Zygosaccharomyces rouxii CBS 732 uid39573

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|254576819|ref|XP_002494396.1| ZYRO0A00484p [Zygosaccharomyces rouxii]
    MKAGSSLLSLVSLLAVGSRAQNVTENNLEPRSISFGGNTSVVPSAVPPPVPPPLNSTYFCTIDKGEVINPTCDVTFDEIN
    EINGKIRKDLVSLVHTDFFKYFRLHLYKQCPFWNQNNGF
    CVNRACAVDVVEDWDSLPEYWQPEVLGGLQENETISDEESV
    KEDCKFLDDLCANNKKQRMIEPDIEYCDINDLHGEGSVLVDLTANPERFTGYGGQESSQIWSSIYGENCFSQGETGQSLA
    KDAFYRLVSGLHASIGTHLSNDHLNTETGKWGPDLDLFMARVGNFPDRVSNMYFNYAVVSKALWKIKPYLDHLKFCDSYD
    PSVKATIMNILSQLDSKVFNENLIFEGELSSKLKDDFRIRFKNVTQIMDCVHCDRCRMWGKVQTTGYATSLKILFELDES
    NENSKQHVVDKLTKYELIALFNTFDRLSKSIESVNNFEKMYNVRLEGGKIASFFKQNNFFKLLGRASRSISESVQSISKS
    IDQVSESQKPSGPVFADLKLPETNSKGSDEPKTNVWVKAWHTEIHNVCEAFKFIFRSYLDLPRNLYTLVLSVVNSMWNSF
    VGARYWNWEEENPVVYNLNTW

    >gi|254577195|ref|XP_002494584.1| ZYRO0A04928p [Zygosaccharomyces rouxii]
    MGVTLNKRNLRVLSITSLLLLLVFFVVQNANSVSIGESSSLANANSNEDQTLTSAGTSINKESKEEVVTEKQKAKEKQPE
    GDSVVDAEIGKIKQEVGIGKTDDLETGSSGSISGGGVVGKGGSASEHAQQTEFDPVKEYAMILDFSPIIVFSKST
    CPYSK
    KLKELLDKEYSFTPSYFVIELDRHHNGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDWSQGTF
    TVLQLDRPSNN

    >gi|254577269|ref|XP_002494621.1| ZYRO0A05786p [Zygosaccharomyces rouxii]
    MIKMWVFKVLIFFMIQCSNLVWAQNFYDEDPHLIELTPKNFDKVIHRTNYTSVVEFYAPWCGYCKQLKPVMKKVAKKLDG
    IVQVASVNCDLPKNKQLCAEHRIQGFPTLMVFRPPKIDMSKPHSQRVELRNHAGEVYKGERKMAPIIDFAVSRMKNYVKR
    LLNVNKLEEIFKKSTRPSMVLFSKKDKLSPVYKSIALDWLGVFNCFIIPNGKLDSLSSDDNLAKSYPNIYGFLQSIAHDQ
    KNSEKSLLVVFDPHNDQYHVFQGDSLVKPQVSKFLTGSIGRNPQEGPGSKRQQFVDAVKSGKNKRVNHDEL

    >gi|254577277|ref|XP_002494625.1| ZYRO0A05874p [Zygosaccharomyces rouxii]
    MTHKIYEYEHIKFLSQNPNSRVVLIDVREPEEFQETNIPTSINVSYRSYPNGLAMDSETFFNTFKTRKPEYDKELVLLCA
    SGRRASEALKVALEAGYSEVSLYPGSMKDWTYREKGGSTTLACPI

    >gi|254577315|ref|XP_002494644.1| ZYRO0A06292p [Zygosaccharomyces rouxii]
    MLVNSGRTLFSRASSTTSTTNTIIKRMVHNKVTIIGSGPAAHTAAIYLARAEIKPTLYEGMMANGIAAGGQLTTTTDIEN
    FPGFPQGLLGSELMDRMKEQSVKFGTEVITETISKVDLSSKPFKFWTEFNEDGPANTTDAMILATGASARRVNLPGEETY
    WQQGISA
    CAVCDGAVPIFRNKPLAVIGGGDSACEEAGFLTKYGSKVYLLVRKDHLRASTIMQRRVQKNDKIEILYNTVAV
    EAKGDGKLLNTLRIKNVKENQESDLQVNGLFYAIGHTPATSIVQGQVTTDESGYIKTIPGTAETNVPGFFAAGDVQDSKY
    RQAITSAGTGCMAGLDAERYLSSLE

