Xenopus Silurana tropicalis

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|301603638|ref|XP_002931500.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin domain-containing protein 12 [Xenopus (Silurana) tropicalis]
    MASAGEGRAVTYVEGRASSAHVDVSVINERCHLRYTYLKCKFXFICACRLGWLLRMRYLNAAGVAVLSVCLLLFLVPASA
    DTGLGRGFGDHIHWRTLEDGKKEAAAGGLPLMLVIHKTW
    CGACKGGKFPETFEELEWQGVCRIDDEEPKEEAFSPDGGYI
    PRILFLDPTGKVHPEIINSKGNPSYKYFYNSAEQVTESMKEAQEKLTGDSFMKPTDEL

    >gi|118404180|ref|NP_001072404.1| glutathione peroxidase 7 [Xenopus (Silurana) tropicalis]
    MYLTALVLLLLLPPSLQKSRDFYTFKVVNIRGKLVSLEKYRGSVTLVVNVASECGFTDSHYKALQQLQRDLGSYHFNVLA
    FPCNQFGQQEPNSDREIENFVRKNYSASFPMFSKTAVTGTGVNSAFKYLIESSGKEPDWNFWKYLVGPDGKVVDAWGPSV
    SVAEVRPHITSLVRKIILKRKEEL

    >gi|144925921|ref|NP_001006908.2| selenoprotein P [Xenopus (Silurana) tropicalis]
    MMHNLALTVSILMGLLGQVSSSEQTNSSICKPPPKWSIEGEVPMAEALGKVTVVALLQASCGFCLVQAARMGPLRYKLSL
    QGMTDIKYMIVNDQSLHSANMFPELKRWAPEGIPVYQQTPGQDDVWELLDGNKDDFLIYDRCGRLTFHVRLPLSFLHFPY
    VEAAILSTYNESFCGNCSFTSNSTLIPMNGTTVSPSGDDSSSPLQNKDEPVNKEPSPTLEKHNDQRKLDSELRLHDHSQH
    HPINSHKRQENQNNHPRNLIKNGKQN

    >gi|58331972|ref|NP_001011135.1| peroxiredoxin 1 [Xenopus (Silurana) tropicalis]
    MSSGNAKIGHPAPDFTAKAVMPDGQFKDLKVSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRVEEFKKLNCEVIGASGDS
    HFCHLAWISQPRKEGGLGKMNIPLVSDVQHTIAKDYGVFEEKEGVSFRGLFIIDEKGILRQITINDLPVGRSVDETLRLV
    QAFQFTDKYGEVCPAGWQPGSDTIKPDVKKSKEYFNKQK

    >gi|301604208|ref|XP_002931767.1| PREDICTED: apoptosis-inducing factor 3-like [Xenopus (Silurana) tropicalis]
    MGGCFSKPKPVEVKVEVVLPEKEREKEEMSPNGKASPLAYKANGTTRLYHHEERPIVLNPYTNPKDVVEASVCHVKDLEN
    GQMREVDLGCGKALLVKQNGEYYAMGHK
    CPHYGAPLVKGVLSKGRVRCPWHGACFNIATGDIEDFPGLDALPKFQVKIEK
    ERVYIRASKQSMDSQAEQIFLRSKEFFHTYDIEVLTESQVVGVDTKNKMVLFKDGFRMEYNKLLIATGNTPKTLKCKGKE
    LDNVFTIRTPEDANKVVRLASSKNAVIVGASFLGMEVAAYLCEKAHSVSVVELENIPFKKFLGEKVGLAIMKMFENNRVK
    FYMQTEVSELREQEGKLKEVVLKSGKVLRADVCVIGIGASPTTGFLKQSGVALDSRGYILVNKMMQTNIPGVFAAGDVVT
    FPLAFRNNKKVNVPHWQMAHMQGRIAALNMLAQGTEINTVPYLWTAMFGKSIRYAGHGDGFDDVIIQGDIDELKFVAFYT
    RNDEVIAVASMNYDPIVSKVAEIMSSGKTIRKRDVEIFVCHGKTGDISWLTGKGS

    >gi|194332465|ref|NP_001123737.1| ATPase, Cu++ transporting, alpha polypeptide [Xenopus (Silurana) tropicalis]
    METDSRAFLAFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANP
    QPVPMDSTFLRLSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLLIQKIPGLSLDSMASKKTTSGSVE
    SRSSVASDVLVKMKIEGMT
    CHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKP
    PQKLGAIDIERLTNTQTNSNGDLPQKIPKHQNDLIRAIFQIEGMH
    CKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFY
    SNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIE
    GLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLANTGQADAFTSEASQKPFLNSLLPKERTNKE
    TPVHSKPEKRTVNKCFIQITAYQMSALVS

    >gi|301604462|ref|XP_002931857.1| PREDICTED: magnesium transporter protein 1 [Xenopus (Silurana) tropicalis]
    MAGLKGLLFGGILLALCGGLSEGQKKKEMVLSEKVGQLMDWASKRPVIRMNGDKFRRLIKSPPRNYSVVVMFTALQAHRQ
    CVVCKQADEEYQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFIHFPPKGKPKKGDTYELQVRGFAAEQL
    ARWVADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNLDFLCNKTGWGLAALCFVLAMTSGQMWNHIRGPPYAH
    KNPHTNQVNYIHGSSQAQFVAETHIVLLFNGAVTLGMVLLHEAATSDLDVGKRKIMCIAGISLVVIFFSWLLSVFRSKYH
    GYPYSFLMT

    >gi|187607239|ref|NP_001120487.1| thioredoxin reductase 2 [Xenopus (Silurana) tropicalis]
    MKVGSVLRKAGLLGGIRHDYDLLVIGGGSGGLACAKQAAQFGKKVAVFDYVEPSPRGTKWGIGGTCVNVGCIPKKLMHQA
    ALIGSTLKDAPHYGWDTPNEIQHNWGKMAKAVQNYVKSLNWGHRIQLQDKKVKYFNMKASFVDEHCIRGVTKAGKETLVT
    AENIVIATGGRPKYPTHVPGALEYGITSDDLFWLKESPGKTLVVGASYVSLECAGFLTGIGLDTAAMVRSIPLRGFDQQM
    AYLVTDYMELHGTKFLWKCTPSNVEKLKNGKLEVTWKNTESGKEGADIYDTVMWAVGRAAETQYLNLEKVGVDVKSDTGK
    IIVNASEATSVPHIYAIGDITEGRPELTPTAIAAGKLLASRLFSGSAELMDYDSVPTTVFTPLEYGCVGISEEDAKERYG
    DDNIEVFHAFYKPLEFIVAERNGSQCYIKIICLRTQDQRILGLHFTGPNAGEVIQGFALGIKCGATYHQLMRTVGIHPTC
    AEEVTKLHITKRSGLDPTVTGC

