Aspergillus fumigatus uid14003

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|70990594|ref|XP_750146.1| Rhodanese domain protein [Aspergillus fumigatus Af293]
    MASVLSIRRPIAALAARTAKTTSQKAIPHAAVTALLSSTASPRSYFTAPRPQTARLALASSNIKQHLSHQQQTIRRINDY
    TTKPLRSWKFEDINAALPSDPAGPPSPPANPQGKLILIDVREPAELTSTGIIPTAVAVPLASQPDALFLTPDEFETRFGF
    PKPGIEEEGDIIFY
    CKAGVRAKTAAQLAVQAGYNPDRIGVYEGSWLDWADKGGRVEKWEGPKHE

    >gi|70990844|ref|XP_750271.1| selenoprotein domain protein [Aspergillus fumigatus Af293]
    MTEPTPPIEQHPPSSSTTTNPPPTTTTTTATTTTTLPRITIKYCTQCKWMLRAAYFAQELLSTFSTSLGEVALVPCTGGT
    FIVSITSLSETEVRESVLWDRRVDGGFPEVKVLKSRVRNVVDPQRDLGHTDRALRKEHGDSQQQSQEKKTEKCEDCQA

    >gi|70990864|ref|XP_750281.1| disulfide isomerase [Aspergillus fumigatus Af293]
    MMQPSSALLLVASLLAASSVNADGLYTKKSPVLQVTQKTYDQLIANSNYTSIVEFYAPWCGHCQNLKPAYEKAAKNLEGL
    AKVAAVNCDDDANKPLCGRMGVQGFPTLKIVTPSKRPGKPKVEDYQGARSAKAIVDAVVDRIPNHVKRVTDKDLDQWLSE
    DQESPKAVLFTEKGTTSALLKAVAIEFLGSIKVGQIRNKESKAVEKFGVKEFPTLVLVPGGDKEPIIYDGELKKQAIVEF
    LSQVAAPNPDPAPASTDAKSSKATKSAKSPKSSTILSEEAENLKPTASPDPKVVPDDATESKPAQVPIQAPPIPVLPTAE
    ELEAACLKPTSGTCVLALLPEPREGDADVSSPAKEALTSLSEIAHKHAQRKSKLFPFYSIPAINSGAKTLRAGLGLSEDQ
    TSVEIIALNGRRGWWRRYDASEAQDYGAVSVEAWIDAIRLGEGSKSKLPDGVIVEQKEEGDVEAKKDADKEKGDHDEL

    >gi|70991020|ref|XP_750359.1| glutaredoxin Grx1 [Aspergillus fumigatus Af293]
    MSAAKTKAQNLINENAVVVFSKSYCPYCNASKKTLKDLGAKFYALELDEIDDGREIQNALYEMTQQRTVPNIFIGQKHIG
    GNSELQAKSAQLPALLKEAGAL

    >gi|70991244|ref|XP_750471.1| DSBA-like thioredoxin domain protein [Aspergillus fumigatus Af293]
    MTNINIQIISDTVCPWCYVGYRRLSRAITAHKAIYPSDTFTLTWHAFYLNPASPGYPGVDKREYYASKFGEGRAAAIFSR
    LAAAEEPDGIAFKFGGRTGNTRDSHRVLWYAGLKEKEAGARGGAAATNGDASEEKVGGLQTRVAEQFFRAYFEEEKNITD
    RKMLVDSAAAAGLDRGEVEKFLESGDEGGKDVDLEAERARHRLVTGVPYFTVQGQYAIEGADEPETFLEVFEKVKQIS

    >gi|70991322|ref|XP_750510.1| YdiU domain protein [Aspergillus fumigatus Af293]
    MANQLSTRAAGVSLAELPKSNVFTTKLPPDPAFETPESSHKAPRETLGPRLVKGALYTFVRPEPAGETELLSVSPKAMKD
    LGLKMGEELTPQFQALVSGNEIWWNAKDGGIYPWAHGSWAGQLGDGRAISLFECINPQTKRRFELQLKGAGKTPYSRFAD
    GKAVLRSSIREYVVSEALSALGVPSTRALAITLLPKSKVLRERIEPGAIVARFAETWLRIGSFDLPHSRGNRDLIRKLAT
    FTAEDVFGGWETLPGVVSLGSDQSADAVDNPARGIPRDHAEEHQGVTENRFARLYREIVRRNAKTVAAWQAYGFMNGVLN
    TDNTSILGLSLDFGPFAFMDNFDPQYTPNHDDHLLRYSYKNQPTVIWWNLVRLGEALGELIGAGDKVDEEWFLKDGLTEE
    TAPPVVKRAEAIIERTGDEYRSVFLNEYKRLMSRRLGLKTQKESDFHELFSEMLDTLEALELDFNHFFRRLSNVALADIE
    TDQQRMDTAPIFFHSEGFGGIGYTERSAKERIAKWLAAWRIRILEDWGIENDADRQKDMNAVNPKFIPRGWILDEVIERV
    EKRGDRKILDRVMQMALDPFRDSWGLDKDEEERFCGDVPRYKRAMMCS
    CSS

    >gi|70994958|ref|XP_752255.1| iron/copper transporter Atx1 [Aspergillus fumigatus Af293]
    MSEHQYKFNVSMSCGGCSGAVERVLKRLDGVKSFDVNLDSQTALVTTEPTVSYETVLATIKKTGKTVNSGEADGKPMDV

    >gi|70995702|ref|XP_752606.1| DUF255 domain protein [Aspergillus fumigatus Af293]
    MHSQTHLGSADHEPKLVNRLRDSRSPYVRAHMNNPVAWQLWDAEAIELARRYNRLIFLSIGYSACHWCHVMEKESFMSQE
    VASLLNESFIPIKVDREERPDIDDVYMNYVQATTGSGGWPLSVFLTPNLEPVFGGTYWPGPNSSTLSRQDTVGFVDILEK
    LRDVWKTQQQRCLDSAKEITRQLREFAEEGTHSQQGDRQAGEDLDIELLEEAYQHFASRYDTVNGGFSRAPKFPTPANLS
    FLLRLKTYPSAVSDIVGQEECDRAAAMAVSTLISMARGGIRDHIGHGFARYSVTADWSLPHFEKMLYDQAQLLDVYVDAF
    KITHNPELLGAVYDLATYLTTAPIQSPVGAFHSSEDADSLPTPNDTEKREGAFYVWTLKELTQVLGQRDAGVCARHWGVL
    PDGNIAPEHDPHDEFMNQNVLSIKVTPSKLAREFGLSEEEVVKIIKSAKQKLREYREKTRVRPDLDDKVIVAWNGLAIGA
    LAKCSALFEEIESSKAVQCREAAARAINFIKENLFEKATGQLWRIYRDGSRGETPGFADDYAYLIHGLLDMYEATYDDSY
    LQFAEQLQSMFHDRGSFGRTILTQAEYLNDNFLAYVGSTPAGYYSTPSTMTPGMPGPLLRLKTGTESATPSINGVIARNL
    LRLSALLEEEEYRTLARQTCLSFSVEILQHPFLFVGLLDVIVGLQTTTRSVTGVFCTANLPQSVTLEGTDRLINKPEEPV
    SVRDMIIKKIRSEAGSTMVTSATVTSLVDIRPSHLGDFVGNQSFWLRTRNPLLKELKPSGTVKNYLMVCESGRCTMVDV