    >gi|254577621|ref|XP_002494797.1| ZYRO0A09900p [Zygosaccharomyces rouxii]
    MEEKLYYRYLDHPITTVLLVSRGKTGCLVYASLGSNRKELLKISQSDFRKLSRSTKVSYGLYYDANDSMVNLERSFASYL
    DGSFTETIPYEYLFGTKFQHKVWDELLKIKTGETTTYRQIAEAIGSPKAYRAVGTAVGANKIAVIVP
    CHRCKPCDGSLGN
    FRWGTQLKNRLLQQ

    >gi|254577821|ref|XP_002494897.1| ZYRO0A12364p [Zygosaccharomyces rouxii]
    MANSQPQEGVSGRKIIYDEDGKPCRSCNTLLDFQFATGKISGKRAASATGAASSNSAGSLGPTATEKIPGSKTHAKGDPP
    DVEVLGRSSWNLLHTISANYPTKPSDRQKSEMKQFLQLFSHIYP
    CSWCASDFERYLRDHAPKLGSRDEFGRWMCDAHNEV
    NVKLNKETFDCNFWQKRWKDGWDE

    >gi|254577869|ref|XP_002494921.1| ZYRO0A12958p [Zygosaccharomyces rouxii]
    MSIRPSVYLHSIAPNFQCPSSQGFIDFYQYSSRSWILFFSHPSDFTPICTTEIGALAALQDEFNARNCKLLGLSTNDAET
    HRQWLLDIQRITGSQVRFPILCDESRKVSTTYGMIDLLHFDRAGKPIPMRSVYIIDPHKRVRLIQAYPLSTGRNTAELLR
    CIDSLQTVDAHNGNIMTPVNWIPGDDVVLDPDLDTISQGEKFPHHRSITNYMYLSPL

    >gi|254578016|ref|XP_002494994.1| ZYRO0B00968p [Zygosaccharomyces rouxii]
    MIAQCVRNDSMLLLGQSQRLFSRCTVLKEKGASSYHFTPHSRGFLRTSLPDDKPPVLSQLFFSVGQKEQGQHRNKARQLP
    QPQLQERDNVRSKWSSYTMPSKEVLKEQEEKQKQEEKHAAAPTEAPSKEAENPARLRRRKNRRTLRPRKALISLSPRAMT
    HLRSLLDQPEPKLIRIGVTNRG
    CSGLSYDLQYITEPGKYDEIVEQDGIKVIVDSKALFSVVGSEMDWIDDRLSSRFVFRN
    PNSKGTCGCGESFMV

    >gi|254578222|ref|XP_002495097.1| ZYRO0B03256p [Zygosaccharomyces rouxii]
    MLTRTLFQTQKAAFKSFAPAFTLPLRTSVRYTSSFRQEDQPRLRIGSTVPNFDANTTFGKINFYDYLGDSWGVFFSHPAD
    FTPV
    CTTELGAFSKLKPEFDKRNVKLVGLSVEGVPSHNEWIKDIEEISKLNKFGFPVIADENKEVAFLYNMVDEEGFKNL
    GKGPVSTIRSVFVIDPSKKLRISFTYPPSVGRNSAEVLRVVDALQKTDAKGVVTPIDWQEGQDVIIPPSVSDAEAEKKFG
    KFETVKPYLRFTKA

    >gi|254578590|ref|XP_002495281.1| ZYRO0B07634p [Zygosaccharomyces rouxii]
    MSSELVPKVLELLKSHKVLQFSASWCPDCRYANSVWKKLGIENKIYVFDIASFPRPDQEQWRSAFQQVTGSRNLPSIYYN
    GTLWGTESQLHAFENNGTLRDELRKIGLL

    >gi|254578948|ref|XP_002495460.1| ZYRO0B11902p [Zygosaccharomyces rouxii]
    MPIHTIQNQDQFTNLTTAEAGDRLIAIYFHTSWAEPCKAMNEVVKALSDEPSNKDVLFLSVDADEQSDISELFEVSAVPY
    FILVRSGTILKELSGADPKEFVKALDETKTQGNAKQAVAENAESEEDEETEEELNARLTKLTQAAPVMLFMKGSPSEPK
    C
    GFSRQMVGILREHQVRFGFFDILKDTSVREGLKKFSDWPTFPQLYVGGEFQGGLDIIKESLEEDPEFFQHNLRSA