    >gi|301604768|ref|XP_002932030.1| PREDICTED: protein disulfide-isomerase-like protein of the testis-like [Xenopus (Silurana) tropicalis]
    MGGEKELSWSLHQQHSALHLVQYVAKDAQADKGSKVKKHKPPKIKEENDVLVLTGSNFARALKENKYLLVKFCVRTASAF
    VTWLNRRMGPSSLYINSTDQYDSFVHSGEVTVVGFFKEPASKKEYFNEAAKDIPDFPFGLVSNDEIFSHVGITTNMVAVY
    KKDKPTNYLIPEEEIESKLDLVRLIRTYIMDVVTEYNLETQVTIFDVPVGSHILLFTSKTSQSFGTIYENFESAALEFRG
    KLVFILVDTDEPRNGRIFEYFRITEVDTPAVRILNLTSDVQYRMPADEVNFENLRRFCRSYLDGKAKPKRDSEEIPKDWD
    KNPVKLLVGKNFNHVAFDKTTHTFIMFYAPWSQE
    CKGLFPIWEELGRTYQNHKNLTIAKIDCTANDIQLMVLDRYPYFRY
    FPAGSDTKSIRYTGERTLSAFIEYLENEMKSTNTEKLDKESSGTRKTENEEKDGEKITKEEL

    >gi|47498026|ref|NP_998864.1| anterior gradient protein 1 [Xenopus (Silurana) tropicalis]
    MQTGLSLVCLVLLCSALGEAALRKTKKQAVVTDTGNSAKSDPEPVPIKTKGLKTLDRGWGEEIEWVQTYEEGLAKARENN
    KPLMVIHHLED
    CPYSIALKKAFVADRLAQKLAREDFIMLNLVHPVADENQAPDGHYVPRVIFVDPSLTVRSDLKGRYGNK
    MYAYDADDIPELVTNMKKAKSYLKTEL

    >gi|62858309|ref|NP_001016925.1| DnaJ (Hsp40) homolog, subfamily C, member 10 [Xenopus (Silurana) tropicalis]
    MHDIRAYPTTVVFNQSIIHEYDGHNNAEEILEFIEDLRNPSVVTLTPETFNSLVRRDEVWMVDFYAPWCGPCQALMPEWK
    RMARLLNGYISVGSVDCQKYNVFCSQERVNAFPEIRLYPVKTNSPYNF

    >gi|301605115|ref|XP_002932188.1| PREDICTED: putative thiosulfate sulfurtransferase YOR285W-like [Xenopus (Silurana) tropicalis]
    MSVLLSRICLSVRPLYGLRNSCTAAYRGYNTNRVHSSARSVARGFSSVPSQTIKYEELKDLLKEEGVVIIDVREPWEVKE
    YGVIKGSLSIPMGDLASALQLDPLTFEKKYQVKMPEKTSTLIFS
    CLAGIRSKKAVDVAGSLGFKRVHHYAGGFEDWARHE
    TPEKKL

    >gi|62860152|ref|NP_001016637.1| glutaredoxin 2 [Xenopus (Silurana) tropicalis]
    MGISSTKEVSETEATDIIKNTIAENCVVIFSKTTCPYCVMAKEAFKNIDVQYTAVELDELENGRQMQVALQQLSGIRTVP
    QVYVNGKCIGGGTDTRNLEREGKLLKLVQECNLSAAT

    >gi|45361505|ref|NP_989329.1| protein disulfide isomerase family A, member 3 [Xenopus (Silurana) tropicalis]
    MNRQLLGAFFLLAVTAGTQAAGSDVLDLTDDNFESTVSQHSILLVEFFAPWCGHCKKLAPEYEIAATKLKGTLSLAKVDC
    TANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIVSTMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYS
    GPHSEFLKAANTLRDNYRFAHTDEKELVDKYDSNGEGFVLFRPQHLANKFEDSSVTFPADEKITSSKIKKFIQDNIFGLC
    PHLTEDNKDLIQGKDLLVAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVANRKAFGHEVTEFGLDAGTGELP
    VVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRYMKSEAIPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAP
    W
    CGHCKNLEPKYKELGEKLGDDPNIVIAKMDATANDVPSQYEVRGFPTIYFTPAGSKQKPKRYEGGREVSDFLSYLKKEA
    TNPPVVKEDEKPKKKKKKEEL

    >gi|62857571|ref|NP_001017209.1| glutaredoxin-3 [Xenopus (Silurana) tropicalis]
    MAAVLEAGSAGQFEQLIQNSAKSLTVVHFWAPWAPQCTQMNEVMAELAKEQPQVMFVKLEAEAVPEVSEKYEVTSVPTFL
    FFKNSQKIDRLDGAHAPELTKRVQRHASSTSFPATPNSAPKEDLNGRLKKLINAAPCMLFMKGSPQEPR
    CGFSRQIVALL
    NDQKVQFSSFDILSDEEVRQGLKTFSNWPTYPQFYVKGELVGGLDIVKEMVASGELDQMCPKAQSLEERLKALVNKAPVM
    LFMKGNKEMAK
    CGFSRQILEIMNNTGVTYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIIKELKESGELVS
    VLKGDQ

    >gi|58332656|ref|NP_001011404.1| O-6-methylguanine-DNA methyltransferase [Xenopus (Silurana) tropicalis]
    MEEALISCALGKIQISACEKGIHEIKLQEDAVPESRTKGASVSFEIVEGPREMIEPLKQCTAWLRAYFCEPRLTEKLPVP
    AFHHPTFAKDSFTKAVLMALLQKVKFGETVSYKELAVMAGNEKAVRAVGGAMRNNPVPILIP
    CHRVICSNGSVGNYIGGK
    GNQLKPWLLAHEKLLKEM

