Yarrowia lipolytica CLIB122 uid12414

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50542924|ref|XP_499628.1| YALI0A00781p [Yarrowia lipolytica]
    MSLLDRYNSQLVDEGDAEDQEFLDLLDDDEAFQGYREQRIAELSRQMKEAKDGAQSGHGSVQTLESDKDVLEATTSADRC
    VIHFFHPDFTR
    CKIMDSKLEQLAARHLGTRFVRVDASKAPFLATKLGLKALPVVVCYIKGQEATRVVGFERLGGTDNFQL
    SALENLLYTYGIIQRVGTSGMRRAEKKMEEEDEDWSD

    >gi|50545407|ref|XP_500241.1| YALI0A19426p [Yarrowia lipolytica]
    MATERAPLRLGSKAPDFEADTSNGPIKFHDFIGDNWTVLFSHPDDFTPVCTTELGAFAKLEPEFSKRGVKLIGLSANDTS
    SHKAWIKDIDEVNDSKLTFPIIADPTRQISLLYDMIDHQDATNVDAKGIAFTIRSVFIIDPKKTIRLILQYPASTGRNTA
    EVLRVIDSLQTGDKHRVTTPINWTPGQDVIVHPSVSNEEAATLFPKFKTIKPYLRTTPLSAE

    >gi|50545711|ref|XP_500394.1| YALI0B01650p [Yarrowia lipolytica]
    MKLSTLFSTFVCVTLGVASSAKEYSYFDVKKLSESLVDGSAPADTILIDVREPSEYAAGFIPGAFNMPLKTQSFALCKSP
    EEFETAMGFPKPSKNMHVVFY
    CQSGVRARMAEKQGEQCGYENRGIYLGSWKEWSQYETEVGQC

    >gi|50545789|ref|XP_500433.1| YALI0B02684p [Yarrowia lipolytica]
    MDSYVFEVSNLHCSSCETSVKEALAPVIPPSWQVFVSVAEGKVTLVPDEGKLDSKGIRRVVDRLLASGYDVEDMNVDEIV
    AKPGWFRQFKSALFDGGQKEKRHKKHCESCRDEKHKESEDSDEAPTIIGENSPATATEFKTTFAIGGMS
    CVSCSNQITET
    VKAQFPSLDTFAVDLMNKSAVVIINNKTTATKIQECIRGMGYMCDLVEMAPVKSTKAYKVTASIGGMT
    CAACVNQIVAAV
    QDIEGVDCVTVSLMSNSADIIIADKKWLPKVVEAIEDSGYDCDIHAVEDTESKRVEEMTRTVNLAIDGMFCDHCPDNINN
    ALSSYGQAMVVDDPVALDHPFVKFTYKPELPNVTIRHIIRKVQDLSPQFTLSIVHPMTLEERSAKLQKHEQVRLFFRLAL
    SVAVAIPTFILGIVGMSLLKKDHPFRMYIDESAWAGSASRVTWALLILATPIYFFAADVFHIKAVKEIRNLWRPGVSWKR
    RFFKFGSMDMLMSLGVNVSYWTSLALLILAAKSPNREEHGKGDEEMGYHTTFFDSVVFLTMFLLIGRCLEAYSKARAASA
    ISLLSDLRPKEAILVFAEDGALAKEKVDFEEGKMESDEEEEEHTTYSGDDKVSVDYLEIGDYIRVLPGMTPPTDCIVVQG
    GSTFDESALTGESRPVRHGQGDQIFAGTVNNGSGSLIAKVMALEGGSLLDQIVNVVREGQLHRAPIERVADRLTSVFVPI
    VTSLAIITWIIWLALGTTGSLPPHYLDIDLGGWVVWSLQFAISVFVVACPCGIGLAAPTALFVGTGLAAKYGILARGGGE
    AFQEGAKVDVVCFDKTGTLTEGGEPKITDEKVISYDTKEIFFLAKLIEQQSGHPLAVAVVNHVTDMNIELPGYSVTVEEV
    PGKGLKGSLSVPKTSSLGQAGVTEFLFGNERLIEENNAAISNEDAALLHRWKTEGKSVMLMALRPDGGNFALALIISAED
    KIRPETPSVLKALQEQNIQTWMISGDNQITANAVAARIGIPADNVIGGVLPQEKAAKVQWLQKTAVSARSGKSTGRAIVA
    MVGDGVNDAPSLSTADVGIAIGSGADIAMSSAKFVLMRSELTSVLTLFDLSRAIFRRIKLNFAWALVYNCIGIPVAAGVI
    YPYNNSRLDPVWASLAMALSSVSVICSSLLLRLYRPPKVQFDAEVGDEGESIKSVHTNRKWKRRLAKIKNVKKLKNAGKR
    LETIEVVEE

    >gi|50545868|ref|XP_500472.1| YALI0B03916p [Yarrowia lipolytica]
    MTASQEPGISPTIKFGPSKLDVITVAGGCFWGIEHMYRKHYTDKGLVDCKVGYSGGSIDNPDYKSVCAGSTGHFESLQVT
    FDSAQVSYEELADFFFKIHDPTQTDGQGPKNIGTQYLSGLFTHNEDQQARALAVKKKLEDQWFAKPIATVIQPIENFWDA
    EDYHQNYFVSNEGYHCPTHFLRTTPEK