    >gi|254579551|ref|XP_002495761.1| ZYRO0C02442p [Zygosaccharomyces rouxii]
    MQRFVTRTATRGFKTFSPTLFKAGSAIPSGLPGLHENSPGNAIDIGEEVAKGKSIIVGVPAAFSPACSASHVPGYVNHFQ
    ELKNKGVQQVFVTPVNDAFTTKAWAQSLNLPQGIRIIADSQGAFAKAGDHLFDSEKVFGNKRSIRFAAIVQDGKVVQEFA
    EPDKIGLDVSSAENVLKHL

    >gi|254579691|ref|XP_002495831.1| ZYRO0C04004p [Zygosaccharomyces rouxii]
    MFNHEQGILTEDEHQNVMSEAIDKFEDQLLQREKYGRSIDDEDAELDELLDGEDDFLAHYRERRVQEMSDHMKTVEKNVT
    QKEYGSLQVVKDESALMQLASKSPRCVVHFGLDNFGK
    CKYMDEKLELLAERHLTTKFARIDVEDCPFLVSKLKIKVLPFL
    VAYKDGKEVTRIVGFSKLGNDPNGFAPESLEGLLAQVGILEPRSFNRPRHEDHDDSGSDLDL

    >gi|254579795|ref|XP_002495883.1| ZYRO0C05214p [Zygosaccharomyces rouxii]
    MAGLRRSTRLSSKEDTLKNRPEENESTQPPKKKSKKSDDNESLGEEEGDEEEESEGDSDFKEQEGEGEGEGEGKEEEEEE
    EEEEEPEEAKELEEGDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPG
    CTRQACGFRDNYEDIKEHAAVFGLS
    ADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVLKHKRVKISPEVSIEEGKKEVLELVKQ
    FEDEGEKKEEKGDDEKKEEEEEDDKKEEDN

    >gi|254580303|ref|XP_002496137.1| ZYRO0C11352p [Zygosaccharomyces rouxii]
    MRQAKLTVDGMTCSACVNTVTSQVSALPGVSDCQVSLVTNECDVKFSDDSECSTDKVIEAVEDCGFDCKLIEESGSSQNE
    ALLTVQGMTCGSCVSSVTEQVNKLPGVQNVVVSLVTEECRVVFDASKISIQEIKESIDDCGFDASVNSVQQVSITEEGGR
    LKNAKYHIFGIDWNTPVDVVNTSFQQLCSGGIKSVDMSKVDEFYVASIGYDQNECGVRDIANRITSELGYEPTVVSTYDS
    STQLKLLARVKEIQFWKYNCFKASIFAIITMALYMGIPMSLPFIVKSHTFPYKETSFLPGLFYRDIIGFILATYLQFTLG
    RYFYGAFWKSLKHFTGTMDTLVCTSTSCAYFFSIYSVVLNVINPSDSGKLPNVIFDTSVMLFSFISLGKLLENRAKSATS
    TALSKLISLTPTSCVVRDSQGETFEVPIDLLQTNDIVEVMPGKRIPADGYILEGETEIDESLITGESLPTAKSRDDNVIA
    GSINGPNHFVFKAEAVGDESKLANIIRTMKQAQLTKAPIQRYADFLASIFVPSILLLATCTFFMWYVLANLITDSLPVLN
    SSNGRFYMCFQTAISVVIVACPCALGLAAPTAIMVGTGVGAEHQVLIKGGEIMERFDTVGKFVFDKTGTLTTGCMTVRSF
    ILEESQQLSTELLACILASESISEHPVAKAIVDYCTNISHQDTKGKATVLDSKIFVGKGLECLCEFNGIKHTLLIGKKAL
    MPEDWNAKMGDTNSDSTVSYVCMDGAIIGRFEITDEVKSDAHETVQYLLDNNYKVYMVTGDNHGSAIKVAQQLGIDLNSI
    FSEVTPAGKCEVIEEIRKGSRDGIVFVGDGINDSPALVTSDIGISISTGTDVAMEAADVVVLCDQDRTKARLRGILYALD
    ISRKTFHRVKLNLFWALCYNIFMIPISMGILIPWGITLPPMAAGFAMAMSSVSVVLSSLGLKRWKPDHLYGSKGDRIFSR
    LFRIRREPNQQREDVELQTRSIQ

