRKRNLVEDYNHRRINFTHLCMVELEAFGLYNNPCRTSPTSAYISHSGPAVPASFQ
    QKLAQLRSGGRPFSAAAAELGRLAQTVPEMADMELQAVGGERISVNSRILSRRWGPYFIQLLRESSDTASDTATLRTGLQ
    PYPSRNSSITITPSLDHGSTYSNATTLASSNNNPAKSILANLELPSAHSLPPTSRPRVLFLPHTVLTLQVLVFYLYTSAL
    PPVGSPLCTPQILCSLLQLARPYQVDGLLEAVVERLHQVLDGRNAAAVFNAAAMAAGGGRGTGFISGPGGTLEALNGAHA
    ANELADLTNAISLTDTRSRLNSDSSDTEHGTASAVSVASSSAGGGTRGVPLRINTNIFSRRQGREREDSISNASTSSASA
    TSYDFSDSEGLPGDMARSSRRRRGTHGDNEVWTGDLSSVIGLQKRGLRGLMEGRRLRERSAKPPSSGQASVAAVPVDHTA
    NVI

    >gi|67522951|ref|XP_659536.1| hypothetical protein AN1932.2 [Aspergillus nidulans FGSC A4]
    MAPPPVNKSEDEWRAVLSPGKQACPAHSKSPPWAMAAGCSIEMESEYDSHYPSKGVYTCAGCHAPLYKASHKFKSGCGWP
    AYFDSIPGAVQRHVDNSFGMERTEITCTNCGGHLGHVFKGEGYPTPTDERH
    CVNSISLKFTENEEGEGAKAKA

    >gi|67523035|ref|XP_659578.1| hypothetical protein AN1974.2 [Aspergillus nidulans FGSC A4]
    MSLCKPTMQYSVTSSAFLRCLKQPPSIRMAPNYRLFSSYGNAHRSSKRDMQTATAYRPHTLPSSFPISPSPGAKDSSVAA
    DFVHYREPAQRNSQIQNTELKADVNQGEPQKSKPVESTPTTSKPAEKPRRKLRPRKAAMKLTPIAVEQLRKLLSQPEPRL
    IRVGVKNRG
    CSGLAYHLEYVDKPGTFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSARFVFRNPNIKSNGVRVRSV
    FAPNPPGPENNTLFITVRFSASIPDLRLDIDYPETTTATGLKQAIRARLPPSLSSHRLRLIYAGRGLEDTTPLAVSLKLP
    PPSNRFSKSLSAPDKDAASEDTSNQGISTKRDKGKAPIREPPRLYVHCSIGDIVLSAADLEAEAAAVSTLQIQGHNSHRS
    NDEKTKDSHSRQQSHDGQASSSTIPAPRGFDRLLSAGFTAAEVTALRSQFMATLSVSRTRDTMPTGAELRELEDRWLDEG
    SSTMATGGTVAGGEGVSFTDDDGGFGSNSRGAIDDMLWGAVMGFFWPVGCAMWLRREEGVWSWRKGLAVFVGVVVNIAFG
    AMRIMG