    >gi|45361217|ref|NP_989186.1| thioredoxin domain containing 5 [Xenopus (Silurana) tropicalis]
    MLRFPSALLLCAVLARVSGEPWEEGADEDPHKKNLYTADMFDHAIKQEPHFIMFFAPWCGHCQRLQPTWNELGDKYNRMS
    KTPAYIAKVDCTTDMPTCTEHGVRGYPTLKLFRPGQEAVKYQGPRDLQSLENWMLQTLNDEPEKPKVEEKVEEPAKVPEL
    KQGLYELTAANFKEHIAEGNHFIKFFAPW
    CGHCKALAPAWEQLAATFQDSNSIKIAKVDCTQHNGLCSDNQVRGYPTLLW
    FRNGEKVDQYKGKRDLDSLKEYAESQLKPAEEKKEEEQKEDATPPQVEKPVAVESKVLSLSESNFDQTVATGVSFIKFYA
    PW
    CGHCKNLVPIWEDLSKKEFSGMSDVKIAKVDCTAERALCNRFSVRGYPTLLLFRAGEKIGEHEGARDLETLQNFVLRH
    SRDEL

    >gi|301607119|ref|XP_002933161.1| PREDICTED: dihydrolipoyl dehydrogenase, mitochondrial-like [Xenopus (Silurana) tropicalis]
    MVALKIEIATCIATFNRWLQHPKHLIHLVFSSGGYRVSRKEILGKKNHFSRIPHGLQRISFAAWRNYSEKALEADVTVVG
    SGPGGYVAAIKAAQLGFQTVCVEKNDTLGGT
    CLNVGCIPSKALLNNSHLYHLAHGKDFASRGIEVTGIRLNLEKMMEQKS
    GAVKSLTTGIAHLFKQNKVVHVQGFGRITGKNQVTATKADGSTQVINTKNILIATGSEVAPFSGIPIDEETIVSSTGALS
    LKQVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGLGIDMEISKNFQRILQKQGLKFKLNTKVTGATKRPDGK
    IDVSIEAAAGGKEEVITCDVLLVCIGRRPYTENLGLQELGIELDSRGRIPINSRFQTKMPNIYAIGDVVAGPMLAHKAED
    EGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGTEYKVGKFPFAANSRAKTNADTDGLVKILSHKSTD
    RMLGAHILGAGAGEMINEAALAMEYGASCEDVARVCHAHPTVSEAFREANLAASFGKAINF

    >gi|301607164|ref|XP_002933187.1| PREDICTED: selenoprotein O-like [Xenopus (Silurana) tropicalis]
    MIQDGFLHICFWVVLCPLYIGLKADLLMDEVGSPTVYMNSTSGTLGFCERRRKVYSVDQWRLSTEDILDELPVDPNRNNY
    VRRVQECIFSYVSPTPFTSDVRLVAVSEDALENLLDLAISVGETDAFLQFVSGRDGFTDWGPLAHRYGGHQFGVWAGQLG
    DGRAHLIGTYINRFGERWELQLKGSGRTPYSRGGDGRAVLRSSVREFLCSEAMHYLGIPTSRAARKLVDFIITNYFPSIN
    SKAPNRTLTFFSIVVSETANLIASWMSVGFAHGVCNTDNFSLLSITIDYGPFGFMESYDADYVPNTSDDEGRYSIGNQAN
    VAMFNLNKLRLALNPLLDSKQQQQASQVLRGFPDLYYKRFTELFRAKLGILGENDQDLALISSFLDLMASTRADFIMSFR
    QLSEISQDQLRSLSIPQEYWALQDIGQQKQFLAWIDAYILRLKRNPEDTDEKRRRRMMLINPRYVLRNWMAESAVRKAES
    NDFSEVHLLQKTLCQPFHTQKMAEEAGYSQRTPAWAKHLKVS
    CSS

    >gi|62859521|ref|NP_001015905.1| methionine sulfoxide reductase B2 [Xenopus (Silurana) tropicalis]
    MSRLLTGFRLLLRVREISFPSVTAQRLQAWSRVRMAQTGADLGSLTRYDDSAVSTDWQKKLTPEQYYVTREKGTELPFSG
    IYLNNTEKGMYHCVCCSAPLFSSEKKYNSGTGWPSFSEAYGAQGADESNTNVLRRLDNSLGSTGTEVICKECDAHLGHVF
    EDGPPPYGQRF
    CINSVALTFAPSSM

    >gi|55741898|ref|NP_001006909.1| anterior gradient protein 3 precursor [Xenopus (Silurana) tropicalis]
    MSVRKEIRAPQTLSRGWGDDISWVQTYEEGLYNAKKRNKPLMVIHHLEDCQYCQALKKVFAESDEAQTLAQEQFIMLNLM
    HETTDKNLSPDGQYVPRIMFIDPTLTVRADITGRYSNRRYTYEPQDLPLLIENMNKAIHLLQTEL

    >gi|62860100|ref|NP_001016627.1| anterior gradient protein 2 [Xenopus (Silurana) tropicalis]
    METVLKTLFVLLVATSLTLAKDLPQATRVLQTLSRGWGDNLEWVQTYEEGLYKAKTENKPLILINHRNDCPHSLALKKAF
    AEHQGIQKLAEEFVLLNVVYDPTDKNLQLDGQYVPKVVFVDPSLVVRADLPGKYSNHQYTYEPADIDLLFENMKKALILL
    KTEL

    >gi|62857883|ref|NP_001016597.1| glutaredoxin (thioltransferase) [Xenopus (Silurana) tropicalis]
    MAQSFVQSKLKPSKVTMFEKPTCPFCVRAKGVLTKYNFKDGHLEIIDICKLDFMSSLQQYFKQSTGESTVPRIYIGEKCI
    GGCSDLVPLENSGELEKALQSIGALSD

    >gi|301608139|ref|XP_002933632.1| PREDICTED: peptide methionine sulfoxide reductase [Xenopus (Silurana) tropicalis]
    MKVLCKRGQEYCHEYSRLGPPPKGPTEPAEDPFMVATSPLLVPRRFLFYLLSNTYLHMGDMSSKTQLPSKEGALPGRSEK
    MRVSAKHHVSGNSMVEPFPEGTQMAIFGMG
    CFWGAERKFWRQKGVFSTQVGYSGGYTTNPLYEEVCSGRTGHAEVVRVVY
    EPGTISFEKLLKVFWENHDPTQGMRQGNDVGTMYRSAIYTYTKEQAEAALKSREDFQKELTAHGYGQITTEISEAKNFYY
    AEDYHQQYLSKIPNGYCGMGGTGVTCPIGVK

    >gi|55742316|ref|NP_001006812.1| peroxiredoxin 4 [Xenopus (Silurana) tropicalis]
    MAVLLRHYLRGSPVLGLCLLLLSAAAVTCEPQEEKEQPQGRPGRAAPDGECHFYAGGQVYPGEATRVPVSDHSLHLSKAK
    ISKPAPYWEGTAVINGEFKELKLTDYKGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWI
    NTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDT
    HGEVCPAGWKPGSETIIPDPAGKLKYFHKQH