    >gi|254580641|ref|XP_002496306.1| ZYRO0C15356p [Zygosaccharomyces rouxii]
    MQYQVLLSLWSLVAGLCMAITNDNLLQRSRKSSDNIIELTDGNYQRILGTGRNAWIMVFLTSSSPQIGCATCIEAADEYK
    LLAKSWFKDHPEGVSTAGEEEASLFFAISDLKDSKIPETFSFYGLEHVPKFFLFGPGGNIREYETIELMSGGGMERVLGL
    VSDIKKSTNIPDFNIYQPMNWSLISIVAFTTFCISYMFKRHYELTTKILSMRPLWALVWTFFTILMLGGYMFNLIRGSQL
    AGVGENGDLVYFLPNQSSSQFRIETQITGVIYSGLAAAVVGLVLAVPKLKSYYKGTSKSTIVEVGSSVVFAIMVYAFFAG
    LTSIYEIKQPGYPYPLTKVSSLFK

    >gi|254580721|ref|XP_002496346.1| ZYRO0C16258p [Zygosaccharomyces rouxii]
    MDLKVLVLGAGGLGCELVKNLAVLKVREIHVVDLDTIELTNLNRQFLFKDEDIGRYKANTAVDYLSRWCQLKGFRSIKLV
    AHCQDLFTLQPDFYKYFDFVISGLDAVGPRRFVNRTLVQLTRDSNFQICVPFIDGGTEGLNGHVKTIVPGVTACWECSID
    TLPQQQTQHPL
    CTIANNPRNLEHVVEYVATVQLAGEELEPGVLLKLCYERATQFGISTDKLTESYAWGVAKHIVPSVSST
    NAVVAGLCCNELVKIYNDCVDFDRLKNFKTISATNGLYINSFQFDRLEDCPVCSGL

    >gi|254580723|ref|XP_002496347.1| ZYRO0C16280p [Zygosaccharomyces rouxii]
    MIMLGRLGASRLLARSSFISARWYAALNANEALVKPARIVNFLPGKQFEISQRAADRLNAIYKESKEVLRIKVESGGCHG
    FQYNLNLIPDSQVQRSIQELENNNKAQKEGEEEDEEDEDFDEDFESNKDVIFVLPGIGAKVVLDESTLNVLNKTTLTYTT
    ELIGSTFKIAGGNMKSSCGCGSSFDVEANQ

    >gi|254581440|ref|XP_002496705.1| ZYRO0D06248p [Zygosaccharomyces rouxii]
    MSLINQKVPTENFQFQYIPISPSDGDACKLPQAESWSKFLSEHKNVILTGAPAAFSPTCSINHIPEYIKGIKDLQAKGVD
    QVVVITVDNPFANAAWAKSLGVNDTTHIKFASDAGGHFVKRLGFDLPVGEGVSWSTRWAAVVKDGVITYADKETKPAEEV
    TVSGLSNIEKHL

    >gi|254581702|ref|XP_002496836.1| ZYRO0D09240p [Zygosaccharomyces rouxii]
    MRLLKLLSALYLIIGIARSSSVSSDYDGEFEPRAPLGEKEFRQELKSGLHLVEFYSPYCPHCRDFAPTWHETWRKFRKEG
    ERLNISFVQVNCVKDGDLCYDEAITEYPAIKLYGPEGFIKNYPNEYERTEGDLINFARQEALDPINMEATDLEISSKFLN
    AQDFNELLAGKGKQPYLVSFWPSDDHEDPLAGSKSYDFCPECQTFQKLWPQITKKLLLQGVATGHINCETLPNLCHEMEF
    HKLVNGAQAVDNYPRVALVLPGKGVNNLFIYENGFSSSVWSYEDFAVRAISNSEAPEITLEQIVELVRQDFQFPESKNLP
    VPSQALHVVFAYSPENVVTEDFHVLEHLVKHLAKVPNAYLHKSKDDVSTAAKVSLDYMYEKINYNRSEPVKLPKTDYLEL
    NLVPQSPTFYIFKEGDWVPHLYVGDSTTETRNVEALAKWFNESALPVISEVTPYNFGQLLSFQPSDYDAVAIQLVDLTDA
    ESIKTSNEQLKNFIKAAYDYEDVRMQNVVNVRAEKRANKNKRIKELKAAKASSDKIGKVYHEEIKFEDKNKVILGYVDIS
    KGPHVLEDLGFHRGRDDYKSGDVLVVDSYSSAFTEKDVFGNRLTTDSMYALRETLVKLILPELSHFHERLESQELSFNYS
    RGLDIFEPMRKHKVWRYFFIVGALVLIVKAPSFYKKFKSNKKYKAKRSTVGILGQPSKRSKD