    >gi|50546737|ref|XP_500838.1| YALI0B13398p [Yarrowia lipolytica]
    MSVVEITSDSHFSELTSSLAPTTLVAVYFHTPWAAPCAQMNSVFKSLSTLHSSVLFLSVNADELPEISESFDISAVPYFV
    MLRDGTILKELSGADPKELAATISALSESDAKPAESESAAAAAPTSSTADAPASSSTDAPEPAEETEEELNARLAKLVKA
    APVMLFMKGTPAAPQ
    CGFSRQLVAILREHHVRFGFFDILKDDAVRQGLKKFSDWPTFPQLYIGGELQGGLDIVKESIQED
    PEFFEKAVAE

    >gi|50546891|ref|XP_500915.1| YALI0B15125p [Yarrowia lipolytica]
    MVATVQHPAPDFKKTAVSGGVFEEVSLDQFKGKWVVLAFIPLAFTFVCPTEIIAYSDAVSQFKERGAEVLFASTDSEYSL
    LAWTNVARKDGGLGPVNIPLLADTNHTLSKDYGVLIPEAGVALRGIFIIDPKGVVRQITINDLPVGRSVEETLRLIDAFQ
    FTEKHGEVCPANWQKGSDTIKADPVNAKEYFEKANK

    >gi|50548009|ref|XP_501474.1| YALI0C05467p [Yarrowia lipolytica]
    MATESAIKTIKEHIAKDKVFVASKSYCPYCKQTKQLLSQFKEAKPVILELDELDDGAELQAALAEITGQRTVPNVFIGGQ
    HIGGNSDLQVLAQKDELADKIKAAL

    >gi|50548015|ref|XP_501477.1| YALI0C05533p [Yarrowia lipolytica]
    MSNKTDSEWRAVLSPEQFRVLREKGTERPHTGKYNSTFDNGTYNCAGCDAPLYTSKAKFRSSCGWPAFYEAIPGALKLNV
    DKTLGMTRTEMVCANCDGHLGHIFKGEGYDTPTDERH
    CVNSVSLSFKPE

    >gi|50548577|ref|XP_501758.1| YALI0C12386p [Yarrowia lipolytica]
    MRFTTLFTLATAAMASLIDLTDKTFEKSVLNADHPTLVKFYAPWCGHCKKMGPDYDQLASVYAHTDDVEIARYNGDENRK
    FSKKYGIQGFPTLKWFPGKGADPVDYESGRDFDSLVQFVQSKSGVKAKTAPKSEGAKLIKTVDDQSFADLFKNDKKYALV
    AFTAKW
    CGYCKQLAPEYEKVAAVFSRDPVSIGQVDCTEPEPSHDLLEKYDIKSYPTLLWFEEGSTEPVKFEGGDRSVEGL
    VAFINDKTGLNRNTDGSYNDYAGVFSGKLLEQLKEAVENPTKVKEFIGEIPQSFSSVYERVLSKVGSLGEETEAYLDKEI
    TRLGNIIEKRGAKQDKLDEFKIRQNVLKSIKALKNKVENVRDEL

    >gi|50548981|ref|XP_501961.1| YALI0C18095p [Yarrowia lipolytica]
    MDRSDSEKTDVLPMFKQEYGRYGRQMLVPEFGISGQLDLRSKRILVVGAGGLGSPAIQYLAGAGIGHITIIDDDTVEESN
    LHRQTIHAGNVNVPKSESAAEFVGKLNPCISVTPMVVRLSPSNSFSVFEGHDLVLDCTDGPAVRYLINDTAVLSGIPVVS
    ASALKTEGQLSIYNYNGGPCYRCLFPIPPPADAVQT
    CGDGGIMGPVVGMMGMSQAMEAIKLLTGVYSESFTPFLMLYSAY
    NFPPWKSVKVRKRQKTCAACGDVPRISRQLIETGQVDYSEFCGSPSQVLLGEEHRITPEEYSKIVSTKHILLDVRERPQF
    DITSFPRSINIPWSELKHKEELDVQVDGSPVYVVCRYGNDSQNAVDKLQKLGIPSKDIKGGLYAWAKNVDEKFPIY

    >gi|50549203|ref|XP_502072.1| YALI0C21043p [Yarrowia lipolytica]
    MAAVQKGQEVPAVTVREGTPSCQFDLQDVTKEGTHIIVGVPGAFSPACSAGHVPGYINLFPKLKERGVKTVWVVAVNDAF
    VTNAWAESLDAPADDVRIISDQAGEFSLAFGTLFDASEFFGNKRSARYAAVIMDGKVVEVFEEPDKTGLDVSKAENVLKS
    LG

    >gi|50549387|ref|XP_502164.1| YALI0C23078p [Yarrowia lipolytica]
    MIRRSSATFIALILTLVIITLVSLRSDHVPGRAAVSMVEDRITRVQPGSKKAAAPEKVNIVKDDTSSENIKAKNEAAQQV
    PDIGGPSIMAKMGNETLKAELGRASWKLFHTIMAQYPETPTKQEQTTLKNYIYLFSQVYP
    CGECAEHFQKLLAKFPPQVS
    SRNTASQWACYVHNQVNERLGKEIFDCNNVGEHYKCGCAEDEEGGEKKEEDSDIMEPMEDDFTFGLKLDENE