    >gi|301608478|ref|XP_002933816.1| PREDICTED: phosducin-like [Xenopus (Silurana) tropicalis]
    MPLFLVESILKRFSRLFCLYLHTGPKGVIHDWRKFKLISEDQESIPPNKKEILRQMSSPYKPPIKDEKDTKEKLSRKMSM
    QEYELINDKEDEHCLKKYRKQCMHDMHQRLSFGPKYGYLVELKSGDEFLEAIEKESKTTTVIVHIFADDIKG
    CEALNNCL
    TCLALEYPTVKFCKIKAADTGAGERFSSEVLPTLLVYKAGELISNFISVTENLNDEFFAVDVESFLNEYGLLPERDAQGT
    VVDNGEGDIE

    >gi|147903278|ref|NP_001090691.1| hypothetical protein LOC100036669 [Xenopus (Silurana) tropicalis]
    MFDLSDQLIAMGLWSISIGAFGAAVAGILLANTDLFLTQTEEATLDYLEETELKAIGDEPKSFKAKDLWEKNGAVVMAVR
    RPG
    CFLCREEASDLSSLKSQLDQLGVPLYAVVKENIGNEVEQFQPYFNGKIFLDEKGKFYGPQKRKMMFLGLVRLGVWQN
    FRRAWKGGFEGNLEGEGLILGGMFVIGSGKQGILLEHREKEFGDKANLTAVLDAARKINKQRAQNDN

    >gi|45360853|ref|NP_989102.1| peroxiredoxin 6 [Xenopus (Silurana) tropicalis]
    MPGLLLGEIFPDFEADTTIGRIKFHEFLGGSWGVLFSHPRDYTPVCTTELGRCVKLAPEFKKRNVRMIALSIDSVEDHLG
    WSKDINSYNCDEPTETLPFPIIADPKRDLAVKLGMLDPDEKDMQGMPVTARCVFIIGPDKKMKLSILYPATTGRNFDEIL
    RVVDSLQLTAVHNVATPVDWKPGDRVMVPPNVPEEEASKLYPSGVFNKALPSRKNYLRYTAHPQ

    >gi|284447306|ref|NP_001165182.1| 15 kDa selenoprotein [Xenopus (Silurana) tropicalis]
    MAAERMLLWLVTVLQALSSYGAELSSEACRDLGFSSNLLCTSCELLGQFGLNEINLFCRQCCQEEVHLESKKRYPGAVLE
    VCG
    CKLGRFPQVQAFVRSEKPKLFKGLQIKYVRGSDPVLKLLDENGNISEELSILKWNTDSVEEFLSEKLDRL

    >gi|54020801|ref|NP_001005646.1| mercaptopyruvate sulfurtransferase [Xenopus (Silurana) tropicalis]
    MTHQLLPRALVSPRWLWDTLRNGSALSGTLRVLDASWHLPKSGRDGWREYKERHIPGSYFFDIDACSDRTSPYDHMLPTA
    DQFSEYTGRLGISNNSHIVVYDASDFGSYSAPRVWWMFRIFGHPQVSVLDGGLKAWLREGLAVNSGKEPRPQPAEFHTQF
    NSSLVVGHEDMVENIEKKKFQMVDARVEGRFRGLEPEPREGIEPGHISGAVNVPFPSFLTAEGYEKSPDEIRRLFHDKGV
    DLSKPTVAT
    CGSGVTACHVALASFLCGKEDVSIYDGSWVEWYMRAKPEDVISEGRGKTL

    >gi|156717932|ref|NP_001096508.1| thiosulfate sulfurtransferase [Xenopus (Silurana) tropicalis]
    MAQQLLSRALVSASWLSAALKESQAGAALRVLDASFYYPAIRDGRKEYAEKHIPGALYFDIDECKDKSSPYEVMLPSEAD
    FAKYVGKLGINNESHVVVYDADHLGMYYAPRAWWMFKVFGHHKVSVLDGGFRNWLSQGLQVTAEVPKVEPETYKAVLNSS
    RVKTYEDILRNMDSKEFQLVDSRSEGRFQGTEPEPGEGIYPGHIPGSSNLPFTSFLTEEGYEKSPDEIRNLFQLKGIDLN
    KPLTIT
    CRRGVTACQLVMASYILGKEDTAVYDGSWFEWFHRAQPEHKISEWKNQ

    >gi|284172423|ref|NP_001165078.1| selenoprotein M precursor [Xenopus (Silurana) tropicalis]
    MWRPLLLLGLLQPILGYQIDWNKLDRIARGKVESCGGCQLNRLKEVKAFVTDDLPLYHNLEMKHIPGADPELVLITSKYE
    ELERIPLRDMKRSEIIQLLKDLGFYRKSSPDALVPAEFKMAPARASGDKKEDL

    >gi|213983023|ref|NP_001135672.1| nucleoredoxin [Xenopus (Silurana) tropicalis]
    MSGPGLLVELLGEKLMNSEREEVDVQALGSRVSLIGLLFGCGMSAPCLQLLPGLSDFYCKTRDRLEIVFVSSDPDQKKWQ
    LFLKDMPWLALPYQEKHRKLKLWNKFRISNIPSLIFIEASTGKTVCRNGLLLVRDDPEGLEFPWGPKPFCEVIAGPLIRN
    NGQSQESSTLDGSYVGVYFSAHW
    CPPCRSLTRVLVESYRKIKESGQKFEIVLVSADRSEESFKQYFSEMPWLAVPYSDEA
    RRSRLNRLYGIQGIPNLIILDPKGEVITRQGRVEVLHDVDCKEFPWHPKPVVELTELNAVQLNEGPCLVLFVDSEDEGES
    EAAKQLIQPIAEKIIAQYKAKDEDAPLLFFVAGEDDMTDSLRDFTNLPEAAPLLTILDMSARAKYVMDVEEITPEIVESF
    VSDFLAEKLKPEPI