    >gi|254581870|ref|XP_002496920.1| ZYRO0D11154p [Zygosaccharomyces rouxii]
    MGRESSITRIVGPENYAKLQQFKCLIVGAGGIGSELLKDCILMGFGEIHIVDLDTIDLSNLNRQFLFRQKDIKQPKSTTA
    VKAVQHFSNSKLVPYQGNVMDTNQFPLHWFDQFDIFLNGLDNLAARRYVNKISQFLKKPLIESGTSGFDGYIQPILPGNT
    ECFDCTKKETPKTFPV
    CTIRSTPSQPIHCIVWAKNFLFNQLFTSDQSSTTGDSDGNDWGTDDKEEIERIKQETNELHDLQ
    QIVHHQDKVHITDILKKLFVKDIEKLLQLDNLWKSRAKPTPLTDDLIDSAKDGHDSTDLNAIWSLEEQISQFINVTEKLM
    DRIVEEDYNIEFDKDDQDTLVFVATAANIRSHIFGIPIKTVFDIKQIAGNIIPAIATTNAIVAGLSTLTALRLLNFLPYA
    KTNSGLDVNMAFTARASNLSKDRYLSNPKLAPPNCNCAVCAKVARGVVKITEKGLEKLTLSQLIDLLKKKYNYPSETSLI
    DTSDQRLLVDFDFEDLLDRTLSQAKLHDGSVILFSDEEGDESEMYRKPLEIYLDVVEESAINSEIELPALEIPLFTPPKQ
    EEEDEGKETSTEESPEKEEDKNGIVILDEDEGKDEKDGTTTKRPRSPDQTENDSKRAKTSKNHNDENGVIELD

    >gi|254582036|ref|XP_002497003.1| ZYRO0D13112p [Zygosaccharomyces rouxii]
    MKWIGLFWFACMFWQSCQALIDAKEVAPLEDNRGFIKLNDENYPKWSGGIKDHYTILFITISDDNPMDIQCDICHELESA
    LSTVFGLARKQAPATKILMFEVDIVENSKLLKDMNLNSIPHVLIYPPPTSESFKWSVDPFYQYPVSPDNEKRILHFGDFL
    AQVLDVHLEISDFDYSEFSKYFIASVALFVFIKKQIVPRVTHFRKWATVFVSFVILLTSIGGYKFTEINAIPFIARDGDG
    KIMYFSGGTGWQFGIEIFAVAAMYVVMGALVVILILSPKLPFSSRAQNIQGAVLSCFLFFAFSYYTKCYKIKFPEYPFEF


    >gi|254582052|ref|XP_002497011.1| ZYRO0D13288p [Zygosaccharomyces rouxii]
    MSKFYELQPRDGKGEVFSFDQLKGKVVLIVNVASKCGFTPQYHELEELYKKYKDMGLVILGFPCNQFGHQETGSDTQIAQ
    FCKLNYGVTFPIMKKINVNGPDSDPVYQFLKSQKAGLMGFRGIKWNFEKFLVDRQGQVFGRWGSLEKPSSLDSVIQQLLE
    SEPKL

    >gi|254582078|ref|XP_002497024.1| ZYRO0D13640p [Zygosaccharomyces rouxii]
    MVALVQKPAPYFKKTAVVDGVFEEVSLDQYKGKYVVLAFVPMAFTFVCPTEIVAFSDAYKRFKDLGVEVLFASTDSEYSL
    LAWTNVEKKDGGLGHVNIPLVSDNNHSLSRDYGVLLEDEGVALRGLFVIDPKGIVRHITINDLPVGRNVEEALRVVEGFQ
    WTDKNGTVLPCNWTPGSATIKPGVKESKEYFSEAHK