    >gi|70996414|ref|XP_752962.1| glutathione oxidoreductase Glr1 [Aspergillus fumigatus Af293]
    MAPTDVQQYDYIVLGGGSGGSGSARRAAGWYGAKTLIVESGRAGGTCVNVGCVPKKMTWNFASINEALHVGEHYGYDIPK
    DVKINYRQFKETRDAVVKRLNGAYERNWGKEGIDLVHGRARFVEPKVIEVTLNDGAKARYSAPHILIATGGRPIIPPVKG
    AEHGITSDGFFEIEELPPKVAVVGAGYIAVELAGVMAAVGVETHMFIRGETMLRKFDPMIQKTMTERYEATGVHIHKKHG
    GFKEVQLVKDGKGKDKVLKLIGNDGSEEEFNELLWAIGRQPEVEDLHLEIPGVKLNESGHVVVDQYQNTSAEGVYALGDV
    TGVAELTPVAIAAGRQLGSRLFGPPALKSAKLSYENIPTVVFAHPEVGTIGLTEPQARQRYGDDKVKVYYTKFTAMYYDV
    LPTEEKKKNPTEFKIVCVGPEEKVVGLHILGLGVGEMLQGFGVAIKMGATKKDFDSCVAIHPTSAEELVTMR

    >gi|70996444|ref|XP_752977.1| arsenic methyltransferase Cyt19 [Aspergillus fumigatus Af293]
    MAEDTYQQVQSHYGDIAKRSRVTFHDKEDEIALAFGYNATDLRALPDKANLGLSCGNPVAYANIKQGETIVDLGSGGGID
    VLAARKVGPEGNAIGIDMTRDMVDLAKTNAEAAGLPNTRFIEASITSIPLPDASVDCIISNCVINLIPLKDKPSVFQEIA
    RLLKPGGRIAISDILARKELPPKIVNDIALHVG
    CIAGASQVVDKADLNLYKQSSYLGQSSCCGPAESRKEWPTEFAELDF
    NEWVGKFPLSQYW

    >gi|70996450|ref|XP_752980.1| copper-transporting ATPase [Aspergillus fumigatus Af293]
    MGDDYCGPPAPVSESDVMPLAAPSEKTSSCQDSCCDNDDAEPLDTPAPGQKSPTPQKPDDCCSAGKCADNKTENHTDAPD
    CCRGKVRPCCDTSCLNLLAMRECEMSATAASSPTIQPNTCGGATDHKACSQHSLSALDRYGATLQALGCICRALIALGQE
    TCCEIRERRSLDGKQCSKKSSARSLRTSLDSCSNGSVTKDQAAQNRPRLRSGSRESTRTVGKASADVCVVSFCSKDKPAK
    ELPNAASSGSCCEPPKQDTMKASMTGCADSRCTEKQPPNPQGSCTDACCSSAVPDPGLEIEEASTDAVTDIENRGTGKEH
    VILSISGMT
    CTGCETKLRRALATVPAVKDLKTSLVLSRAEFNIDLRLGSVEEIMKHLERTTEFKCARVQNQGSSLDLIVP
    DEPSNFIRQTWPDGVLDMAPIDRQTVRVAFDPNIVGARDLIEKIWGPPIKLASPRGDPSLEAGSKHVRHAGYMTLLSAVL
    TIPVLVMAWASLPDREVAYSSASLALATIVQVVVAGPFYPKALKALIFSRVIEMDLLIVLSTSAAYIFSVVSFAYLIAEQ
    PLSTGQFFETSTLLVTLIMVGRWVAALARQRAVESISIRSLQASTAILVDQESGTEREIDARLLQYGDTFKVLPDTRIPT
    DGTVINGSSEVDESMLTGESRPVEKYPSSVVVAGSINGSGVMTVRLNRLPSDNTINTIAAMVDEAKLSKPKLQDLADRVA
    SYFVPVVLVLTIITFLIWVALGMTVRGYDGSEATIRAITYAITVLIVSCPCAIGLAVPMVIVIASGVAAERGIIFKSADA
    IEVAHKTSHVVFDKTGTLTRGKLSVVASECDNVDKLPLLLGLIENSRHPVSVSVAAHLKDAGVMASAVPEPKSLTGKGVE
    TTFGGRKLRAGNSRWLNLSDNEVVQPMLAQGYTVFCFTIDNTLQAVYGLEDELRPDAVGTIKTLQRRGVSVHVVSGDDDG
    AVQSLASKLSIPGDNVRSRSSPADKKDYIQTLLSTGIDRKKPIVVFCGDGTNDAVALAQATIGVHMNEGTDVAQSAADVV
    LMRPSLAGIPTMMDASRKSVNRIKFNFIWSFVYNTFAVLLAAGAFVNARIPPEFAGLGELVSVLPVIAAALLLRWSKI

    >gi|70988675|ref|XP_749195.1| glutathione S-transferase [Aspergillus fumigatus Af293]
    MSAPKITLYTNHRCPWAHRAHIALKELGLDYEEVIIDLNTPREPWYLEINPRGLVPAISYNGTIITESAIVAQFLADAHP
    SHLLPPSNSVEGALQRARIAFFVDTFFSKVAPHFLASQRATSDQDRVAAGEAIVAAIEKELEPILASQKGPGPFFGGREK
    LTLAEVLIGSFLLRLLSFHKPEHGLLREDLPQLLEKRTPAFTKWANATVEQESVNFIWDEKSVVELTKKKIASLAKK

    >gi|70988988|ref|XP_749344.1| methylated-DNA-protein-cysteine methyltransferase [Aspergillus fumigatus Af293]
    MRTKQSPSKPTPTPPSSQECISLSPQTKKFLHRISLHPTLTPYRRRVYRTLLSVPKGRWTTYSALATHLGSSARAVGNAM
    RTNPFAPEVP
    CHRVLATNGTLGGYKGEWILGGKYQVEKRLLLEAEGVVFDERGRAQGECFRGFVDLGSGK

    >gi|70988990|ref|XP_749345.1| dihydrolipoamide dehydrogenase [Aspergillus fumigatus Af293]
    MFRSMMPRATPRAALRTSGPQTIPSSFVAAPSLSVYGRFRRGYASETEHDVVIIGGGVAGYVAAIKAGQEGLKTACIEKR
    GRLGGT
    CLNVGCIPSKSLLNNSHLYHQILHDTKKRGIEVGDVKLNLEQMMKAKDTSVEGLTKGIEFLFKKNGVDYIKGTG
    AFVDEHTVKVNLLDGGEQTLRGKNIVIATGSEATPFPGLNIDEKRIITSTGALSLKEVPKKMVVIGGGIIGLEMASVWSR
    LGADVTVVEFLGQIGGPGMDADIAKQAQKILQKQGIKFKTNTKVTKGDDSGATVKLSIEAAKGGKEETLDADVVLVAIGR
    RPYTEGLGLENIGIDKDERGRLVIDQEYRTKIPHIRVIGDCTFGPMLAHKAEEEAVAAVEYIKKGHGHVNYAAIPSVMYT
    HPEVAWVGQNEAEVKAAGIKYRVGTFPFSANSRAKTNLDTEGQVKFIADAETDRILGVHIIGPNAGEMIAEATLAVEYGA
    SCEDIARTCHAHPTLAEAFKEAAMATYSKAIHF