    >gi|210075599|ref|XP_002143043.1| YALI0C23379p [Yarrowia lipolytica]
    MLRLAKRQLYRNYSSSASAAPVQLTNVLKDSPSPYLQAHKNNPVAWQEWNKDTLKLAREANKPLFLSIGYNSCHWCHVMN
    DESFNNPAIAEKLNKNFIPVKVDREERPDLDAIYQMYQQVSSGSGGWPLNVFVLPETLEPIYGGTYWEGPETEKKRLTEK
    GEPVNKEGMVDEKPQSAAKFSDVLDRVGHVWNADPQWCIDAGKDTGDKLKNLLQLHTVGDPLTDAPFDEAMYEDTREHFE
    AVYDARNGGFGTAPKFPCAYQLSFMLNHPEMQKDTNMPTDLPHMALHTLAKIAVGGIKDQVGNGVARYSVSADWVLPHFE
    KMLYDQALLLEAYCDAYNWVQIHDEPHDWYSYVNDMIRDLTIYLTSGDIVAPKGFYAGVDADSQAEDGGKMIEGGYYLWT
    AAQFHKALQPMKNPMDRDMAAAYFDIQDMGNVTSDQDPHNELWFQNVLAPNYSYEKLGKTFGKKPNHVEAAIKEAKTLLR
    KYREENRVAPEVDSKIVTAWNGLAIGALAKASVILKSIDPELAETALAKAISSADFILEEHVRDSHGVQELARFSSNGVL
    STSEGTDADFAFLISGLLNLYDVTGDRKYLENASSLQDSMITKMYDTENGGFYAVSTEVADELLFRPKTTFDASEPSPNG
    VALTNLQRLQRHGIDATNVGRPYEGYEGGIIGAFKEDIRAQPWSYTTFLV

    >gi|50549509|ref|XP_502225.1| YALI0C24420p [Yarrowia lipolytica]
    MSIGKLYDAPSCRVTPLKALVKHFKLDVDIVQRDAEFGKLFPLKKVPAFVAADGTPIHEFIAISYYLLSQIPNNPLAPKT
    KEDEAEVLQWVSFGNQEVLGAAWDTFGPLTGRAPYNKKSVDAASEQLDKLIALTYEPHLTKNTYLVGEKVTYADVANVAL
    LSRGFEYLFDDAWKKKYPATTRWWLTVSKNAVFTGFDFPVTSERIQYTPPKKEETKKETKKEAAPKAANAEDAPAPKKAA
    HPLAALGPAKEPIDNWKRVYSNEDTREKAIPWFWEHYDPEDYSLWKVKYKYDDELTLTFMSTNLIGGFVNRLSASTKFMF
    GTAVVYGTNNDNGIIGAFMIRGQDHVAAFDVAPDWESYDFTKLDPSKPEDKEFVDNMWAWDKPVVTASGESKEIVDGAVL
    K

    >gi|50550009|ref|XP_502477.1| YALI0D06259p [Yarrowia lipolytica]
    MSTTKRHSDLERTFGKEAVATIASSHVLLVGAGGVGCEMLKNLVLLGFGKITVLDLDTVDLSNLNRQFLFGHEHIKQPKS
    VVARATAQKFNPHVDITSHLANIITDPKFTVSWYKGFDLVYNALDNLEARRHVNRMCLTANVPLVESGTTGFLGQTQVIL
    AGKTECVDCVPKETPKSFPI
    CTIRSTPSQPVHTVVWAKSFLFVQLFGNDLDLGEMDESEASKEELNTLKKETAELLELRD
    VISKPEFGKNVFCKIFDVDIARQAEHNVDNGRQKPDPQSWDELEKLAKHLDGAHIAKSRAQNVWSREEAFAVFLDATKRL
    QTRFNNGETLEFDKDDEDTLDFVVAAATLFATVHHVTTKSKFDLKQIAGNIIPAIATTNAMIAALAVQQGVWQLTSPERA
    RDYYISRRGGDRFFTVTKPAPPSSSCVTSSAARVVVMCDVDKTKLSDLVEWVSKFFPKEELAVLSSQLIYDVDFDDNLER
    TLADLGVKERSFVTIMDDSDDDIKLRNLEIYFEPRESAGEASSEKISNITPIPTVPTYTVEKPEEDDDDDDELEVADTSK
    RGFSEIDSVVILDEEPSKVVKVDEGTDEVKKDVQVEDVEEVVLLD

    >gi|50550299|ref|XP_502622.1| YALI0D09603p [Yarrowia lipolytica]
    MKLMHLLPLVALFQPLVAQNVKVYEGDDHVHSARCLSGFIDDACGATFENVEATNAEVRPLLKELVKEDYFRYYKIDLNG
    ERCPFVWDDGL
    CGNKACALNLESEEDLPEVWKPKRLGALTKDSVSRDKNVRQNERFAEFDLEQEYDSRGDNGGSNYCYPE
    DEFAHGGVYVSLLDNPERFTGYAGPHAQRVWRAVYAENCFTGMSSLPGEVSSPLNLGSGLVPFGQQDFDLAEIDSYANDL
    PHQCLEQRIFYRLLSGMQASISTHLCYEYLDMDAGEWRPNSTCFESRVGTHRDRLSNLFFNYALVSRAVSKLNDHLNDIK
    FTDDTKHNEETREIVAKLTGLLQNTTSAIFNETLVFSTPEAITLKSEFRQRFRNVSALMDCVGCDRCKLWGKVQTAGYGT
    ALKLLFELGDNTDEVIKNLRRTELVALFNTFDRLSKSVEAVEYFENLKEGARQESAFATFLYYVRRATSQVSRVFSTIKN
    SIFNRFRWIKHTEFWEDVEREMYATKVGLRFILRSYWNFPRNMLMLTFNWIAPKWDKFVGRDKYQDRIIPTRGVYTLTNT
    N