    >gi|254582384|ref|XP_002497177.1| ZYRO0D17204p [Zygosaccharomyces rouxii]
    MFRTSLRAFQGIRFSSYTSIPKLSTREAFQEAFKKSGLSVFDFYATWCGPCKAMAPILGKLKEEYPKAAFYKVDVDENLE
    LSKELDVMAMPTFLLTKDGSVLEKVVGANPARLEKLIKDNS

    >gi|254583169|ref|XP_002499316.1| ZYRO0E08954p [Zygosaccharomyces rouxii]
    MVPTLSKGIKFNSQTDKILTVGAGCFWGTEHIYRKYLGERIDDCKVGYANGSEMKKDQTNSVTYKRLCIGDTGFCEVLQI
    AYNPQKLSLKELVDLFFRCHDPTTANQQGPDAGTQYRSALFAHSEGDLKELKELKDQWQPKWGNKITTEVELIKNFYDAE
    DYHQLYLDKNPEGYACPTHYVRNL

    >gi|254583400|ref|XP_002497268.1| ZYRO0F01650p [Zygosaccharomyces rouxii]
    MGVSAIASSAEFDKALAVAGKLVVVDFFATWCGPCKMISPMVEKFSNEYSQADFYKVDVDQVPEVAQKNEVSSMPTFILF
    KDGKQVAKVVGANPAGVKQAIASNV

    >gi|254583568|ref|XP_002497352.1| ZYRO0F03542p [Zygosaccharomyces rouxii]
    MLRSFVTKRTFSSSAVWLAAKKQHDVVVVGGGPGGYIAAIKAAQLGLDTACVEKRGRLGGTCLNVGCIPSKALLNNSQMY
    HQMKTDSKNRGIDIKGEVALNVEQFQKAKDTVVKQLTGGIEMLFKKNKVAYYKGLGTFENENSIKVKPVEGLEGSVNEET
    ILEAKNIIVATGSEVTPFPGIKIDEERIVSSTGALSLKEIPKRFVILGGGIIGLEMGSVYSRLGSKVTVVEFQPQIGASM
    DNEVASTTQKFLKKQGLDFKLGTKVVSAERNGDVVNIVVEDVKSGKQDKLEADAFLVAVGRRPYIQGLEAEKIGLEVDKR
    GRLVIDDQFSSKFPHIKVIGDVTFGPMLAHKAEEEGIAAVEYIKEGVGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGI
    NYKVGKFPFIANSRAKTNLDTEGFVKVLIDSETERLLGAHIIGPNAGEMIAEAGLALEYGASAEDIARVCHAHPTLSEAF
    KEANLAAFDKPLNF

    >gi|254583926|ref|XP_002497531.1| ZYRO0F07700p [Zygosaccharomyces rouxii]
    MSFFKLITPKAFVELAQKETSRRVIPVDSTWYLPNLNRNGKQEFLTLDRIPNSVFFDIDAVKDVNSPYPHMVPDLATFNQ
    SMSELGLQRNDVLVVYDRIGNFSAPRCAWTLAVFGHPSVYLLNNYNLYKKLGYPVENDKRTKWSELGPTEYKSDIDLSAQ
    KVIGYDEMLQLVTSGELSKRFNVFDARTVGRFDGSAPEPRPEMSSGHIKGTQPLPFGELLEQDSGAFPESPELMKKRFDE
    ALAKLKDNYNPSLPTIAM
    CGTGVTACIVMAGLEHAGIRDVKLYDGSWTEWVMRSDPKLITKGRD

    >gi|254584036|ref|XP_002497586.1| ZYRO0F08932p [Zygosaccharomyces rouxii]
    MFARFAPRFAPGFAPRFAGLPRVSLLRQTQLFMSTETRAAIKEAIGSAPVVLFMKGTPEFPQCGFSKATISLLGQQGVDP
    MKFAAYNVLEDPELREGIKEYSEWPTIPQLYVNKEFVGGCDILTTMAQSGDLCNLLEQANVLVPEED