    >gi|67523437|ref|XP_659778.1| hypothetical protein AN2174.2 [Aspergillus nidulans FGSC A4]
    MARQGFHLHAFTITSSNLPVRDAAKLGKRRASAESETRPEKKAMTDTKMQVDTPTQDTVEKIKQGDIDESLYSRQLYVLG
    HEAMKRMGSSNVLVVGLKGLGVEIAKNIALAGVKSLTLYDPAPVAISDLSSQFFLQPQDVGKPRAEVTAPRVAELNSYVP
    VTIHEGSSLVENLEQLKRYQAIVLTLTPLKEQLVIADFCHKNGIYLTIADTFGLFGYLFNDFGKNFTVGDSTGEDPVGGI
    VADISEDGLVSALDETRHGLEDGDFVTFTEVKGMEGLNNSAPRKVTVKGPYSFTIGDVSGLGTYQGGGLFTQVKMPKFID
    FEPLSEQIKKPEFLISDFAKFDRPQQLHIGVQALHKFAETKGHFPRPHHESDAQELLQIANGLASSQEEKVELDEKLLKE
    LSYQALGDLNPLAAFFGGIVAQEVLKAVSGKFGPVHQWLYFDSLESLPTSVTRSEETCKPLGTRYDGQIAVFGKEFQDKI
    ANLTQFLVGAGAIGCETLKNWAMMGLGTGPKGKIYVTDMDQIEKSNLNRQFLFRSKDVGKLKSECASAAAVAMNPELEGK
    IVTLKDRVGPDTEHIFNEEFWEGLDGVTNALDNVEARTYVDRRCVFFRKPLLESGTLGTKGNTQVVLPRITESYSSSQDP
    PEKSFPM
    CTLKSFPNRIEHTIAWARDLFQTYFVGPPEAVNMYLSQPNYIEQTLKQAGNEKQTLEHLRDFLVTEKPANFDD
    CIVWARNQFEAQYNNAIQQLLYNFPRDSTTSTGQPFWSGPKRAPTPLKFDSTNPTHLGFIIAGANLHAYNYGIKNPGVDK
    GYYRKIVDNMIIPEFTPKSGVKIQASDNDPDPNAEASGSSFDDNDEIKRLVEILPSPKSLEGFRLNPVEFEKDDDTNHHI
    DFITAASNLRAENYEITPADRHKTKFIAGKIIPAIATTTALVTGLVALELLKIIDGKDDIEQYKNGFVNLALPFFGFSEP
    IASPKTKYQGKQGEVTIDQIWDRFEVDDIPLQDFLKHFSDLGLEISMVSSGVSLLYASFYGPSKVKDRLPMKMSELVEHI
    SKKPIPDHQKNVIFEVTAEDQTEQDVEIPAKSGLVRLSDPSVINVISCEGLQAPPQSSASFTHINLVLFLALIFMFLVLR
    RANQLVQHLSPFSALFGPSNSNISRNLSPALLAKREMATDISKKITDWVNPGDKSGEFKRQASVFRNLISKEAGAEFPPE
    KDRYHLYVSYACPWAHRTLIVRKLKGLEDIISYTSVHWHLGEKGWRFATPDEDIPGANTTPDPVHSSYSHLRDIYFANEP
    NYTGRFTVPVLYDKKTKRIVSNESSEIIRMFYYEFDDLLPAQYQKVDLFPPHLREQIDATNDWVYNDVNNGVYKSGFATT
    QEAYERNVTTLFASLDRIEKHLADSKSAYFFGDDITEADIRLFTTIVRFDPVYVQHFKCNIRDIRSGYPAIHAWLRRLYW
    DVPAFRETTQFEHIKKHYTKSHSQINPFGITPVGPTPDILPKDKEVNAVKH

    >gi|67523743|ref|XP_659931.1| hypothetical protein AN2327.2 [Aspergillus nidulans FGSC A4]
    MKTLQYLLKYSLACYLMVIPISSTVSSLLVRSLMWSSEKGLVDFARRAVETPGGDILHVPHAGFLRPTARSYRPNIFWME
    DLETRCASLRTEIAAAEAQLTKLKRELHEAEGAALRAQSQKTASANATTGQRTKSKWPLHGEEYRRYGRQMIVPQFGLQG
    QLKLRDAKVLIVGAGGLGCPAALYLAGAGVGTIGLVDGDTVEASNLHRQVLHRSRNVGKLKVDSAIEYLRELNPHPTYIA
    HQAHLTPREAPDIFKDYDLILDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNNPPQPPGDKTGGPCYRCVFP
    KPPPANSVTS
    CADGGILGPVVGTMGVLQASEAIKVLTSAGESVEATPPSLLIFSAYSSPQFRTIKLRSRRPNCAVCSAEA
    TVTLESVRSGSMDYVFFCGTVDPADILSPEERISPSEYGNVDSAGAQRHIIDVREKVQFDICSLENSINIPMSTILASAY
    SAPTLDADEPKRLPSWLPPEVAHESNKPIYVVCRQGNDSQTVVRKLKELGLDHGGERPVVDIKGGFRSWREQVDPDWPDY