    >gi|55742505|ref|NP_001006844.1| thioredoxin-like 1 [Xenopus (Silurana) tropicalis]
    MVGVKVIGADGEFQGDLTAAGSRLSVVKFTMKGCAPCVRIAPAFTSLSNKYPQAIFLEVDVHQCQATATANNISATPTFL
    FFRNKVKIDQYQGADAAGLEDKIKQHLENDPGNNEDADIPRGYMDLLPFVHKAGCECLNESDDHGFENCLRKDPTYLESD
    CDEQLLMTVAFSQPVKLYSMKLQGPDNGQGPKYVKIFINLPRSMDFDEAMRSEPTQAVELSADDIKEDSIVPLRYVKFQN
    VNSVTLFVQSNQGDEEATRITYLTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|58332616|ref|NP_001011382.1| phosducin-like 3 [Xenopus (Silurana) tropicalis]
    MQDPNADTEWNDILRRKGILPPKEKPQDEEEEEAEILQQQSVVKTYEDMTLEELEDNEDEFNEEDERAIELYRQQRMAQW
    QATQIKNKFGEVLEISGQDYVQEITKAGKDLWVILHLYKQGIPL
    CSLINKHLTALARKFKDVKFVKSISTTCIPNYPDKN
    LPTIFVYVDGEIRAQFIGPLVFGGMNLTQDELEWKLAESGAVKTDLEENPKKQIQDHLMTSIRVSIPTKKDSDSEDD

    >gi|166795959|ref|NP_001107730.1| methionine sulfoxide reductase A [Xenopus (Silurana) tropicalis]
    MLGNIRFPTAQEALPGRSDALQVADKHMVNGNSTLEPFPDGLEIAVFGMGCFWGAERLFWKQEGVYSTQVGFAGGHTPNP
    TYKEVRTGLTAHAEVVRVVFDPKVITYKVLLKLFWENHDPTEGMKQGEDVGTQYRSVIFTYGENQKDAALLSREAFQKEL
    NAHGLGITTTEIRAAPTFYYAEDYHQQYLHKNPEGFCGLRRTGATCH

    >gi|301610364|ref|XP_002934712.1| PREDICTED: tumor suppressor candidate 3-like [Xenopus (Silurana) tropicalis]
    MQSARMMARDKKVSVQRWLIVPSLLILSLCLQSGGGQKKKENLLSEKVEQMMEWSSRRSVIRMNGDKFRRFVKAPPRNYS
    VIVMFTALQPQRQ
    CSVCRQANEEYQVLANSWRYSSAFSNKLFFTIVDYDEGADVFQQLNMNSAPTFMHFPAKGKPKRADT
    FDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMAALCVVFAMTSG
    QMWNHIRGPPYAHKNPQNGQVSYIHGSSQAQFVAESHIILLLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFF
    FSFLLSIFRSKYHGYPYSFLIK

    >gi|56118761|ref|NP_001008161.1| thioredoxin 2 [Xenopus (Silurana) tropicalis]
    MAQRLFLKRVVVPSVKSLIAPAPSLSTCLSNGIRSHGLKTLTSSRLHPHCNLRPISTSTPCRVTFNVQDADDFQERVVGS
    ETPVVVDFHAQW
    CGPCKILAPRLEKVVAKQQGKVVMAKVDIDDHTDLALEFEVSAVPTVLAIKNGDVVDKFVGLKDEDQL
    DAFLKKLIGP

    >gi|62857489|ref|NP_001017196.1| interferon, gamma-inducible protein 30 [Xenopus (Silurana) tropicalis]
    MRCYLLLLCAVGAASQPVCNHPPSTWCSSWEIAKECQVEKQCLEFYSNRDLKKSSEPAIQIDLFYESLCGGCRGFLVRQL
    FPSWLMLAEIINVTLVPYGNAQETNITGKWVFDCQHGPEECLGNMMEACLIHILDDIYKYFPIIFCMESSNNVTKSLESC
    LAVYAPELPLKTVLECVNGDLGNKLMHENAQKTKGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFNLVCDTYKGPKPEPC
    LHSEITPLKRDVLCLN

    >gi|301610979|ref|XP_002935018.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial [Xenopus (Silurana) tropicalis]
    MSASVVRATIRAVSKRKLQPTRAALTLTPAAVNKVKKLLQDKPDNIGLKVAVRTRGCNGLSYYLEYAKSKGPSDEEVVQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

    >gi|189230362|ref|NP_001121505.1| quiescin Q6 sulfhydryl oxidase 2 [Xenopus (Silurana) tropicalis]
    MAVGGLLFRSVLAVLVLFGSVGAEALYGPADPLSILNKESVTRAVFNSSSAWLLEFYSSWCGHCINYAPTWRALARDVSD
    WDPAIKIGVLDCAEEDNYGTCKDFGVTLYPTFRFFKAFTTEFTQGENYKAGNDREIQTVRQVIIDFLQTSPAQSKPQACP
    TLEPISSSEISSLLTQKQSHYTAIIFESEESYVGREVMLDLIRYSNMVVRRALPSDKAILEKLGIGSVPSCYLIQPNGSH
    GLIKEVKCLRAQLSSHLKALPNVRKRLPSDTAHSGLNKDAQQGDVAMKEFDRSKLYMADLESGLHYVLRAELANHRTLEG
    EKLKTFKDFVTILYKLFPGRPHVMKLLETLQEWLVSMPLDKIPYDAILDLVNNRMRISGIFLTNHTQWVGCRGSKSHLRG
    YPCSLWKLFHSLTVQASVKPDALANTALGADPQAVLQTMRSYIREFFG
    CRECAKHFEAMAKETMDSVRTPDQAVLWLWRK
    HNAVNNRLSGAPSEDPKFPKVQWPTSDLCSACHGQTGGGTQSWNENEVLSFLKRYYGKQEISLEFADHRTEQSEAADGHG
    NKEPLPTKKPEEGEDLKKNQGPQFLDKLIPNKPEKSVGSEAADTRQSVSFLGIGFSNIDMSLCVILYLTSSLFLMVMYFF
    FRFRSKRWKVRYSRPFV

    >gi|55742368|ref|NP_001006902.1| selenide, water dikinase 1 [Xenopus (Silurana) tropicalis]
    MSVRESFNPESYELDKSFRLTRFAELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKLTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWVVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGSCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVASQNVNPTPGATS

    >gi|301612050|ref|XP_002935550.1| PREDICTED: prostaglandin E synthase 2 [Xenopus (Silurana) tropicalis]
    MAAYTAGLFGASTRRLVLPQRLTGVVMGAAQTGRCLSFPSVSGGGSLIVSGLGARAHMSLGTRSHLPLYRAVGKSNLPLV
    GPTCPVVRGFRAGGWWKDSDRRTRKLLGLAFVLGGSLGVFQALQSSLGEQRAEEEQQATDGTLKLTLYQYKT
    CPFCSKVR
    AFLDFYQLPHEIVEVNPVMRREIKFSSYRKVPILIADSSSSLQLNDSSVIISVIKTFLTSKKSLEEILSYYPSMKAANDQ
    GKEVIEYNNKYWLMLDERETKQVYPTKESRVEEMKWRRWADDWLVHLISPNVYRTPHEALASFDYIVREGNFGPVEGLFA
    KYVGAVAMYIIGKRLKSRHHLQDDVRQDLYAAANDWVAAVGKHRKFMGGSQPNLADLAVYGVMRVMEGLESFDDMMTNTK
    IKPWYERMTTAVYSPVDSQ