    >gi|50550421|ref|XP_502683.1| YALI0D11066p [Yarrowia lipolytica]
    MLLCVVIQGVTLINANITPHWHQRKMHVLAPIVALFLLATTAFAQVFDAEFIRENLPSLSRSKGVIRLNDQNFQKLVGGP
    RDYHFVVLLTAEAAQFG
    CHLCKEFGPSFDLLAASYLTDHPDSDNVFFGIADFSESQATYRGLDLTAAPNFWIFPPTEKNI
    PIGGEHYKFSFPQVDNLEVPAGNFIREVTGKDFKIHYPFRWDKLFSAILTIAGVGVGLVVFKKQLKVFFAKRNVWAAATL
    VLILMFVAGHMYNIIRKTQYIVADGNNNPVYFVGGFSQQIGVETQIIALTYALLAFCVISLALRAPSLNTGSKQVGVTLA
    LCIVILVAYSFLLAKFHIKNGGYPYHLLNIF

    >gi|210075757|ref|XP_502937.2| YALI0D17380p [Yarrowia lipolytica]
    MPTITLIHNPKCSKSCAALELLEQKQISPNVVQYLDTPLSVAEISSIVRKLDMKPVELLRKGEPQFSELNLGAANTPDAE
    IIDAMAKHPNLIERPILIVDDKAVIGRPTEKLNDLLGKL

    >gi|50551225|ref|XP_503086.1| YALI0D20768p [Yarrowia lipolytica]
    MLRTTRILPSKFGVAARTRAVTQFQRCYSSANEELDVLVIGGGPGGYVAAIKAAQAGLKTGCIEKRGSLGGTCLNVGCIP
    SKSLLNNSQMYHAIKTDSANRGIEVSDVKMNIAKLQEAKETSVKGLTGGIEMLFKKNKVNYYKGAGSFVSDSEVKVDPID
    GGEAVTLKAKNIIIATGSEPTPFPGITIDEKKIVSSTGALALEAVPKKMVIIGGGIIGLEMGSVWSRLGSEVTVVEFQNA
    IGAGMDDEIAKAAQKMLTKQGIKFKLGTKVLSGAIEGDGVKVEVENVKKGDKETLDADVLLVAIGRRPYSEGLNLEAAGV
    EKDDKGRIIIDQEYRTNKSNIRCIGDVTFGPMLAHKAEEEGVATAEYIATGHGHVNYAAIPSVMYTHPEVAWVGQTEQQV
    KEAGIKYNVGKFPFAANSRAKTNLDTEGTVKFIADKETDRILGIHIIGPNAGEMIAEGVLALEYGASCEDIARTCHAHPT
    LSEAFKEAAMATYDKAIHF

    >gi|50551289|ref|XP_503118.1| YALI0D21582p [Yarrowia lipolytica]
    MFTPLKASCGAFMLHEATDNYLFSNGRILGASSILFGGIQQLLTDPINAIKTSGSVHVLFGMLLSGVSTYLFTPIFLPNY
    SAHVPWAPFGTYTNLIAGLLVGFGTKLGSG
    CTSGHMLCGLSRGSERSFVATATFSAVAMITARVVGSLPSCYDATGQQVA
    CHHIAENYSAELPYLAGLLGVILLLRNLIPKLNLSLQTRSTLSAIFSGFAFGTGLLVSGLAAPSKTLGFLAGLPPKFDPS
    LALVMLFGVLPNAISAWKSGYFTKVKPLLTGDFSLPTAKDVTPRLVIGAAIFGVGWGMAGICPGPGILGSFLDGLRGLSW
    LVGFLPAYYIASQI

    >gi|50551639|ref|XP_503294.1| YALI0D25894p [Yarrowia lipolytica]
    MSNTATTTETVDKNKIWGAPHATVEINGKMVKLDENGKICRSCNSLKDFQAAMGGGGKGGSMAAMFGAMQAQKKKEEAPK
    GYRDDPADVEVLGRATWTFLHTMAAQYPDNPSETQKKEMTDFMGIFSRVYP
    CWFCASDFQKWIKMSPPEVDSKDILSKWL
    CKAHNEVNVKIGKPVFDCANWKKRWLDGWE

    >gi|50551739|ref|XP_503344.1| YALI0D27038p [Yarrowia lipolytica]
    MKEAGDSSTTPPKPDTTSAYQVGGMTCGSCVSAIINGLEACPGVTEAAVSLVTERASVHHNKSIISAEELQERIEDCGFD
    ASLIDSSPIAAPVSTPMERLKVKIFGMT
    CSSCTNAVRDTIQDIRGVANVVVALATEEATISFNPQECGARDIINAIEDCG
    FEGVLSAQQDNATQLASLSRIKEIQKWRSDGIQCFILGLPVMLLTHILPMVGLQPLHDLTIFKGLYVDDLVCFVLATYIQ
    FWLGHKFYVSSRRALSHGTATMDVLVAISTSSAYFFSVFSMLYAIATVADTHPHTLFETSAMLIAFTTLGKYLENRAKGQ
    TSGALSKLISLTPTTATILKDSSKYDPSIVYDESAEMDIAAELLQRGDIVILKPGAKVPADGVVVSGETYIDESLLTGES
    TPVVRKVGDQVVGGSINGSGRIDFRVERAGKDTALANIVRLVEEAQTSQAEIQRYADKISGVFVPCVVALALLTFIFWII
    MSNVMKHPPNVFSLPEGKFLICLRLCISVVVVACPCALGLATPTAVMVGTGVGATHGILVKGGAVLETASKIKTVVFDKT
    GTLTTGRMTIQKHVFEKDTLKNLNMTETEMWLILAGVEASSEHPIAQSLVRQAKEAAQVEDVPGVADFVAIVGQGVTGVV
    DGHSVAVGSSELVNSSCKSLDKPPATPHSPDNPATVIHACVDGQYVGYMAFADSVKSDARAAVSVLKKMGINVAMMTGDN
    HFVAHAVADEVGIPRSNVWASTSPAQKLAIIEQLQEPQDPNEAADSTDLSLNASVVAMVGDGINDSPALAKAAIGIAMSS
    GTDIAMDAADIVLLNKESLMDVPASINLSQVTFRRIKINLVWASVYNLIMIPFAMGCFLPFNFMLHPMEASAAMALSSVS
    VIVSSLALKKWQPPKDTEYGSDEWRDMESQTVKPKRRWWQKLWRSEGVRYERL