    >gi|67523989|ref|XP_660054.1| hypothetical protein AN2450.2 [Aspergillus nidulans FGSC A4]
    MTRDTYLKRSLGTQANRIRESRVLLVGAGGIGCELLKNLLLTGFGEIHVIDLDTIDLSNLNRQFLFRHEHIKKPKAIVAK
    EVAQKFQPSARIEAYHANIKDSKFDVDWFATFNVVFNALDNLDARRHVNMMCLAADVPLIESGTTGFNGQVQVIKKNVTE
    CYDCNSKEVPKSFPV
    CTIRSTPSQPIHCIVWAKSYLLPELFGTSETDTEEFDYSADADNVEEIENLQREARALKEIRQSM
    GSAEFAQKVFDKVFKEDINRLRGMEDMWTSRKAPEPLDFKELEGTLSTVEPEVSLKDQRVWTVSENLAVFKDSLDRLSKR
    LKTLQSEESGSPAVLVFDKDDVDTLDFVTASANLRATIFGIEPKSKFDTKQMAGNIIPAIATTNAMTAGLCVLQALKVLK
    GDYDHAKMVFLERSGARAINSESLNPPNPHCPVCSVAHARIEIDLTRATLNDLVENILRTQLKYGQEFSVNTEQGTIYDP
    DLEDNLPKKLSDLGITTSAFLTVIDEDEQPRVNLQLIVVAPGSPPSEEQPIVLNRIPEIPRKPQAPAPYDAEANGTSNLG
    KRKRDANETELNGDPPTKRVANVSISDGADKAHPIDLSEAEGGAILIDDD

    >gi|67524273|ref|XP_660198.1| hypothetical protein AN2594.2 [Aspergillus nidulans FGSC A4]
    MANSGVAADELPTVETQNQISGYTLLDRNGKEILFREVYSHPDRTLVVFVRHFFCGSCQEYLQRLSTTVTPEVLSGLPGS
    TSIAIVGCGDPSLIEDYAAHTSCPYPMYCDPSRKLYETLGMVTTWEIGPQPGYISKGLPRLVVDGIWQGLKHIWDGKILK
    AGAAEQQGGEFLFERSNDGEKRISWCHRMQGSWGHTEIPALVDIIHGRKADELTTATE

    >gi|67515587|ref|XP_657679.1| hypothetical protein AN0075.2 [Aspergillus nidulans FGSC A4]
    MVRASTLLLSGLVTLATARSAVLDLIPKNFDKVVLNSGKPALVEFFAPWCGHCKNLAPVYEELGQAFAHAEDKVSIAKVD
    ADANRDLGKRFGIQGFPTIKWFDGKSETPEDYKGGRDLESLTAFVTEKTGIKAKGAKKEPSNVEMLTDTTFKSVVGGDKD
    VFVAFTAPW
    CGHCKKLAPTWETLATDFALEPNVIIAKVDAEAESSKATARSQGVTGYPTIKFFPKGSTEGIVYQGARTEE
    AFVDFVNNNAGTHRAPGGTLNEKAGTILALDEIVAKYITSKNFGELVDEAKKVAKTVGGKYAEYYVKVAEKLAQNEEYAA
    KELERLKKVLSKGGSAPEKLDDMVSRSNVLRKFLEVEEKVEDVVKDEL

    >gi|67515777|ref|XP_657774.1| THIO_EMENI Thioredoxin [Aspergillus nidulans FGSC A4]
    MGASEHVPPITSKAEFQEKVLNAKGFVVVDCFATWCGPCKAIAPTVEKFAQTYTDASFYQIDVDELSEVAAELGIRAMPT
    FLLFKDGQKVSDVVGANPGALEAGIKALLA