    >gi|62859101|ref|NP_001017091.1| SUMO-activating enzyme subunit 2 [Xenopus (Silurana) tropicalis]
    MAMIGALPKELAEAVSTSRLLVVGAGGIGCELLKNLVLTGFINLDVIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESV
    LQFCPEANITAYHDSIMNPDYNVEFFKQFTMVMNALDNNAARNHVNRMCLAAGIPLIESGTAGYLGQVTVVKKGVTECYE
    CQPKPTQKTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVAPDIADPEAAWDPTQAAERANASNVDGDIKRVST
    KQWAKSTGYDPIKLFNKLFRDDIKYLLTMDRLWRKRKPPVPLEWSSLHNKENCSETQNESSLQGLKDQKVLDVTSCAQLF
    SKSVETLREQLREKGNGAELVWDKDDPPAMDFVTAAANLRMHIFSMNMKSRFDVKSMAGNIIPAIATTNAVISGLIVLEG
    LKILSGNTEQCRTVFLNKQPNPRKKLLVPCSLDPPNPSCYVCAIKPEVTVKLNVHKVTVQMLQDKILKEKFAMVAPDVQI
    EDGKGTILISSEAGETDANNNRKISEFGIRNSSQLQADDFLQDYTLMINILHSDEMEKDVDFEVVGDVPEKGPQKPSEQS
    VKNITNGSDDGAQPSTSKAQDQDDVLIVDSDEESPSSSNADINMDSASLKRKLPEEETISSTKRKRLEPPVEEDDDIIAL
    D

    >gi|148224381|ref|NP_001090843.1| ERO1-like [Xenopus (Silurana) tropicalis]
    MEVNRVVPVLVVMMIISLCPSTEDTETTEREAKKESRAVSEQSCGCHLTGVLDDCFCDVESIDAFNNYKIFPKLKKLQER
    DYFRYYKVNLKRPCPFWAEDGH
    CSIKDCHVEPCPESKVPLGIKAGNYNKYSLEANSEKDIDACEQATKLGAINSTLSNQS
    KEAFIDWARYDDAQDHFCELDDERSPDVQYVDLLLNPERYTGYKGPSAWRVWNSIYEENCFKPRSVYRPLNPLAPSISGD
    TGESFYEWLEGLCLEKRVFYRLISGLHASINLHLSAKYLLEDNWGNPRWGPNTKEFTHRFHPAYTKGEGPRRLKNLYFLY
    LIELRALSKVASYFERSVVDLYTGNLEEDVETKNLLLSIFIDAKSFPMHFDEKSMFAGNKKEARSLKEEFRLHFKNISRI
    MDCVGCDKCRLWGKLQTQGLGTALKILFSEKEIQSLPENSPSKGFQLTRQEIVALINAFGRLSTSIKELQSFKYLLHDHR


    >gi|301612752|ref|XP_002935865.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like [Xenopus (Silurana) tropicalis]
    MDGIDSQITCTGSSVDKLPHLKGNEVKSYSLPESHGADEILPELNKSSLTNPDILRYSRQLVLPEFGVQGQLNLSKVSVL
    VIGCGGLGCPVAQYLAASGIGRLGLLDYDVVEMSNLHRQVLHGENRLGMPKSVSIVKTLQKLNSSVIYLPYHMSLNPENG
    LQIIRQYDIIADCSDNVPTRYLVNDACVLAGKPLVSASALRWEGQLTVYNYQQGPCYRCLFPKPPPSETVTN
    CADGGVLG
    IVPGIIGSLQALEVLKIASGMVPSYSGVLLMFDALEGRFRNIKIRGKQNDCAACSNSAETAILQDYEAFCGSSASDKCRM
    LSLLSRDERLSVEEYKRLLDDHIPHILIDVRPQPEVDICQLPHSIHIPLKGLEQKNEKWISFLRTKIAELINTGNRVEKT
    VITICKLGNDSQIAVKILQEIFGNEVDLFVVKDVQGGLMAWAEKIDPMFPRY

    >gi|58332266|ref|NP_001011281.1| protein disulfide isomerase A2 [Xenopus (Silurana) tropicalis]
    MRWLTALQLCLLCTFYTVALGQNATSEEPTKNSSEEETSDELLEEDNVLVLNKKNFDKALETYKYLLVEFYAPWCGHCQE
    LAPKYAKAAEILKDKSEEVRLAKVDATVESELSMEFNVNGYPTLKFFKGGNRTGHIDYGGKRDQDGLVKWMLRRLGPAAI
    VLDKVESAEKFTSSQESPVIGFFKNPEDADIKIFYEAAELNEDFTFALAHDAKLFEKFGVTEDTVIFFKNSEEKPEFKVD
    EDLGLDKDELSKFLKINNIDLVTEYSAETSDKIFAAQIPNHLLLFINKTEDSQLALLEHFRKAATHFKGKILFVFIDSDG
    GFSSVLEYFGLKSSDVPTLRFINLESVKKYAFDAPEITEDTIQTFCRTVLEGNVKQNLMSEEIPADWDKNPVKVLVGKNF
    EEVAYDESKSVFVEFYAPW
    CSHCKELEPVWEELGEKYKDHESVIIAKMDATANEIDGLRVRGFPNLRFFPAGPGRKMIEY
    TKERTVELFSAFIDSGGVLPEEQVEKDAEAEESKEVAEEDKGKDEL

    >gi|301612794|ref|XP_002935903.1| PREDICTED: FAD-linked sulfhydryl oxidase ALR-like [Xenopus (Silurana) tropicalis]
    MAAPSDKQTAQSLTGFPFKIPAVKQDGKAESAAVGGEGGTAAPKKPCRACMDFKSWMRQQRRQGAAPQEAEIEDKERPAE
    CPLDREELGRSSWSFLHTMAAYYPDQPTNQQQQEMRSFINLFSKFYP
    CDECAEDMRERLDSTQPDTSSRHNLSQWMCILH
    NDVNRKLGKEAFDCSKVDERWRDGWKDGSCD

    >gi|261399890|ref|NP_001004972.2| selenoprotein X, 1 [Xenopus (Silurana) tropicalis]
    MSFCSFFGGEVYKDHFKSGIYVCSECNYELFSSRSKYQHSSPWPAFTETVHKDSISKYLERPNAYKVSCGKCGNGLGHEF
    INDGPKKGQSRF
    CIFSSSLKFIPKDKVDGEVQRE