    >gi|70989199|ref|XP_749449.1| peptide methionine sulfoxide reductase [Aspergillus fumigatus Af293]
    MSEITQTATLAAGCFWGVEHLFRKHFGNGKGLLEAKVGYCGGSTSSPSYRAVCTGTTGHAEAVQLTFDPSVVSYGSLLEF
    FYRMHDPTTKDRQGPDVGTQYRSAIFTHGEEQHKIAEEITDKVSKQWYKQPVSTQIIPAGQWWDAEEYHQLYLTKNPSGY
    ECPAQ

    >gi|70989789|ref|XP_749744.1| protein disulfide isomerase Pdi1 [Aspergillus fumigatus Af293]
    MRSFAPLVLSLLGASAVASADATADTTSDVVSLTKDSFKDFMKEHDLVLAEFYAPWCGHCKALAPKYEEAATELKGKNIP
    LVKVDCTEEEDLCKENGVEGYPTLKIFRGPDSSKPYQGARQADSIVSYMIKQSLPAVSTVTEENLEEIKTMDKIVVIGYF
    ASDDKAANDVFTSFAESQRDNYLFAATSDSAIAKAEGVKQPSIVLYKDFDEKKAVYDGAIEQEAILSWVKTASTPLVGEI
    GPETYSSYITAGIPLAYIFAETKEERDQYAEDFKPVAEKHKGAINIATIDAKMFGAHAGNLNLDPQTFPAFAIQDPEKNA
    KYPYDQSREFNAKEIGKFIQDVLDGKVEPSIKSEPIPETQEGPVTVVVAHSYQDIVINNDKDVLLEFYAPW
    CGHCKALAP
    KYEELAALYAGDFKDKVTIAKIDATANDVPDSITGFPTIKLYPAGAKDSPVEYSGSRTVEDLANFIKENGKYKVDALVAA
    SEKVEEGPDVTASPSATSTEAEAPAATGDEKGDHDEL

    >gi|70989815|ref|XP_749757.1| oligosaccharyl transferase subunit (gamma) [Aspergillus fumigatus Af293]
    MKLNSLISFLCIAASALCTSSDPNKYEKYKSVSPVAPIGLTDVTYHDLTSKPRDFHVAVLLTATDARYGCALCREFQSEW
    DLIARSWNKGSKSDDLKLLLATLDFSNGKETFQKLMLQTAPVLLLFPPTVGPFAKVDNAPVRFDFTGPLSADQLYTWISR
    HLPEGAKPPLIRPINYMRIISAITLLMGVITLFTVLSPYALPIIRNRNLWAGFSLIAILLFTSGHMFNHIRKVPYVVGDG
    KGGISYFAGGFSNQFGMETQIVAAIYAVLSFAAIALSMKVPRMGDKKAQQLAVVIWAGVLLCMYSFLLNVFKTKNGGYPF
    YLPPF

    >gi|71001378|ref|XP_755370.1| iron-sulfur cluster assembly accessory protein Isa2 [Aspergillus fumigatus Af293]
    MSLVRAFLLLQHQYSSVYFELSGFIYYRCFVSNPFHKTFSVLPPTLCLLCINCSTGRQSRTESEGRRGREGVDDQYLLSG
    SRGYHLPWLPRDLHISTLLGGGELRHQGISLVEHNPSTYDHRVWKTGLPVRSAVLKPHAGRLVVGWRLREITDPSSSQLA
    TKEENPYHHLRITVTSGG
    CHGFQYLMSLEAASKIDPEEDTVFEAEPEQGTTSGAGEAKVVMDEPSLELLSGSTVDYTMEL
    IGSQFKIVDNPRATSNCGCGTSFDVKD

    >gi|146322904|ref|XP_755392.2| disulfide isomerase [Aspergillus fumigatus Af293]
    MRSSLLAWSFLSLLSIPTFAIPSGGIANDLNLANNRLVKRAEPVEKTESEPVSTTFNGVEVPPLKELTPENFEELTKNGY
    WFVKHYSPS
    CPHCKAIAPTWQTLYEYYYTSKPISSSSEPSDTQSLNSFQNFYNFHFASMNCLAFSDFCKRLDVKWFPTFS
    LYHNGKLIEQFEGAKTMEGLSEFIEGKLESIRPGSRPPKGVKLPKPGDKQVDTEAAPDVPAAKDKDRVAGVKAGEKHNEQ
    VAQLASAEAPVKSATPKVNSKPSAPANPQGISVPLTAESFQKLVTTTRDPWFVKFYAPW
    CHHCQALAPVWQGMAREMQHV
    LNVGEVNCDAEPRLCKDARVNAYPTMYFFRGGERVEYTGLRGLGDLVNYAKKAVDIGSGVQDVDAAQFKQLEEKEEVIFL
    YFYDHATTSEDFEALERLTLSLVGHARLVKTSSAALAERFKITTWPRLLVSRDGRPSYYNALAPKDMRDVRQILNWMRSV
    WLPIVPELTVSNAREIMDGKYVVLGILSRRRSDDFILAKRELKSAALEWMDKQTQLFRLERQELRDAKQLRIEEAEDRND
    QRALRAAKNMRISIREDDKKQVGFAWVDGEFWERWLRTTFGIDIENGERVIINDQDNRRYWDATSSGAPIMASRTSILET
    IPLVIADSSKLKPKSTVGTFEYIFFVTRSFISGHPIIFVALLTISIVAVTYLARARLAKRGLSRGGILGAVQSNSAGFFR
    LDGKEGLLNGGGTGKVD

    >gi|146322986|ref|XP_755706.2| NEDD8 activating enzyme (UbaC) [Aspergillus fumigatus Af293]
    MAPLSSTSRWRHLYSVLSKPGPYSDEDWVPGPETISALESSKILGAGGLGCEILKNLALSGFKDIHVIDMDTIDISNLNR
    QFLFRQTDIGKPKAEVAASFVEKRVKGVKITPYVGKIQDKDEDYYMQFKIIVCGLDSIEARRWINSTLIGMVDPENPESL
    KPLIDGGTEGFKGQARVILPTLSSCIECQLDMHAPRPAVPL
    CTIATIPRQPQHCIEWAHQIAWQEKRKDDAFDSDDMEHI
    SWVYNAALERANQFHIHGVTFQMTQGVVKNIIPAIASTNAVIAAATTSEALKIATSCNPYLENYMMYAGEDGVYTYTFEA
    EKKADCPVCGNLARKITVDPNMTLEEFIESLGERAEAQLKKPSMRTEEKTLYQRFPPQLEEQTRSNLKLKLKELVENGQE
    IAVSDPAYSIDFRFQLIFK

    >gi|71002296|ref|XP_755829.1| thioredoxin [Aspergillus fumigatus Af293]
    MSTLNEITSDADFSAHTSSLPPSTLLVLYFHAPWAAPCAQMRAVLSALASQHPVTTPPTISFVSVNAEELPDISEEYNVT
    AVPYVVLIRNGQILESISGSDAVKVRDAVERHAGAGSGAGADGANKTAIPPPLTATPRENAPAAAAQPPAPSTQALTPEQ
    SKEALFARLAELVKAAPVMLFMKGTPSAPQ
    CGFSRQLVAILREKSVKYGFFNILADEDVRQGLKEFADWPTFPQLWVEGE
    LVGGLDIVKEEINNDPDFLSQYSINKAPASA