    >gi|67515933|ref|XP_657852.1| hypothetical protein AN0248.2 [Aspergillus nidulans FGSC A4]
    MLQPSSALLLVASLLAALPVNADGLYTKKSPVLQVNQKSYNQLIANSNYTSLTQDQIVEFYAPWCGHCQNLKPAYEKAAK
    NLDGLAKVAAVNCDDDANKPFCGQMGVQGFPTLKIVTPSKKPGKPRVEDYQGPRTAKAIVDAVAERIPNHVKRITDKNLD
    EWLSEDGETPKAILFTEKGTTSSLIRALAIDFLGSIKVAQIRDKETAAVDRFGIAEFPSLVLLPGNGKEHIVYNGELKKG
    PIVEFFSQAAAPNADPAPATEKTKSHSSKSSASGKEPTSNEPLGSEDSTIEAKHSAPTPTPPPAIDTLGTPDALEAVCLA
    PKSGTCVLALIPESGDPDTEASASTKEALESLAEVAHKHTQRKTKLFPLYSVPASNAAAKALRAGLGLPEDSKSVEIVAL
    NARRGWWRLYDSSDRADFSPVRVEAWIDAIRLGEGPRNKLPEGIVVTTDEAAKKADHDEL

    >gi|67516609|ref|XP_658190.1| hypothetical protein AN0586.2 [Aspergillus nidulans FGSC A4]
    MMDQHPLPFLTHSPIDPGSIDGEKATAYARGVLNRLNAALAASDTEALENCFYSDQASWKDQLALTWHLRTFRCHNTIAA
    SFLDTARLRGLSSGITIDGEAVFLSATPALVCPESPIAYSPSLQDAMNFETDVFIIGAGNAAIALSACLKALGVESVMAD
    RNAHPGDNWARRYDCMRFHVPTAF
    CDLPYMYRATVYDEELRSPHLLTRQDLTSQVRRYVNSFNLNTLHLAEIQWTEYDEL
    AKKWTIAFQTPAGQCKATSSHLVLATGIGSLKPNIPYIAEPHIYKGISIHSAEYKNAKLLKEQGVKSVVLIGSANTAFDV
    LENGHSAGLNATMVARSPTYIVPLEYVYHQASLGTYDTESMQPIISSSHCQHLWTDSCVVDCFPRSHRLNWNDTPQSRQP
    GPCSQQSRTNGSFRESTCLDTDAIIWCTGFADSNVVTTATEILGGKSDVTVANTKIDDQTGRAHVLTPGGIASHLDTTWG
    VDEEGEIRGMWKRHSHVESIWIMGGYTQQHWWYSRILALQIKAALQVKVGSKDNNSALKGIVSSTLRSIASSCSGRDYYG
    LSSQGRDKDAISSNTAR

    >gi|67517316|ref|XP_658536.1| hypothetical protein AN0932.2 [Aspergillus nidulans FGSC A4]
    MPPVETKQYDYIVLGGGSGGSGSGRRAAGWYGAKTLIVESGRAGGTCVNVGCVPKKMTWNFASITESIEAGRHYGYDLPH
    NIDVNYTHFKKLRDSTIERLNGVYEKNWGNEGIDLVHGRARFVEKKTIEVTNQDGSRTRYTAPHILIATGGRPSLPDIKG
    SEHGISSDGFFEIEELPPKLAVVGAGYIAVELAGVMGTVGVDTHMFIRGETFLRKFDPMIQKTMTERYEAVGIHVHKKHP
    GIKEVQLLRDGKGKDKLLKLIMNDGSEMEVNELLWAIGRVPEVEDLHLEIPGVELNKSGHVVVDEYQNTNVEGIYAIGDV
    TGQAELTPVAIAAGRQLGNRLFGGPQFKNAKLSYDNIPTVVFSHPEVGTVGLTEPQARERFGDENVKVYHTRFPAMFYSV
    FPPEEKAKNPTEFKMVVAGPEEKVVGLHLLGLGVGEMTQGFGVAVKMGATKKDFDSCVAIHPTSAEELVTLR