    >gi|254584104|ref|XP_002497620.1| ZYRO0F09724p [Zygosaccharomyces rouxii]
    MTVEVPESILRELESLKLENAKLKAELAGEKEFNKYPMSLEEYKRYGRQMIVEDTGGVEGQLKLRNSKVLVVGAGGLGCP
    ALPYLAGAGIGHIGIVDNDVVDTSNLHRQVLHNSNKVGMLKCESAKQVLNELNPHVSVETYPIRLDGANAFPIFAKYDYI
    LDCTDTPLTRYLISDVAVNLQKTVVSASGLGTEGQLTILNFKNKGPCYRCFYPVPPSPTSVSS
    CQEGGVIGPCIGLVGVM
    MAIEVMKLIMEVYTEESFKPFLTSYSGFPTQSLRTFKMRGRQKTCACCGENPTITRNAIESGEVDYTLFCGSRKYNVCDS
    MERMSVTDFENDYHDRQDFVFLDVRPSHHYSISHFPSTHNIPLKKLRDMGGSISELQEHVPNIDKESEVVVV
    CRYGNDSQ
    LATRLLKDQFGIPKVKDIRGGFFKYIDDVDPSIPKY

    >gi|254584534|ref|XP_002497835.1| ZYRO0F14608p [Zygosaccharomyces rouxii]
    MALIPKSAGFYRLIFRRTMTSGVNHYNYLVIGGGSGGVASARRAASYGAKTLLIEGKAMGGTCVNVGCVPKKVSWYASDL
    ANKLTHAHEYGFCKNLPLTKEQLTFDWPEFKQKRDAYVHRLNGIYERNLNKEGVEYIYGWAKFNKEGKVEVKAHDGNTQV
    YTADHILIATGGQPIYPEKIPGFDYGTDSDGFFKWEMQPAKVVVVGAGYIGVELAGVLHGLGSDTHLVIRGDTVLRKFDN
    LIQDTVTNHYVNIGVNVHKESQVSKIEKDEQTGKLTVHLDNGNVLEDVDELLWTMGRRSMLGIGPENVGLKLNEREQIVV
    DEYENTNVKGIYSLGDVVGKVELTPVAIAAGRKLSNRLFGPSQFHNDKLDYNNVPSVIFSHPEAGAIGLTEKQAIDKFGE
    KNVKVYKSSFTAMYYAMLQEKSPTSYKLVCAGPEEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEE
    LVTLR

    >gi|254584804|ref|XP_002497970.1| ZYRO0F17688p [Zygosaccharomyces rouxii]
    MLRIGTQLPRLNSYISNVAIRNFSSTMSNQQQQWNPKLTPEQLAVLRDKYTERPNTGAYLNNKEQGTYNCANCDNPLYSS
    GAKFDSGCGWPAFYQEISKDSLQYHVDNAFGMKRVEVCCGKCGGHLGHVFEGEGWQKMLNLPTDSRH
    CINSASLNFEKK

    >gi|254584808|ref|XP_002497972.1| ZYRO0F17732p [Zygosaccharomyces rouxii]
    MDLTFYQSSILTIVTIFLLTSLVSKRFFTAATPRMVSQDTIQRVKGLIGQKKLFVASKTYCPYCQATLKTLFTDLQFPEA
    QAIVLQLNTIDDGQDIQDALYEINGQRTVPNIYIDGKHIGGNSDLQELNASGKLQALLK

    >gi|254584824|ref|XP_002497980.1| ZYRO0F17908p [Zygosaccharomyces rouxii]
    MFSKNLVTLLTLALGAFAQDATAPKGSDVVKLDTSSFAEYIESHPLVLAEFFAPWCGHCKNLAPEYVEAASALKKDNISL
    AQIDCTEDQELCMDQGIRGYPSLKVFKGGDPSKALEYEGGRTAESIINYMVKQSLPSVQVFDDEKAFEELLKESVQPVVV
    FNGDKNLNQTFHKVADSLFNEFTFASFDGAKEYLAVHLPNEDEPISFKGDRKGIEKSADDLEAWIKIEGLPYFGEVNGQT
    FGAYVESGLPLAYFFYNDDDERKEYSSFFTKLGKEYRGKLSFAGLDARKFGRHAENLNMKEQFPLFAIHNMSSNLKYGVA
    QLPDEKYEKLDKPLKLSTKEVSKLVNDVVSGKAEPIVKSEEIPEKQESNVIKIVGKTHDQLIEDNKKDVLVKYYAPW
    CGH
    CKRLAPIYEQLADILASDDKTSKSFVIGDIDATENDVPGVDLEGYPTIILYPAGKNSKPVVFEQERSVESFLAFLKKNGG
    TKLDLEKVYEKYQAEQKKADEDESDETGHDEL