    >gi|71002460|ref|XP_755911.1| poly(A)+ RNA transport protein (UbaA) [Aspergillus fumigatus Af293]
    MQLDNPQETVEKIKQGEIDESLYSRQLYVLGHEAMKRMSSSNVLVVGMKGLGVEIAKNVALAGVKSLTLYDPAPVVISDL
    SSQFFLQPQDVGKPRAEVTAPRVAELNSYVPVTVHKGSNLVDDLEQLKQYQAVVLTATPLKEQLAIADFCHKNGIYITIT
    DTFGLFGYIFNDFGKNFTVGDATGEEPVSGIVADIDEDGLVSALDETRHGLEDGDYVTFTEVKGMEGLNNCDPRKITVKG
    PYTFSIGDVSGLGTYQGGGIFTQVKMPKFVDFEPFSEQLKKPELMVSDFAKFDRPQQLHIGVQALHKFAEAHDGQYPRPH
    NDDDAQEVIKIANELASSQEEKVELDEKIIRELSYQARGDLNPLAAFFGGVAAQEVLKAVSGKFNPIHQWLYLDSLESLP
    TSVTRSEESCKPLGTRYDGQIAVFGKEFQDKIANLTQFLVGAGAIGCETLKNWAMMGLGTGPKGKIFVTDMDQIERSNLN
    RQFLFRSKDVGKLKSECASAAAQAMNPDLKGKIVTLRDRVGPDTEHIFNEEFWEALDGVTNALDNVDARTYVDRRCVFFR
    KPLLESGTLGTKGNTQVILPHITESYSSSQDPPEKSFPM
    CTLKSFPNRIEHTIAWARDLFQTFFVGPPEAVNMYLSQPNY
    IEQTLKQAGNEKQTLEHLRDFLVTNKPTSFDDCIIWARQQFEAQYNNAIQQLLYNFPRDSKTSSGQPFWSGPKRAPTPLK
    FDSSNPTHLAFIVAGANLHAFNYGIKNPGVDKEYYRKVVDNMIIPEFVPRSGVKIQADENEPDPNAQQSSSLDDSQEIQR
    LVESLPPPESLGGFRLNPVEFEKDDDTNHHIDFITAASNLRADNYDIPQADRHKTKFIAGKIIPAIATTTALVTGLVALE
    LYKIIDGKDDIEQYKNGFVNLALPFFGFSEPIASPKGKYLGKQGEVTIDRLWDRFELDDIPLQDFLKHFSDLGLEISMVS
    SGVSLLYASFYGPSKVKDRLPMKMSKLVEHISKKPIPEHQKNIIFEVTAEDQNEEDVEIPYVMVKLQK

    >gi|70986132|ref|XP_748563.1| ubiE/COQ5 methyltransferase [Aspergillus fumigatus Af293]
    MQSTETIQAVQDYYGGLAERGSTGRSEDYQTNVAKAFGYDPEDLKFLPENANLGVSCGNPLALASLREGETVIDLGSGGG
    IDVILAARKVGPKGKAIGVDMTKVSIHVYRADYTLPASDLLPIYQKMLALAHENVEKAGITNASFVEGFITAIPLEDSTA
    DCIISNCVVNLVPKEQKSLVFHEMFRLLKPGGRVAISDILARRELPPEIANDLALYVG
    CIAGASQAQQYHAYLKDAGFGG
    TSTNPLATDRKMLILCADIMIVDTKADLNIYKDMPQEKSACCGMSCSDLQSNDKIRDYDCNEWAGELVLDEASRRGPWLT
    QFLGSFQIYAVKPAL

    >gi|70986364|ref|XP_748676.1| pyridine nucleotide-disulfide oxidoreductase [Aspergillus fumigatus Af293]
    MSADSSSPLVVKEPKDGGMPTEGEKLRLVIIGGARGGMSAAVRARRLNENASIIVIERGSYISYTNCFAPFSLGGAIERD
    TWIAVQTPAGLKARFNVDVRVCTELVSISRERHSITVRCRKTDTTYDLPYDKMILAQGADPAGRPMADIEKDKVFPLQTP
    ADLQAIRSFVVKNDCREVVILGGAFTGLKAVESLHSFGLHVRVVEAGDRLCPEFDPDFATIIQKELVKRGVGIHLGRGEC
    QTIAETEDSDRCRIEFHDGSSLSADLVVVATEPEPRVQHAKNAGLTVRKGIVVNAFMQTSDPDIYAVGSVAEVVNSISHM
    PQVSSSMSGASNRQGRLAADHIFTRATAYPGTAGTHVYHVFHLTAAITGLSVSELRQIGYDPQSVTIHQPDHAGYFPSAQ
    QLTLRVAFERASGVLLGAQIIGHSGVDGRIDVLATAMQAGMTVFDLEHLELSYMPQYGSVRDPVNLAGSVGSNLLRGDLH
    IVHPQDLQDHLHEWPIIDVRSAEHFAQGHLPLARNIPIDTLRSRLAEIGKDRPVLVYSRVGYHGYLAYRNLVQSGYRAAN
    LDGGLKLFTDGGYQPELTVD

    >gi|71000357|ref|XP_754873.1| mitochondrial metallochaperone Sco1 [Aspergillus fumigatus Af293]
    MASSARPVSRILGRLSRSGISTVESSAHLPTQRTASLLSRSALTTPKPNGIGIRRATPQQRGFSTSPACLRAKTMGQLRA
    RNATGPFSWKAALLFVLTGAGMIVYFRVEKERLERKRIAEMSKGVGRPKVGGPFTLTDLDGKEFTAEDLKGKYSFVYFGF
    TH
    CPDICPDELDKMAEIIDRVKEATKGENIFLPVFITCDPARDTPQVLREYLKEFHPDIIGLTGTYEQVKHVCKQYRVYF
    STPKDVKPGEDYLVDHSIYFYLMDPDNDFVECIGRQDTPESASKVILQHINDWKREGKPLKRD

    >gi|71000028|ref|XP_754731.1| FAD dependent sulfhydryl oxidase Erv1 [Aspergillus fumigatus Af293]
    MSDPRPQESETQPKLPKSLFPHQTPAAASSSTASKDDDVPAGMTKLPNGVILDKEGKPCRLCTSAASWRALTKQAKSQTA
    AGTTPAATPSNASASAPAPSPMQAECPPDVEELGRATWTFLHSLTAAYPAKASPEQQSEMRSFLSLFSRLYP
    CWVCAEDF
    RRWMAEPSGRNAPRLSGRADFGTWMCEAHNEVNRKLGKKEFDCRFWEERWRTGWKDGRCD

    >gi|70999350|ref|XP_754394.1| glutathione peroxidase Hyr1 [Aspergillus fumigatus Af293]
    MVLLPSSLSPPSIIFRCSPLPYISRQSPINRLSSTRAPSLLIRTMASATTFYDFKPADKKGEPFDLASLKGKVVLVVNTA
    SK
    CGFTPQFKGLENLYQSIKAKHPEDFTILGFPCNQFGSQDPGSNDEIQSFCQVNYGVTFPVLGKLDVNGDNAAPVWTWM
    KEMMPGLMGLKRVKWNFEKFLISADGKVVGRWASITKPESLEATILKEIEKAKKEGTAASTRKGEGEATAQAKLS