    >gi|67517751|ref|XP_658661.1| hypothetical protein AN1057.2 [Aspergillus nidulans FGSC A4]
    MQAQRHQGHDTASGVGPKLVNRLEASKSPYVRAHRHNPVAWQLWDAESMELARRHNRLIFLSIGYSACHWCHVMEKESFM
    SQEVASILNESFIPIKVDREERPDVDDIYMNYVQATTGSGGWPLNVFLTPDLEPVFGGTYWPGPNAASLLGPETVSFIEI
    LEKLRDVWQTQRQRCLESAKEITKQLREFAEEGTHTFQGDQSDEDLDVELLEEAYQHFASRYDINNGGFSRAPKFPTPAN
    LSFLLRLGIYPSAVTDIVGQEECENATAMAVSTLISMARGGIRDHIGHGFARYSVTADWSLPHFEKMLYDQAQLLDVYAD
    AFKITHNPEFLGAVYDLITYLTSAPIQSTTGGFHSSEDADSLPTPNDTEKREGAFYVWTLKELTQVLGPRDAGVCARHWG
    VLSDGNIAPENDPHDEFMDQNVLSIKVTPSKLAKEFGLGEDEVVRIIKSGRQRLREYRDKNRVRPDLDDKIIVAWNGLAI
    GALAKCSVLFEEIDSSKSAQCREAAAKAINFIKETLYDKATGQLWRIYRDGSKGTTPGFAEDYAFLTSGLLDMYEATFDD
    SYLQFAEQLQRYLNENFLAYAGSSPAGYYTTPSTSAPGSPATLLRLKTGTESAVPSVNGVIARNLLRLSSILEENSYRVL
    ARQTCQSFAVEILQHPFLFVGLLDVIVGLNTGTRNITAVVAADSSLSTSTEGGTPTSAWDGLVKRIRAEAGPTLSTSSNT
    VAALVDVRNSSQGVSTGNKSSWLRRRNPLFKDLKAGDKNYLLICEEGRCRTVNL

    >gi|67521866|ref|XP_658994.1| hypothetical protein AN1390.2 [Aspergillus nidulans FGSC A4]
    MSDQEHHYKFNVSMSCGGCSGAVERVLKKLDGVKSFDVNLDSQTASVVTDASVPYETVLATIKKTGKTVNAGEADGEAKD
    V

    >gi|67537436|ref|XP_662492.1| DCPY_EMENI Pyruvate decarboxylase [Aspergillus nidulans FGSC A4]
    MADIATRELRQPIDIAEYLFRRLHEVGIRSVHGVPGDYNLAALDYLPKCGLHWVGNCNELNAGYAADGYARVNGIAALVT
    TFGVGELSAINAIAGAYSEFVPIIHIVGQPHSRSQKDGLLLHHTLGNGDYNVFSSMNKGISVTTANLNDTYDAATLIDNA
    IRECWIHSRPVYLALPTDMITKKIEGERLKTPIDLSLPANDPEKEDYVVDVVLKYLHAAKNPVILVDA
    CAIRHRVLEEVH
    DLIEVSGLPTFVAPMGKGAVNETHRCYGGVYAGTGSNPGVREQVESSDLILSIGAIKSDFNTAGFSYRIGQLNTIDFHST
    YVRVRYSEYPDTNMKGVLRKVIQRLGFIKADPVPHISNALPEHEKNSSEQRITHAWMWPMVGQWLKENDIVITETGTANF
    GIWDTRFPSGVTAISQVLWGSIGYSVGACQGAALAAKEQGNRRTVLWVGDGSLQLTLQEISTMIRNNLNPIIFVICNEGY
    TIERFIHGWDESYNDIQTWDIKGLPVAFGGKGRYKGYKVTTRDELTKLFASEEFSSAPCLQVSLCDLTHYLSDANFEQLV
    EVHMPREDAPASLKITAEAAASRNK