    >gi|50551747|ref|XP_503348.1| YALI0D27126p [Yarrowia lipolytica]
    MTHSPVVIIGSGPAAHTAAIYLSRAEIKPTLYEGMMANGIAAGGQLTTTTEIENFPGFPDGIMGSQLMEDMRKQSIRFGT
    EIITETVSKVDLSQRPFKYWTEFNEDEEPHTADAIILATGASAKRLSLPGEDQYWQQGISA
    CAVCDGAVPIFRNKPLAVV
    GGGDSAAEEALFLTKYGSKVYVIVRKDKLRASAVMAKRLASHPKVEILFNHVSIEAKGDGKLLNALEIENTLTGEKRDLE
    VNGLFYAIGHIPATSIVKGQVETDEEGYVVTVPGTANTSVKGVFAAGDVQDKRYRQAITSAGTGCMAALDCEKLLAEEE

    >gi|50551959|ref|XP_503454.1| YALI0E02310p [Yarrowia lipolytica]
    MSAEKTNTAFYNLAPLDKNGEPFPFKQLEGKVVLIVNVASKCGFTPQYKGLEEVYQKYKDQGFTIIGFPCNQFGGQEPGS
    ADEISSFCQLNYGVTFPVLQKINVNGNDADPVYVYLKEQKAGLLGFRGIKWNFEKFLVDKHGNVVDRYASLKTPAGLEST
    IETLLKKP

    >gi|50551969|ref|XP_503459.1| YALI0E02420p [Yarrowia lipolytica]
    MRITRLLLLAAAAVAAVIPTPKPEGEEEAPAPCPEISGKEWETTVAEGTYWVKFYSPQCGHCQMLAPKWERMYQEIGNDV
    ASRHDFHIAAVNCLADGDLCNQENINVYPTLNLYKNGKKVETYDLRKGTQPSRLAKFVEEKIKEASGISKLEGDEEKIAS
    TKKANVNVEGLSVDLNPTNFKALVSDDPTGWYIKYYLPS
    CPHCVAMDDAWNEVAAKFKNQLNVGEINCAKYADFCRGQGI
    EYYPAVTFQIGELSVTYNGERTTDALTLFGLQAVEARDMKSVNQLEFEELRQKHPETVSYIYLHDEALFPEDLQALQKFA
    INVVAHANVYKSDDKKLVDKFSVTRLPALVAVNNDYTDEMSFEVYPEYDVGHLRNSERLLQFARRTWLPLMPELTPINQD
    SVFADGRIVVLALVDREDKFATKVAIDELKQSATKYFKAKMHARQKELDLLRIQRHSERAKLLKEKDPKLQKKLEKDDTS
    VPTRPPVQFAWIDADKYSKWIESRFRFNWDDRKANAPIIVIDDAKNVQFFDTDDKNARLEPSDAEQLARVLDLIEKNNSR
    QLFPRSTRGFFASWFIFVWGLKTYILLVFVLLAVAKMGKRYLRHRRSAATPTLGKWE

    >gi|50552013|ref|XP_503481.1| YALI0E03036p [Yarrowia lipolytica]
    MKFTALTIALMGALAAASDVVKLDSDNFADFVTDNKLVLAEFFAPWCGHCKQLAPEYESAATILKEKGIPIGKVDCTENE
    ELCSKFEIQGYPTLKIFRGSEEDSSLYQSARTSEAIVQYLLKQALPLVSEFANEKELNAFTKDNDVTIVAFHDEDDEKSQ
    STFQRVAQKLRERFTFGHSADKALAKKYGVEKFPALVVYRNFDEKPAVYDISAGKKVFKFKPEPLTKFIKTEAVPVIGEI
    GPASFQDYATSGLPLVYIFSALEKDTKQISEWVKPWAEKLKGEAYVGVIDADLYGSHAQNVNIQEKFPAIAIENFDNKKK
    WAHAQDAKITKASVDKFFKEYIEGTLEPILKSDPVPEYQDGPVHIVVGKNYKDIVLDDDKDVLIEFYAPW
    CGHCKILAPI
    YDELGDLFFDHPEISKKVTVAKIDATTNEFPDEDVKGFPTIKLYPAGKKNAPITYPGARTLEGLNQFIKEHGTHKVDGLA
    HADEEEAPAKDTKAKKGGKIDDEL