    >gi|70999251|ref|XP_754347.1| copper resistance-associated P-type ATPase [Aspergillus fumigatus Af293]
    MATETRPLPASSPVASDARCLTSMFFVGNVHCSSCVAYITEVLSGEPGVKNISVSILTHEVRVLHNLRSKPANLARALIR
    AAFEVHHVTTYGPDGTVISDLNTASESGFFSALHSPASASAPENRRHILNCDACRKEEFERQTARSAAAVETSKEAAATS
    STDVRAQNFSDTGSPVPRKTLADASSSTVVSDTRQVLSPGAQEFNARISIGGMT
    CASCVNTVTKEVQQLDFVREVTVNLL
    TNSATLRYTGPQTNIDKIVDLIEDIGYEASVDEVEPLVATAPSSPAYLAEIAIGGMTCGSCSATIARGLEEMPFVTEVSV
    NLLAHSGRVQFVGRENVDAILEKIDGLGYEASLDNIQPVVVNNEEGKNQKRTVSVRVDGMFCHHCPERVLDSLKAFPDVE
    CERTLSLNNNVLKVTYTPDPPSLTIRAIIQTIESAHDAFQASVFHPPSLEDRSRAMQLHERRRLLMRLTFVLLVAIPTFL
    IGIVFMSLVSSNNGVRKYLEQPMWAGSVSRMEWALFIMTTPVMFYGTDIFHIRAMKEIYSLWRPRSRTPFLRRFYRFGSM
    NLLISAGTTVAYVSSLAVLIMDAAANSSTSSHSTTYFDSVVFLTLFILAGRFMEAYSKARTGDAVASLGKLRPSEALLVE
    KSTPIDQTEFGKSFSYENQQRIAVDLLEIGDVVSIPHGASPPADGVIIGPNTYQFDESSLTGESRWVRKSAGDQVFTGSV
    NVGQPVKIKITALGGSSMLDQIINVVREGQSRRAPLERVADVLTSHFVPVITLIAILTFLIWLSLGLSGALPPDYLDTAR
    GGWAFWSLEFAIAVFVVACPCGLALAAPTALFVGGGLAARHGILVKGGGEAFQEASRLNAIVFDKTGTLTEGGSLKVSDH
    EVLATDADQIQVAWKLAQQLEESSNHPIAQAVSAFCKGRSEIPVAASDIVEKSGRGMMGTFTISINDPASNSSTTVVYEA
    AIGNEALLQSLTSAVDTYRLSGLLEEYQSAGKSTAILSLRKIDPTSPDKPSFTPAIVFAATDAIRPQASEIISRLRKRDV
    DVFMCTGDNQTTAYAVADVVGIPRSNVMANVMPAGKADFVRKVQAGLYPVRNEDDAESQTNRSGSRPIVAFVGDGVNDSP
    ALAAADVSIAMASGSDVAMNSASFILLNSKLDTILQLVLLSRRVFNRVKMNFGWAVVYNLCLVPVAAGVFYPIVTGQKHM
    MMDGEMVTVNDHWRLSPVWAALAMALSSVSVICSSLALAIDGRTIKKLLGRSMS

    >gi|70999099|ref|XP_754271.1| flavin containing amine oxidase [Aspergillus fumigatus Af293]
    MAKSQEGFVWSSKDGFRYAAVVASTPKSELSASYDVIVIGAGFAGLTVARDLGFKGKKVLLIEARDRIGGRCWTVDTGET
    AKLEMGGTWVHWIQPHVFSELQRCDLDEFVETVAFPENCESVKKASRQDPAVVHDPAEGQAMMEQLEGLMAKFFDIDGQG
    GRSVIPFPFNMASSTNHNPEYLELDKLSIADRVAQMPDCDEEQRAVLGAQAASFYGIAPEKGAFTEVLHTQALCNFDPAM
    TEIATMKYKIAEGTTAFALAILNDFKGDRIFSSPVQSISQPSDHAPVAVTLKNGEQFTSNSVVSTIPVNVLSSITFNPPL
    SPLKKEAFSDAVTPARIDKLLVCTPTKFANGFTVSCEGGDMPFASGFLDGTHGSHNLLTLLTHPDNKFDSAEDNIRLVET
    LHPSGVEVHSVYGHIWSDDPYAGGVMPVRKPGFLGKYHDEIRKPHGNVHFCGSDFADGWRGFISGAFEDAYRVTREVETS
    LSIK

    >gi|70998811|ref|XP_754127.1| thioredoxin Trx1 [Aspergillus fumigatus Af293]
    MGVEELSSLQAFRSGVADNMLVLVDAYADWCGPCKAIAPKLELFSNQYANIKFFKVNVDKVPDVAQELGVSSMPSFYLFR
    AGDYVEKVVGANPGLLETYIKKHAESVQG

    >gi|146323683|ref|XP_001481557.1| disrupter of telomere silencing protein Dot5 [Aspergillus fumigatus Af293]
    MVELRKRKAPSQNPATKNKSKRLKETASEETSPTLVQSSKEDERSTHVSHKKPPTVGDTIDLDNFGGEVELNDGTKTTLK
    HLVDTSKSGIVLFTYPRASTPG
    CTKQACLFRDKYDYITSTGLSIYGLSADSIKANSSFKAKQSLPYPLLCDTASTLISSL
    GFKKTPRGTTRGVFAVDKQGKVLLLQPGGPDATVDAVQQLISACNIETHGQIKE

    >gi|146323687|ref|XP_752229.2| glutaredoxin Grx5 [Aspergillus fumigatus Af293]
    MMFQRQAFAPAFRPFSRSPLVLTPRFTAFQLPHALHARFLSEQTRSAIDKAIASAPVVLFMKGTPETPQCGFSRASIQIL
    GLQGVDPKKFVAFNVLEDPELRQGIKEYSDWPTIPQLYLDKEFIGGCDILMSMHQNGELAKLLEEKGVLVAAD

    >gi|70994244|ref|XP_751969.1| mitochondrial peroxiredoxin Prx1 [Aspergillus fumigatus Af293]
    MAQERAAPLRLGSTAPDFEADTSNGPISFHKFIGDSWAILFSHPDDFTPVCTTELGAFAKLEPEFAARNVKLIGLSANGT
    DSHKAWIKDIDEVNGSKLTFPIIADPSRKIAHLYDMVDYQDTTNVDEKGIAFTIRSVFIIDPAKKIRLIMAYPASTGRNT
    AEVLRVVDALQTTDKHGVTCPINWLPGDDVIIPPPVSTEDAKKKFGEIREVKP

    >gi|70994138|ref|XP_751916.1| thioredoxin [Aspergillus fumigatus Af293]
    MSGLVHISSKEQFSTLLSTSKFVVADFYADWCGPCKAIAPAYEQLAKQLSRPNRITFTKVNVDQQQDIARAYGITAMPTF
    IVFQQGRPISTVRGADPKALSDAVRKLADEANKNDNSASGEASGDLSGGNGWIGAAVPKGYSDITDQHDPKGLELLNWDS
    DFGTAKTLFDPSKPSALSNNGKRKEGAPADWVESDTDEQLMLFIPFQSTLKVHSLQVTSLASPSEDDDEAPMRPKTIQLY
    TNRSHVLGFDEADDITPVQTVTIQPEDWDPKTATAKIDLRFVKFQNVTSLVLFFVDGDGDSEKLRVDRIRIFGEAGEKRE
    MGKLEKIGDEPGE