    >gi|301612894|ref|XP_002935943.1| PREDICTED: thioredoxin domain-containing protein 15 [Xenopus (Silurana) tropicalis]
    MRVNVQLWLLYFLLFMSWARGNQQNENSVVEGDNKKEDTVRLEPAPSSENAAASEPVQYKTAEIADAMQATDIPTNPAVL
    LSMVPREVMDFKVTEVCDSIKDKAACSYYKHLAFVNEPTDAQDKAKSETNEQGTEQAKTAEANSTDSSKALKVNCEERNI
    TGISNFTVKILNITQDLMEFLNPNSSECTLVLFYTPW
    CRFSAGLAPHFNTLPRAFPTLHFLALDASQHSSLSTRFGTVAV
    PNILLFQGAKPMARFNHTDRKLEALKSFIFNQSGIEAVPGVVVTEDDCESPLPCAPTVGIDWLLVFSVIYVTIFIVYATM
    QTESIRWLIPGQEHEHQE

    >gi|52345746|ref|NP_001004919.1| glutaredoxin 5 [Xenopus (Silurana) tropicalis]
    MSWCLSKVSAAVLRGSARTQQVCVSLSARRWLSSDSGKPEHVDGLVKKDKVVVFIKGTPAQPMCGFSNAVVQILRMHGVQ
    DYAAYNVLEDQDLRQGIKNYSNWPTIPQVYFNGEFVGGCDILLQMHQNGDLVEELNKLGIRSALLDAEPSQEKK

    >gi|301614039|ref|XP_002936509.1| PREDICTED: ubiquitin-like modifier-activating enzyme 6-like [Xenopus (Silurana) tropicalis]
    MAAESTEIDDGLYSRQRYVLGDTAMQKMAQSHVFLSGIGGLGVEIAKNIVLAGIKALTIHDNRKCEMWDLGTNFFIKEDD
    VKNKKNRAETCLPHIAELNPYVHVESSTVPLDDLSFLKHYQCVILTETRLSLRKKICNFCHAQQPPIKFISSEAFGICAY
    LFCDFGNEFEVTDTTGEEPKEIFISNITQSTPGVVTCFENRPHKLENGQFVTFREVNGMTSLNGSRHQITVISPYSFSIG
    DTAHMEPYQHGGIAVQIKMFKTFSFETLEMQLENPTYLTVDFSKPEAPLNIHTAMLALDYFQEKHNRLPNIGCLLDAEEM
    QKLARSVTEVLKNKPLLDENLVKWLSWTAQGLLTPLAAAIGGIVSQEVLKAVTGKFSPLQQWLFIDALDIVHSLETANRD
    EFLPRGDRYDALRACIGDTFCKKIHNINVFLVGCGAIGCEMLKNFALLGAGSGSERGLITVTDPDLIEKSNLNRQFLFRP
    KHIQKPKSYTASAATLNINPQLKIDPRLDKVCPATENIFDDEFCTRQDIIVTALDNVEARRYIDSRSVSNLRPLLDSGTM
    GTKGHTEVVIPHLTESYNSYRDPLDEEIPF
    CTLKSFPATIEHTIQWARDKFESSFSHKPSLYNKFWQTHSSAQHVLQRIQ
    CGDSLEGCFHVVKLLNRKPRNWTQCLELARHKFEKYFRHKAQQLLHSFPLDTQLKDGTLFWQSPKRPPTPVHFDAKDQLH
    LSFIVSTAKLLAEVHSIPLTEKDVSKEAIIKIISEMPIKEFTPSNKIVETDETVKKPDQIPVSSEDERTAVSQLEKAIAD
    GHVSKSTAAVSGLVALELIKVVGGHPFEVYRNCFFNLAIPIIVFTEAAEVRRTNIRNGISFTIWDRWTIYGKEDFTLLDF
    INAVKEQYGIEPTMVIQGVKMLYVPVMPGHAKRLKLTMQKLVKPGISRKYVDLTVSFAPERDEEEDLPGPPVRYYFSQED
    N

    >gi|62858121|ref|NP_001016906.1| thioredoxin domain containing 1 [Xenopus (Silurana) tropicalis]
    MTRLLFLCLGLILCSSEVLAKKGDVIDITDSNWNEVLEGEWMIKFYAPWCPACHKLQPEWNELADWGEDLNVNIAKVDVT
    AQPGLSGRFIITALPTIYHCKDGVFRKYQGSRTHKDFINFISEREWEAIEPVSSWVGPDSFLMSGMSALFQLSMWIRQCH
    NYFVEDLAIPVWGSYIIFGLMTLFLGLMLGLILVFVADFLCPSKRHRPQGYQYPKNLPTVPADRKELEDELKEEVNEFEN
    TKLGDKEARDAPQDKLRKRTAKS

    >gi|301614534|ref|XP_002936743.1| PREDICTED: hypothetical protein LOC100487674 [Xenopus (Silurana) tropicalis]
    MEIQRTKTLKYAHEETDSFSFFFCQSKRILRLPSSLAGGRYGYSTQPEDSRPISRFPIPYKKDLPYDIVELMEEVENKSG
    FLPNVFKAMAHRPDEFRAFFAYYDVLLNKESGNLSKADKELIIVATSANNRCPY
    CVTAHGALHRIYSKNNRLADQVVVNW
    NLADLSQRECAMLEFALAIANAENITENHFTKLEVHGFDREDAWDIAMITAYFAMANRIAHLMDLRPNQEFYSLGRIPRV
    KSEESKT