    >gi|50552402|ref|XP_503611.1| YALI0E06017p [Yarrowia lipolytica]
    MSDKSDKMQIDNAGEIDESLYSRQLYVLGHEAMKKMANSNVLIVGLQGLGIEIAKNIVLAGVKSLTLYDPGKTEVADLSA
    QFFLREDDVGKRRDQVSQPRLAELNSYVPVHVLEAKDLSEEEVARFQVVVLTNASLEEQIRVNEITHKQNIGFVSTDTRG
    LFGNIFVDFGSSFALIDANGEEPHSGIIAGIDEEGNVAALDETRHNLEDGDYVKFTEVEGLDINGDTPRKIKVTGPYSFN
    IGSVDGLGTYKKGGLFTQVKMPQEISFGSLKEQLAKPELLISDFAKMERPAQLHVGFMAVQAFQQKHGRAPRPQNTEDAN
    EVLHLAKSVTAEYPDVLSGGEIDEKLLTQLSFQAAGELPAMTALFGGMAAQEVLKGCSGKFGPIRQWVYFDSLESLPKDV
    ALTEQSVAPTGSRYDRQVAVFGKEFTEKIFAVKTFLVGSGAIGCEMLKNWALMGLGKDGEIHVTDNDVIEKSNLNRQFLF
    RPKDVGKHKSVTATEAVAEMNPDLKGHFDAKLDKVGPDTENIFDDSFWKSLDFVTNALDNVDARTYVDRRCVFFQKPLLE
    SGTLGTKGNVQVVYPNLTESYSSSQDPPEKGIPL
    CTLRSFPNKVDHTIAWAKSIFQGYFTDNVESVNLFLSQPNFVESTL
    KQTGDQKSILENIKSYLVDERPTTFKECVQWARLEFEKKFNGDISQLLYNFPKDATTSTGAPFWSGPKRAPDALEFDFNN
    QDHLDFLIAGANLRAFNYGIRGDDLDVSEYKEVVDNMTVPKFEPKSGIKIQANENESVDPVDADSEELTQLANSLPPPSS
    LAGFRLTPVEFEKDDDTNFHIQFITAASNCRAQNYAIDGADRHKTKFIAGRIIPAIATTTALVTGLVCLELYKVVDKREV
    IEDYKNGFVNLALPFLGFSEPIASQKMEIAGVELDKIWGRYDIHENLTLKQFLEFFEKNYNLTVTMLSQNVSLLYASFFP
    PAKLNEKYDLTLTELVEAVTKKKLEPHVKTLIFEVCAEDQDGEDVDDIPYVCLHL

    >gi|50552648|ref|XP_503734.1| YALI0E09427p [Yarrowia lipolytica]
    MTITDLHSLGEFEEAIKSEELTVIKFSTKTCIPCKMIAPVYEKYSKAYKGAKYYNCDSEELVEVASMVPVSSVPTFALYK
    NGEIVLIVSGNGADPRKLRSGIRKYAAKDETKKPRPVTNGIKKRRRPKKIT

    >gi|50553354|ref|XP_504088.1| YALI0E18029p [Yarrowia lipolytica]
    MASIPHYDYLVIGGGSGGVASARRAASYGAKTLLIEGKALGGTCVNVGCVPKKVMWNASDLAGRIRQAKEYGFPDVDPKY
    ADNFDWSGFKAKRDAYVKRLNGIYERNLQKEGVEYVFGWATLYKQEGQEFPLVHVKSDDGNTKLYSAKKIMIATGGKPRL
    PDVPGAEYGIDSDGFFALETQPKRVAVVGGGYIGVELAGVFHGLNSETTLFCRGQTVLRAFDIMIQDTITDYYVKEGINV
    LKGSGVKKIVKKDNGELLVTYEQDGAEKDITLDSLIWTIGREPLKDTLNLGEFGIKTNKRGYIEVDEYQRSSVDNIYSLG
    DVCGKVELTPMAIAAGRKLSNRLFGPTEFKNQKQDYTDVPSAVFSHPEVGSIGITEAAAKEQYGEENVKVYTSKFVAMYY
    AMLEEKAPTAYKLVCAGKDEKVVGLHIVGADSAEILQGFGVAIRMGATKADFDNVVAIHPTSAEELVTMR

    >gi|50553450|ref|XP_504136.1| YALI0E19206p [Yarrowia lipolytica]
    MTMSLRNKLTVGKRFLQTAERSTPSMTPFMLNNPNAYHSSKSDNQAENKSSSSQPQGFTWARHQLPRFDAASKSSKIETP
    KPFAFKFPNTQDKSSRPATTPFAFRPAAKTSATAAAPTKAAAPAEKAAAPAPAPKRTRKLRPRKAVITLSPTAVKHLKDL
    LDQPEPKLIRIGVRNRG
    CSGLTYHIDYVDKPAKFDEEVVQDGVRVLIDSKALFSIIGSEMDWLDDKLSSRFIFRNPNSKG
    ECGCGESFMV

    >gi|50553470|ref|XP_504146.1| YALI0E19448p [Yarrowia lipolytica]
    MARRSARLAGEKAPAPQELPSKRAKKQKVNGSDKKDIEESKTEESKTEESKTEEDEAKTNESKPEEVPTELQIGDALPEK
    LTLLDQDSNPIDLSALVAKEPIVVIFAYPKASTPG
    CTRQVCGFRDKYDDFKKVDATVFGLSADSTAAQKKFQTKQNAPYE
    LLSDPKHELIGILGATKTPGKVPKGVIRSHWIFKNGKLAVKEVKIGPEASYTQALEEVQKE

    >gi|50553526|ref|XP_504174.1| YALI0E20119p [Yarrowia lipolytica]
    MPAVSPTLKTTASSELLTVAAGCFWGVEHMYRKHFADKGLVDAKVGYSGGNTEDPSYRKVCSGTTGHAEALQVSFEPAKV
    SYEQLVDFFFKIHDPTQANGQGPDIGSQYRSAIFTHSSEQQKIAEGVKQKLQDTWFKDPIATDIEPIQNWWDAEDYHQEY
    LFKEPGGYQCPTHFYRNTPQK

    >gi|50553806|ref|XP_504314.1| YALI0E23540p [Yarrowia lipolytica]
    MKELTSTDEYFKAIHPATVSVVDFYADWCGPCKAVAPGYAKLAEQYKNQASFYKVNVDNNQGASSHAGVSAMPTFGVFKS
    GKLLETVRGADLGAVERLIKKHGAAAKPVYVTQGHVLGQKPMSAQATSSIRHVIQAILAYFVSLFSLLPLESATSFVEAA
    QARQKGREMQRQRAPPRGFDGSDRFSFNKKESPASTCSS