    >gi|254585069|ref|XP_002498102.1| ZYRO0G02266p [Zygosaccharomyces rouxii]
    MSAGEIDESLYSRQLYVLGKEAMLKMQHSNVLIIGLKGLGAEIAKNVALAGVKSLSLYDPQPVTIQDLSTQFFLTESDIG
    KQRATVSREKLAELNSYVPIKVVDSLIDEKSLLEFEVVVATETVSLQEKVNLNNLCHAAGIGFISTETRGLFGNVFVDLG
    DEFTVLDPTGEEPRSGIVSDIEPDGTVTMLDENRHGLEDGNYVKFSEVEGLEKLNDGSLFKVEVLGPFAFRIGPVSQYGK
    YIKGGIFTEVKQPQKLSFKTLQQSFAEPEYLFSDFAKMERTPQLHLAFQALQQFASTHGGELPRPLNASDAAEVVKHAQQ
    IAAHEPNVLGGAPVDEKVIAELSYQARGDLPGIVAFFGGLVAQEVLKACSGKFSPLKQYMYFDALEALPEQKQFVRTEET
    TKPINSRYDNQIAVFGLEFQRKIANLSVFLVGSGAIGCEMLKNWALLGLGTGSEGGIVVTDNDSIERSNLNRQFLFRPKD
    VGRNKSEVAAQAVAAMNPDLTGKIDAKIDKVGPETESIYNDQFWESLDLVTNALDNVDARTYVDRRCVFYRKPLLESGTL
    GTKGNTQVVVPLLTESYSSSRDPPEKSIPL
    CTLRSFPNKIDHTIAWAKSLFQGYFSDAPENVNMYLTQPNFVEQTLKQSG
    DVKSILETISDSLNHKPIKFDDCIAWARLEFQKKFNHDIQQLLYNFPKDAKTSNGAPFWSGPKRAPTPLKFDINNPDHLH
    FIVAAANLRAFNYGLTGDSGAPNLEHYKQVLSKINVPEFSPRSDVKIQVNDDDPDPNSDRGENDLSVLAGSLPEPSQMAG
    YKLDPVEFEKDDDTNHHIEFITACSNCRAENYFIEPVDRQKTKFIAGRIIPAIATTTGLVTGLVNIELYKIADAKTDVEK
    YKNGFSNLALPFFGFSEPIHSPKGEYNGKSYDRIWDRFDINGDIKLNDLIKHFQEKESLDITMLSYGVSLLYASFFPPKK
    LKERLNLTITELVKFITKSEVPPHVRTMILEICADDKDGEDVEVPYITIHL

    >gi|254586335|ref|XP_002498735.1| ZYRO0G17314p [Zygosaccharomyces rouxii]
    MKKVGYRQSHLVRIIAAAALVGLWWFLSSSELSYTKPEIDYKGDGTQLQNQNQPKPKPTEGASVPGTIMPSMPDQEAKKE
    LGRASWKYFHTLLARFPDEPTEEQRNKLNSFIHLYAELYP
    CGECSYHFVKMLETNPPQTSSRVTAAMWGCHIHNIVNEYL
    HKPIYDCSTILEDYDCGCGDGEGKIRDSLKSNKVSLQREGQQGG

    >gi|254586713|ref|XP_002498924.1| ZYRO0G21758p [Zygosaccharomyces rouxii]
    MLALSPSPYFRVLRSISSKTSFTSKSSIVESLRPSTNNSIRAMSSAASKFYGLEPLDKTGKPFSFKQLEGKVVIIVNVAS
    K
    CGFTPQYAGLEELYKKYKDEGLVILGFPCNQFLSQEPGSDEQIGEFCKLNYGVTFPIMKKIDVNGKNVDPVYEFLKSQK
    SGTLGMTRIKWNFEKFLIDKQGKVVERFSSLTKPSSIEPKVKELLGK