    >gi|70993822|ref|XP_751758.1| iron-sulfur cluster assembly accessory protein Isa1 [Aspergillus fumigatus Af293]
    MLRCTSRPFNTQCAQALRSFSSFGNTYRSSKRDMQTATAYRPHTLPSVFPPLSRNAGTPDTSIAAEFPPTPEPTLQKQGQ
    SEGYSNVSVREREAQRSKPITTTPTTNSTQAEKPRRKLRARKAAMKLTPLAVEQLRKLLSQPDPKFIRVGVKNRG
    CSGLA
    YHLEYVEKPGAFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRKFVFRNPNIKEQCGCGESFMV

    >gi|146323851|ref|XP_751653.2| glutathione transferase [Aspergillus fumigatus Af293]
    MDGADLQRFRVDSHPSDEQPRSLSSLADDAAALAATQHQHHQSHTQELADPQDAQSLQPLQTALEHSELHLHHPQKQQHH
    QNAGHPLNIPASMQPPSRPGEPVNTELISPRQFNEKLHNYHQASREHTFPGSLSDGQQTQSCLSHSGNQDGHHEQVLSQV
    RSDLAHTAVECNGNGADDVTHMRNTSLQVSPSYPHHLQLQPQSNGYSVAPELSRQDGCLKDMKLVPNPPDLEYWREKLFN
    VDETITLTEDQFRTYFPHVDNVYSHRSTQRYKRKPFVSHYWDCRLKGRPPGTPKSDDPNKKKRKRTARQRDLCDVKIKIT
    EYFPGYGVAAVSDFAATGPETSFPSSEFLPSVNSLFHESSALGQRRGSQPFGVLTPNPTLPEDHPGANGERFFTIQRVNG
    NGANGKNDGVGGGHRHTLEESDRVKKNSVQRYLLKEAKEKKKTGSVSVRSISKTRTMPSQSEAQQKTYHTKATGLAALTA
    INHSNEAELKLFGSCF
    CPFVQRVWIALEIKGIPYQYIEVDPYQKPQSLLEVNPRGLVPALRHGDWGSYESSVLLEYLEDL
    GVGPHLLPPGDAKLRAHCRLWTDHINRHIVPSFYRVLQEQEEQKQTANVQELQDGLKALITAANPEGPFFLGPTISFVDV
    QIAPWILRLSRVLKPYRGWPDPEPGSRWAAWVNAIEANEHVKATTSSDELYLDSYERYARGYTFTA

    >gi|70993370|ref|XP_751532.1| thioredoxin reductase Trr1/Trr2 [Aspergillus fumigatus Af293]
    MVHTKVTIDCLLCWLYVLLTWYPFKIVIGSGPAAHTAAIYLSRAELKPVLYEGMLANGTAAGGQLTTTTDIENFPGFPDG
    IGGAELMENMRKQSIRFGTEVITETISRVDLSSKPFKLWTEWNDGPDKEPACTADAVIIATGANARRLNLPGEETYWQNG
    ISA
    CAVCDGAVPIFRNKPLYVIGGGDSAAEEAMFLAKYGSSVTVLVRRDKLRASKAMAKRLLAHPKVTVRFNTVATEVLG
    EKKPNGLMTHLRIKNTVTGEEEIVDANGLFYAVGHDPATALVKGQIDLDEDGYIITKPGTSYTSREGVFACGDVQDKRYR
    QAITSAGSGCIAALEAEKFIAEAESPEEEPVAVSAQKSADNSTIQPAAQEVNGDVKKDPKGAVPEYKSNPLL

    >gi|70985384|ref|XP_748198.1| allergen [Aspergillus fumigatus Af293]
    MTRLKAPRNPLAISITDRFILSPISLSSKTYSQDLKMALKPGDKFPDNVVFQYILYAEESSDINACGIPINYNASKEWAD
    KKVVLFSVPGAFTPT
    CSANHLPGYIKSLPQLKEKGVQIVAVLASNDPYVMSAWGKANQVTGDDILFLSDPQARFSDSIGW
    ATAGRTGRYAIIIDHGKVTYAQIETEKGVVKVSGADAVLAHL

    >gi|70998668|ref|XP_754056.1| NTP binding protein [Aspergillus fumigatus Af293]
    MNQDSEQKHQPARELDDDNDDDSLFEALENEDDSAYRAHRIEQLNAEFSAAKNNRSSLHDLATTVIEEGIYPTLKDDQAV
    LDFTTQTHRCVIHFAHPDFAR
    CGFMDEHIRALATRHHEVRFARVDVRNTPFVVNKLNIRVLPCVIGFKDGIVVERVVGFE
    GLGAGGRDGADSFDIATLEKRLLWKGILTQTKFKNNEDDSDISEGGSGDEGSNRRRPGTGRRTIRSGNGRHHGGDDDDDD
    DWG

    >gi|70997717|ref|XP_753595.1| molybdenum cofactor biosynthetic protein (CnxF) [Aspergillus fumigatus Af293]
    MENLEQTCASLRAQIAATEAQLAGLKRELEIAEQAAEVKAQSTTRTITAEDGKTNETREWPLLSEEYKRYGRQMIVPQLG
    LQGQLKLRAARVLIVGAGGLGCPAALYLAGAGVGTLGLVDGDTVENSNLHRQVLHRSKNVGTFKVDSAIEYLRELNPHPT
    YVPYRAHLTPQEAPGIFKDYDIVLDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNYPPRPVGDKSGGPCYRC
    VFPKPPPANSVVS
    CADGGILGPVVGTMGVLQALEAIKVITSPAVNPSASPPSLLIFSAYSTPLFRTIRLRARRANCAVCS
    ADASVTLETLKNGSTDYVFFCGVAGLEATLSPEERISPLEFKKRHPKEVPQDGGRINKEPTIIDVREKVQFDICSLENSI
    NIPISTILSSASSPTNVDANAQPSLPFWLPRELASADSTDPIYVVCRHGNDSQIAVRRLKELGLDRGGQRYVGDIQGGLR
    AWREQIDPDWPEY

    >gi|70997545|ref|XP_753517.1| thioredoxin TrxA [Aspergillus fumigatus Af293]
    MSHNVEKITDAKVFKEKVQEGSGPVIVDCSATWCGPCKAISPVFQRLSTSEEFKNAKFYEIDVDELSEVAAELGVRAMPT
    FMFFKDGQKVNEVVGANPPALEAAIKAHVA

    >gi|70997353|ref|XP_753425.1| disulfide isomerase (TigA) [Aspergillus fumigatus Af293]
    MARLSFLLVSCLTLLVGIASATSAVIDLLPKNFDDVVLKSGKPALVEFFAPWCGHCKNLAPVYEELAQAFEFAKDKVTVA
    KVDADEHRDLGKRFGVQGFPTLKWFDGKSDKPEDYKGGRDLESLSAFIAEKTGIKPRGPKKEPSKVEMLTESSWKSTIGG
    DKNVLVAFTAPW
    CGHCKNLAPTWETLANDFALEPNVVIAKVDAEAENSKALAKEQGVTGYPTIKFFPKGSTEPITYSGAR
    SEEAFIEFLNANAGTNRVVGGGLNEKAGTVAVLDEFINKYISSRNAEELVAEVKKAAKGLQDKYAQYYVKVAEKISQNEE
    YASKELARLKKILEKGGSAPEKLDDIVSRSNILRKFVGEKDTDAKDEL