    >gi|50553945|ref|XP_504381.1| YALI0E25091p [Yarrowia lipolytica]
    MDQNDLALTQLRCLLNLHPHPPLPYSANTDSFPSATFNYVPETPEIEGNVAACGIPQPFHSDKELAGKKVVFVSVPGAFT
    PT
    CTANHIPPYIENVDKLKAKGVDKVVVISANDPFVLSAWGRALKAPKDNFFIFASDGNAAFSKSIGQAVDLASVGFGER
    TARYAIIVDDGKVTYNEQEPGKEVTVSGFDAVYAKL

    >gi|50554343|ref|XP_504580.1| YALI0E30151p [Yarrowia lipolytica]
    MVWPFSRFSSKPVDEKSPKISPKLQQPEGCEIATVAAGCFWGVEHVFRHKYEGKGLYDCRVGYSGGAKESPSYLKVCTGL
    TGHAEALQISFDPKQISYPELIELFFKMHNPTTLNRQGSDKGTQYRSAIFTHNDTQQKEAEAVKNKMEETFYKNPIVTEI
    EPISSFFDATENHQKYLNKNVNGYTCPTHFIRTLPEKHVA

    >gi|50554477|ref|XP_504647.1| YALI0E31647p [Yarrowia lipolytica]
    MTPKPPPTKHNSAQHTTTTMKLHTVTSLGEFDKVLKSELVIVDFFAEWCGPCKVISPFVETLQSDYNQVLFAKVDVDQGK
    DIAAKYTVSSMPTFVYFHKGKEVNRVVGADRAGITTGLDQLVSLNPAAVKSLPGAGGADSEDAGSTVNSADNSAIAAFVP
    KNMEILNSGIDFTSTEALNIANNGDVRNVLTNGLSGDQEFVSDTDSQMLLNVQLQNNAKIQTILLKKPAVSGDNQIPSHI
    KVWANHPNLSFDDTQSIEAQHVGDVVFDGEWAEIKLRYVRFQNVSTISMLIEGEDEDECTNLDRVVLIGSSGEARSGKLE
    KMQD

    >gi|50554607|ref|XP_504712.1| YALI0E33077p [Yarrowia lipolytica]
    MFRRLLQAKSSLRTVPRLGSPSLLTQRHFTASARRLFEFPESVPREKIEEDAVTIVNPQKDDKGRLLRLFVSDRAATRLN
    AISEDDKNPLLALRIEVESGG
    CHGFQYKLELSDVEDVDFEMDSVFEKNGARILIDKSSLEILRESNIDYTTELIGSQFKV
    VDSPYTVSACGCGSSFDFDESKLA

    >gi|50554901|ref|XP_504859.1| YALI0F01408p [Yarrowia lipolytica]
    MLHMATDNYLFTNGRILGASSILFGGLQQLITDPAQAIASSNSLHVLFGMFLSGLSAFLFTPIFMPNYEAHLPWAPFGSW
    TNLIAGVLVGFGTKLGSG
    CTSGHMLCGIARGSKRSFVATATFSIFAMLTARVVGSLPTCFDAAGQEVACHHIAENYSAEI
    PYLAGLLGVIIVLRNVIPKLNLPANTRATLSSIFSGFAFGTGLLVSGLASPQKTLGFLAGVPPKFDPSLAMVMLFGVLPN
    AISVWKSGFFKNVTPLLTTEFSLPQIFDVTPRLIAGAAIFGIGWGIAGVCPGPGILGSFLDGLKGFSWLAGFIPAYYLAG
    KV

    >gi|50554909|ref|XP_504863.1| YALI0F01496p [Yarrowia lipolytica]
    MAVTQITSVSDFQNAIKSDKLTVIDFYATWCGPCKMIAPTFDKFSETFTDAQFYRCDVDEASAVAQEVGVTAMPTFAFYK
    NGEKITTVMGANPSALNAAIKQNV

    >gi|50555145|ref|XP_504981.1| YALI0F04147p [Yarrowia lipolytica]
    MHELHDQIWTSLPNLFSTMTAVRNPYSISPVLTTSGPFSDEEFAPSPDVITALADMSILVIGAGGLGCEILKNLALSGFK
    KIHVIDMDTIDISNLNRQFLFRPSDVGKPKSEVAAEFINRRVAGVHVTPHFGKIQDFDNDFYMQFTLVVCGLDSIEARRW
    INATLVGLVGDSPETLKPLIDGGTEGFKGQSRVILPTITSCYECSLDMLTPQTTFPM
    CTIANTPRLPEHCIEWASVLEWP
    KHFDRKADNDDVEDVTWIFEQARARAEQFGIEGVTYQLTQGVIKNIIPAIASTNAIIAASSCNEAFKVATTCVPFLNNYM
    MYSGNNSVYTYTFQHQKRPDCPVCGVQVLRLAVPKSTTLENLIERLKENPATKVKNPSLRTASKSLYMASPKELEEMTRG
    NLVKLVGELVGEEEVTVTDEALPFSLRLVVDVE

    >gi|50555488|ref|XP_505152.1| YALI0F08195p [Yarrowia lipolytica]
    MSFRLATYLRTAKSLRPATLPAGARFYSFKAEDQPRIRIGSTAPNFSAQTTGGDIDFHNFIGDKWTVLFSHPADFTPVCT
    TELGAFAALKDEFTKRNAQLIALSADDLQSHKDWVQDIEDTSTSGKAFDFPIIADPERKVAFLYDMVDQQGFENINKGIA
    FTIRSVFIIDPNKKVRLFITYPASTGRNSSEILRVLDSLQLNDATGLVTPIDWEAGKDVIIPPSVKNEDAKKKYGDFKEL
    KPYLRFTKDPVN

    >gi|50556078|ref|XP_505447.1| YALI0F15191p [Yarrowia lipolytica]
    MLTTLKNIKKTSSFTARMAPDALFPTLQSVKEAPEELLRKDRYLKSGNFTWVYPEQRPEYKMLAVSPPAVHDIGLEAAEA
    TSDYFKDIVMGKKYVEDPFPYAQAYAGWQFGEWAGQLGDGRALSLFETHNPVTGKRYELQLKGSGLTPYSRFADGKAVLR
    SSIREFLGSEYVNALGIPTTRALSLAELPGTTARRGRGKEPCAVICRFAESWVRVGTFDLLRNRGDRPGVKQLADYVVDD
    VFGGEDKLLNNDHTRDAIAKSAIPYKHNNRYVKLYREIVTRNAYMCALWQVFGYLNGVVNSDNTSVYGLTIDYGPYAFMD
    AFDPNYTPNHDDGLLRYSYKNVPTAVWWNMVRLGEDLAELLGVAEGTDLENLTKSEKNELLDTAEAVITSAGEEYKAVFL
    YTYKKFISKRYGLLEQRDSDFDELMTPTLNMLEDSALDYHRFFRLLGDLPFFTGENASKSEPADFAPDVEQFISPEKNIN
    AIKTPSQTRTELSQFLADFKKRLAAENNTDDAARKVRSREINPKFVLRSWVMQEVVEDAHKGDYDKLERVLNMALHPFQE
    TWDEDWDDEEARFCGHVPKYCDSIQQT
    CSS

    >gi|50556582|ref|XP_505699.1| YALI0F21219p [Yarrowia lipolytica]
    MAFMQRSIFALRAATPAMRAPAFRIAPSMRRFISTETKDAIETAIGTAPVVLFMKGTPEFPQCGFSRATIQVLGHQGVDP
    QKFAAFNVLEDEELREGIKEFSQWPTIPQLYINKEFIGGCDIVMSMSQSGELAEMLQQQDLLAPEEEEHME

    >gi|50556770|ref|XP_505793.1| YALI0F23551p [Yarrowia lipolytica]
    MSKLISPAELAKRLSSKETKIFDATWYLPTPANVGKNAYDNYMKKRIPGALYFDIDAVNTPSKFPHMLPSPQTFENELTK
    LGVSSDSPIVVYDTQGVFSGPRLVWTFKVFGHDNVQFLNGFEAYTQLPGIPSRPDAYTWGIWDTQVPGKIDPADPPYKVT
    KARPELVKSFEDVLAIVEKHNGDGAKIRNEVTFIDARPNGRFTGKDAEPRAELSSGHVPGAYSIAFPEVVENGKFKSPEE
    LKALFASKGIDGSKPIISM
    CGSGVTACVIDLALEIAGIGSRDTNAVYDGSWTEWAQRAPTKYIVKEENLNEANRA

    >gi|50557140|ref|XP_505978.1| YALI0F28127p [Yarrowia lipolytica]
    MVSTRRTRVLILTAILFTVGLLIFAVHGPRYDLAVDPRSSSQKTVKTTDNNIDKEVLEVNEDEGVAHKSEKEKTEKIVKG
    EEKADLTTSQGEEFNPEKEYQSILKLAPVIVFSKSY
    CPHSQFVKDLLQKEYAITPDLQIVELDKHPSGPELQAYVKQKTG
    RGTVPNVIVAGKSLGGGDEMRALHKDGELAETFHEAGPKALTVVRRSPL

    >gi|50557214|ref|XP_506015.1| YALI0F29381p [Yarrowia lipolytica]
    MRCLLILLFLASVALASFYKNSPVVEAKGNLGPVLKSNKTSIVEFYAPWCGHCRNLLPEYVKASKGLRGLANVVAVDCDQ
    EINKPVCAQWKVQGFPTLKIFRPFNDPKTGKKMRPMVEDYKGPREAATIVKEVSGRIKNLTKRLSSVADLKSLMESTEED
    VHHILYLPATTKKLVQVPPVLKAIAIDFVDTAKVSFAPGKAVPDIVKHLQREYPSLSKLDTTKSQIVLLKKGYHPASSNK
    DMSHEGILKFVNQYVIIREGKNRNAPAKKTLKEFIVESDVPDLTTDNDSVDEEDEILTDAKDDIEVEIVEQVEEVTQEEA
    AAQPDTDTDDTEPEPLMADSPSDSDSDTDYDADTEEIEDEKPSKITPTPEQINLNGGPEHQKAQIQSIIDRYGGEEKHPR
    QASRIYSFAELRDACLKSDSPTCVIMSTSPYSFQTDLLTIHKAARHASDDTYKKVKFVYFVDITDELERLAEELGMGPYT
    YMKPPADAKGGKHHLHEGSYVLLDIHKNKVYKMPSSIVKNDGNIVNFATKGYKKVDGKKLPPRYRFEYSDRDEL

    >gi|50557224|ref|XP_506020.1| YALI0F29667p [Yarrowia lipolytica]
    MMFRRITPVARRVIARDASKHALGIRGRALRPIVNSITTRKVHSVSQLNSARVALAAVPHNFHTQLLKRRYSALSSECRE
    LTYPDIKALSDNILKGDNDNVILVDVREPDEFKAGHIPGAINIPVKSTPGALSLSAEEFEGTFGFPKPDINDELVFY
    CQA
    GIRSAKAESLAETCGYQLRANYPGSYNDWLAHQK