    >gi|70997071|ref|XP_753290.1| thioredoxin [Aspergillus fumigatus Af293]
    MDVELYVYDLSKYSLALTGTYIDAIYHTSIVLNGVEYYFGQGIQTSVPGSTHHGQPMEKLLLGKTELPIDVVEEYIQSLA
    SIYTPEDLAMFLVGKSIPEHIQNLPQKFLSTPFGQMMKPQIEQALRGVTQTAAPAPQPLPRAPVTTAAPTHPGTVRQVSN
    VNQLEELLESAVKSCAVIFFTSAT
    CPPCKIVYPTYDELAEEAGEKAVLIKVDISTAYDVSMKYGVRATPTFMTFLKGKKL
    DEWSGADPAKLRGNVRLLIEMAHPTHRHRQLHLPSFQRHLSNFVMYKKVPPLDKVVQRLQPHHEDPRLKSMIAFITARSS
    STTPTSPAADVALPEALPTFASYLQSTFHALPPENQFALVDLARLLFLDTRVSSFFAEEPNHTTLLNLLSPSTKLSSCPY
    NLRIVMLQLICNLFSSPLYLDHLTTNTANNNNLHTTVLTLATSSLLDPHPNLRTVAASLAYNLSAANHNARFAGHPDKLT
    EEEQVELTASLVEAIAQEAESAEALHGLLFALGLLVYEAPADGAVVDLCRAMGIAETVKAKGEMQVFAKEGLVREVGVEL
    LGKGL

    >gi|70996801|ref|XP_753155.1| arsenic methyltransferase Cyt19 [Aspergillus fumigatus Af293]
    MAEDTYQQVQSHYGDIARRTRVTVHDKEDEIALAFGYNAKDLRALPDKANLGLSCGNPVAYGNIKQGETIVDLGSGGGID
    VLLAARKVGPEGNAIGIDMTKDMIDLAKRNAEAAGLSNTRFIEASITSIPLPDASVDCIISNCVINLIPSRDKPSVFQEI
    ARLLKPGGRLAISDILARKELPPKIVNDIALHVG
    CIAGASQVAEYEEYLKRAGFKEILMVDTKADLNLYKQSSYLGQSSC
    CGPAEPRKEWPTEFAELDFNEWVGKFHPSQYWLNEALMICVASFQIYAVKHSAVEQAMS

    >gi|146324255|ref|XP_753150.2| AhpC/TSA family thioredoxin peroxidase [Aspergillus fumigatus Af293]
    MGHMLFKSLASNQRNHKYMKSGRLHPVCTTELADLAKHQSEFAKRGVKLIGLSANSIESHDGWINDITEIAGCSLTFLVI
    GDEDRKIAHTYDMLDHQDVTNVGARGIAYTIRSVFIIDPNKVIRLIQAYPASTGRSTTELLRVVDSLLVTDKYSVNTPAN
    WEPGDDVVVPAGLTAEEAQVKYPNMETVKPYLRFIPLARHHLYQH

    >gi|70984685|ref|XP_747849.1| allergen Asp F3 [Aspergillus fumigatus Af293]
    MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKG
    VDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSS
    AETVLKHL

    >gi|146324407|ref|XP_750675.2| methionine-R-sulfoxide reductase SelR [Aspergillus fumigatus Af293]
    MRFQHFTRFLRILTTAPSITSLSPRSITRIPFPVSRATALKAAPTIPFLSSFFSSSAKAEESNMSYPEQRSEAEWRAVLS
    PEQFRVLREKGTEPPYTGEYDSHFSSKGVYTCAGCNAPLYKATHKFKSGCGWPAYFDSIPGAVTRHTDRSFGMERTEIVC
    SNCGGHLGHVFKGEGYPTPTDERH
    CVNSISLKFTEDEEAAKSKA

    >gi|70992029|ref|XP_750863.1| thioredoxin reductase GliT [Aspergillus fumigatus Af293]
    MSIGKLLSNGALLVDVLIIGAGPAGLSTATGLARQLHTAVVFDSGVYRNAKTQHMHNVLGWDHRNPAELRAAGRADLTTR
    YSTIQFQNSTIEAIRQVETNQLFEARDNEGHSWYGRKVVLATGVRDIPLDIEGYSECWANGIYH
    CLFCDGYEERGQETVG
    VLALGPIANPARALHLARMALRLSESVTIYTNGNEQLAKEIQQAAEESPVGASGLKFEARPIRRFEKGDVAKTVIVHLGE
    SESKTEGFLVYNPQTEVNGPFAKQLALNMTEGGDILTTPPFYETSVPGVFAVGDCATPLKAVTPAVSMGSLAAGGLVAQL
    QAQALPEFRLDQEL

    >gi|70992139|ref|XP_750918.1| thioredoxin [Aspergillus fumigatus Af293]
    MSHGKVIAVDNPVIYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQVDVDKVRSVAQEMNIRAMPTFVL
    YKDGQPLEKRVVGGNVRELEEMIKSISA

    >gi|70992181|ref|XP_750939.1| ubiquitin-like activating enzyme (UbaB) [Aspergillus fumigatus Af293]
    MARDAYLKRSLGTLSRRIKESRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRYEHIKKPKALVAK
    EVAHKFQPNAKLEAYHANIKDSQFNVDWFATFDLVFNALDNLDARRHVNRMCLAANVPLIESGTTGFNGQVQVIKKNQTE
    CYDCNSKEVPKSFPV
    CTIRSTPSQPIHCIVWAKSYLLPELFGTSEDESEEFDHSADADNGKHLWSSNVSQASYNPEAAAE
    IANLRKEAQALKAIRESMGSPEFYQKVFEKVFKEDIERLRGMEDMWKSRTAPQPLDFEKLQQESSSIEPIISVNDQKVWS
    SAEDFVVFKDRFETPSLMTILHEQYLERLSRRLKTLQETAKDGLKPILFFDKDDVDTLDFVTASANLRATIFGIEPKSKF
    DTKQMAGNIIPAIATTNAMTAGLCVLQAFKVLKDDFQNAKMVFLERSGARAVNSDSLKPPNPSCPVCSVATARIKIDPER
    ATVNDLVQDVLRLQLGYGEEFSLSNELGTIYDPDLEDNLPKKLSDLGIKNESFLTVVDEEDEQPRVNLELVVLVPEKPEP
    SEAEKPISLEKMIDIPRKPKEREPPVPEPVNGAAVTGKRKADEAGLTDGDERAKRVASASVVEGDGEHPIVLDEADGGAI
    LIDD

    >gi|70992559|ref|XP_751128.1| AhpC/TSA family protein [Aspergillus fumigatus Af293]
    MENLDGSMLPYQPEETMTKYVQCRYNHNLSSTVSLPINMFTARRLLTSAPRAISRRALFHSTAPAFVQKGDAIPDLDVLV
    ESSPGNKVNLAKELKGKGIIIGVPAAFSPA
    CSSSHVPGYINHPKLKEAGQVFVVSVNDPFVMKAWGVSLDATGKSGIRFL
    GDPTGKFSEALDVTFDSSSIFGNQRSKRYALVVEDGKVKEAYIEPDNTGVNVSAAEKVLG

    >gi|70982534|ref|XP_746795.1| thiosulfate sulfurtransferase [Aspergillus fumigatus Af293]
    MAFATLRSIPSPTRLMRPTMAISQHQSRQISFSSYLVSPRELHEALKKNPTTKISTSPRVIPLCAAWFMPNDPEGRKGID
    AFRKHRIPQARFFDLDAIKDSESPYPHMLPTVETFAEAMSELGIRRDDEVVVYDTEELGIFSAPRVGWTLRVFGHPRVHV
    LNNYRLWVRDGYPTETGEPAPVEKTSYPLPQFDSKLVIPYRELKEIAKEHRKEGSKEVEILDARSYGRWAGTDPEPRPGL
    SSGHIPGSKSLPFQELLDPETKTYLAPEELRKVFQKHEVDETKSIIST
    CGTGVTASVIETALNVADYGNPSLRRVYDGSW
    TEWAQRVNDSEGLIKKAT

    >gi|70987121|ref|XP_749041.1| FAD dependent sulfhydryl oxidase Erv2 [Aspergillus fumigatus Af293]
    MANRQITRRILITSAIAVFVLFVLFIRPQGPPSPAVRAPGHIDKSAPAVTVKDDLLKGEVIMPGLGNETAKAELGRATWK
    YFHTMLARYPEDPTEEQQETLRSFILLFARLYP
    CGECASHFQGHLKKYPPQVSSRNAAAGWGCFIHNEVNTMLGKPEFDC
    NNIGDFYDCGCAEDEKAAGHKDKSQAASRGVPQKKDHEGDATTPVEIHKEPSVAPQYFTFQLLTDHRRTTRG

    >gi|146324870|ref|XP_748885.2| DSBA-like thioredoxin domain protein [Aspergillus fumigatus Af293]
    MTVIEIDVVFDFICPWCHIGKRSLDRAIALYRKTYPGGRNDTITIKWRPFYLNPNRHGRSVPKSVLIDERLKDKTPEQRA
    AMVKRVEKIAQSVGVRINYGRMIGPDTRDAHRLVYLSREDPAISSEIHGELVERLLEAFHERAMDITRPEVLKEAAAAAG
    IEAAVVERWLAEDVGNVVDEEARKYREVEGIKGVPRFRFQGKYEWDGEDLQECMEIMGKVEAEEGS

    >gi|70983139|ref|XP_747097.1| thioredoxin [Aspergillus fumigatus Af293]
    MPVTEITSAKLSTHGRFEQFKELTDGDKPVVIDFWATWCGPCKAISPLFEKMSDNPEYGNVGFYKVDVDEQEQVSQEVGI
    RAMPTFVLFKNGYKIGEAVGAAPPRLEGLLNTARSL

    >gi|70982997|ref|XP_747026.1| thiosulfate sulfurtransferase [Aspergillus fumigatus Af293]
    MTSPFSSTLVSPAEFHAAVNSPTNTRRIVPVAAGRRTVHTPAYHAQHIPNSVYVPASTTQHQHANEHSFFDMDLIRDTTS
    PYPQMLPTAAHFASCVAALGITKDDVLVIYDAVDVGIYSSPRVAWMFRFFGHQAAHVLNNFRVYVQLGYPVATGEMRPLP
    SVGEYRVSPPDSDRVIAFEELRELVLGGGEGFQIVDSRIAGRFSGEEDEAVAGLSSGHMPRAVNVPLAAMLEEGSSTFLP
    VEKLAEVFKRAGVDGRVPLVLT
    CNSGVTAAALDLALGETGFKNARRIYDGSWMEWARRVDRPELIVKDVH

    >gi|70983584|ref|XP_747319.1| oxidoreductin [Aspergillus fumigatus Af293]
    MRRTNSDMTTLFARLVASITKNTSRTVSDYVFVQIDPSATVSDACVSYVTIDSLNDQIYSLLQSITQETDFFSYYRLNLF
    NKQCPFWDDANSM
    CGNIACSVNTIESEEDIPLTWRAEELSKLEGPKAGHPGRKLQKERPSDKPLQGELGANVGESCVVEY
    DDECDERDYCVPEDEGASGKGDYVSLVDNPERFTGYAGPGAHMVWDTIYRENCFLKSPPEMALSPHPSLGGLQAVNDFRN
    VLQKEMKRSEQLPFDNECLEKRVFHRVISGMHASITAHLCWDYLNKTTGQWHPNLQCFKERLHDHPERISNLYFNYALVS
    RAVAKLRKHLQNYTFCISDPLQDRETKEKVSQLTAILADRPQIFDENIMFQDPSAPGLKEEFRNRFRNVSRLMDCVGCDK
    CRLWGKLQVNGYGTALKVLFDYDETKNGENPPLRRTELVALINTLGRISHSLAAVRSFHRAMDLGQGQTFAIMAGTPMLK
    QHPGGRKAKVLYKDGGSTFYYEDDEDDFKYATERLPWERRPYKESDTAWDSFTAEFEVVWNTFVYVLKSWWNLPKTLWEI
    FVLEANRAWSYWLGLPVPPRSWRIRLPQRPQIRSHDEL

    >gi|70983878|ref|XP_747465.1| ubiE/COQ5 methyltransferase [Aspergillus fumigatus Af293]
    MAENTYQHVRSRYGDIAKRTGTTIHDKEDDIALAFGYSAQDLHALPDKANLGLSCGNPVAHANIKEGETIVDLGSGGGID
    VLLAARKVGPEGTAIGIDMTKDMINLAKKNAEAAGLSNTRFIEATITSIPLPDASVDCIISNCVINLVPSKDKPTVFQEI
    ARLLKPGGRVAISDILARKELPAKIVNDMALYVG
    CIAGASQVAEYEEYLKRAGFKSTYFNSTQILLFVTNMTADILIVDT
    KSDLNLYKQSSYLGQSSCCGPAGSCKALPAEYAEMDFNEWQPRVGQVSNCWSLQLITAHSMCNNSSLLSNNFAICRVDLR
    LIMSILLAGASNIYHQQIEPFQLSRFGTAFTAETNPNNTGISSNGPTVDAIAWLLSALNIVIATAITS

    >gi|70983971|ref|XP_747511.1| AhpC/TSA family thioredoxin peroxidase [Aspergillus fumigatus Af293]
    MASILPRTGLRALSALPRAGPVSRVAFSRQLPRAQPLVQPFGRRFLATVPQEQPRLRLGSTAPNFKAQTTHGEIDFHEFI
    GDSWTILFSHPADFTPV
    CTTELGAFAKLKGEFDKRGVKMIGLSADDLSSHGDWVKDINEVASTTVQFPIIADPERKVAFL
    YDMIDQRDLDNIAEKGIPFTIRAVFIIDPAKKIRLTMLYPASTGRNSAEVLRVIDALQAADKKGIATPIDWTVGEDVIVP
    PSVSTEDAKKKFGNVREVKPYLRYTKF

    >gi|70984968|ref|XP_747990.1| thioredoxin reductase [Aspergillus fumigatus Af293]
    MAPKSLLYTIFSSLAVALAASVPHTDYEVMIIGGGPSGLSAASGLSRVRRKNIVFDSGEYRNGPTRNMHDVIGNDGAVPS
    DFRALARNQISKYNQTTWVNEKVDSVRVITDEERNTTYFRASVAGETYTARKLILGTGMKDILPETPGLDEAWGKGVYW
    C
    PWCDGWEHRDQPFGILGSLVDVVGSVLEVYTLNTDIIAFVNGTQTPKAEAKLAEKYPNWKKQLEAYNIVLNNETVKSIER
    VQNGEDVYDDQGRQFDIFRVNLADGSSVTRNAFITNFPSEQRSSIPKELGLKMKDNKIDTNIDGMRTSLPGVFAVGDANS
    DGSTNVPHAMFSGKRAAVFVHVEMAREESRAAVSKRTLPSKRAMEKEAERRMGSDLEKLWERVRRA