    >gi|301614600|ref|XP_002936778.1| PREDICTED: copper-transporting ATPase 2-like [Xenopus (Silurana) tropicalis]
    MKDNVERNLGRRSVVGYLDKKDIALTSFRQLRDEAPSPLCVAQNSMDPFERDGNKKVIKMTAASGDMGSSNAQTFSDSPV
    SVWKEAKKPSCAFDNRGYEGSPDDLCSLPDDVGSVVVAIQGMTCQSCVQSIEGRISKVSGVVGINVCLEQNNAIVNYLQT
    EITPHKICEEIEDMGFDASLSEQSGMPSSVKSSYYGDNVIKIRVEGMTCQSCVNTIEGKIGKIQGVQKIKVSLTGQEAVI
    TYQSHIIQAEDLRKYIEDMGFEASIKNKPDPTKLGTIDIERLQNSIAENHSGHTNSNTVTLGIDGMHCKSCVHNIEGYVS
    GLAGIQSIRVSLKNKNAVVCLSQGSTSLLSLKESIENLPPGKFKVTLPVGVEKGQSLARNSTHSSHRDQSMGGNIAIISI
    GGMTCQSCVSSIENMISQRKGVLHILVSLDEGNGNIFYNPCETNAEELRAAIEDMGFHSTLVSDNSPSISCSEYNSKEEE
    NKQTPPKATRQISGSRDYILDVLPKKSHPDFANEKYDTAPEKCFLQITGMT
    CISCVSNIERNLKKKDGIVSVLVALMSGK
    AEVKFYPDRIEPLEIAQLVEDLGFGASVMEDYTASDGNVELIITGMT
    CASCVHNIESRLMRTPGILQASVALATCKAQVK
    FDPEIVGPRDIIRIIEGIGFQASLAKRDPTAHKLDHKEEIKQWRNSFLFSLLFGIPVIILMIYMLAANKDHHNTMVLDRN
    IVPGLSIINLVFFILCTFVQTLGGRYFYVQAYKSLKHKATNMDVLIVLATTIAYIYSVVILTVAMVEKADKSPETFFDTP
    PMLFMFIALGRWLEHIAKSKTSEALAKLISLQATEAAVVTFGANQIILREEQVAVELVQRGDIVKVVPGGKFPVDGKVIE
    GTSMADESLITGEPMPVRKKPGSMVIAGSINAHGTVLVEATHVGSETTLAQIVKLVEEAQMSKAPIQQLADKISGYFVPF
    IIIISVVTLVTWIIIGFVNFDIIIKYFPSYSKNISKTEVIIRVAFQTSITVLSIACPCALGLATPTAVMVGTGVAAQNGI
    LIKGGEPLEMAHKIKAVMFDKTGTITHGVPKVMRVLLLGDVVKMPLKRMLAVVGTAEASSEHPLGMAVTKYCKEVTRVLL
    GLIFSHNAPISSVIQCLNMISHCRIPIWLARLTYLCPTGAQAPLAHTVLIGNREWMRRNGLHISTDVDEAMSSHEMKGQT
    AVLVAIDGELCGMIAIADTVKQEAALAVHTLKSMGIDVVLITGDNRKTAKAIATQVGIKKVFAEVLPSHKVAKVQALQSD
    NKRVAMVGDGVNDSPALARADVGIAIGTGTDVAIEAADIVLIRNDLLDVVASIHLSKRTVRRIRLNFVFALIYNLLGIPI
    AAGVFMPAGLVLQPWMGSAAMAASSVSVVLSSLQLKCYRKPDSDRYEARAQGHMKPLTPSQISVHIGMDDRWRDLPKTKA
    WDQISYISQVSRASQKPKRHGSLVEQQDKWSLLINETHEDQMI

    >gi|52346078|ref|NP_001005086.1| glutathione S-transferase omega 2 [Xenopus (Silurana) tropicalis]
    MTGSEKSLAKGSPAPGPVSEETIRVYSMRFCPYAQRARLVLAAKGIKHEVININLKNKPDWFIEKSPFGLVPSLETSSGQ
    VIYESPIVCDYLDEVYPGKKLTPVDPFQKAQQKMIVEHFSKISTLFYKILLAKKNNEDVSGVKAEVQEKLVKLDEILAKQ
    NGLFFGGSDVSMVDYMIWPWFERLIIFDSKDCLNKTPHIDKWYQQMLQDPAVKATYIEPDLLLGFFKLYSQNDVEACDYG
    L

    >gi|58332208|ref|NP_001011256.1| glutathione S-transferase omega 1 [Xenopus (Silurana) tropicalis]
    MAGPTKSLAKGSPAPGPVPDGVIRAYIMRFCPFAQRAHLILVAKGIKHELVYINTLNKPDWFFEKSPFGQVPAIETSKGQ
    LIYESQIVCDYLDEVFPGKKLTPQDPFQKAQQKMLLEHFSKASTVAFKIVGAKKNNEDISALKAEFLEKLVQFDQVVAKL
    NTPYVGGSSVSMADYMILPIFERFDIFGVKDCLEKTPHLLQWYQLMLQDPAVKATHIKPEALEGFFKLYLQGNPESVDYD
    I

    >gi|62859455|ref|NP_001016058.1| ERO1-like protein alpha precursor [Xenopus (Silurana) tropicalis]
    MVSGCCRLDMSSYVSVLVLCSLLLWGSNSQQEQSSAAQRCFCQVTGYLDDCTCDVETIDHFNNYGLFPKLQQLVASDYFR
    YYKANLKKPCPFWEDNSH
    CGVKDCAVKPCPTDEVPGLKPPGFKYTEEANRAHEEIDDCEKEKRLSAVDESLSVEAQEAML
    KWNRHDDSADNFCELDDEESPDAEYVDLLKNPERYTGYKGADTWRIWNSIYEENCFKPKAVQRPLNPLTSTRGENEGKVF
    YNWLDGLCVEKRAFYRLISGLHASINIHLCANYLLKDTWMDKIWGHNTAEFQKRFDATLTQGEGPKRLKNLYFIYLIELR
    AISKVLPFFERSSFLLYTGNETKDTETKKLLLDVLLDARDFPLHFDENSLFSGDKKEAAKLKEDFRQHFRNISKIMDCVG
    CFKCRLWGKLQTQGLGTALKILFSERQIENLSESNQPSEFHLTRQEIVALFNAFARISTSVKELENFRTLLEKV

    >gi|301615076|ref|XP_002937004.1| PREDICTED: sulfhydryl oxidase 1 [Xenopus (Silurana) tropicalis]
    MGVSGLCICGATLVLLATVVPSHAGLYTPDEPVVHLDRKAHTYLLGSRSFWVAEFYASWCGHCQRFKPSWSGLAEDIKDW
    RPVVYLGVIDCAESSNFETCNEFGVEGYPTIKSFKSFTKEVSQGVSEDAVHSVQALRENIITRLEEQKDSRPSSWPPLEP
    ISTFEVENFFKTKQENYLALIFEEPSMYIGRETTLDMVQYEGVSVRRVLRDQNDMVNKFWITSYPSLVLLSRNGSNTVVN
    LKADTRSSYTDFLRSLPGVRKKNLFIIGVANNGTTEQDDRRIADSTKLYMADLESAVHYTLRAEVSRFSHLEGERLDALI
    AYVSVLRKYFPARPYGTTLLKSIHSWLHDRAGKEVLYKDFENVLNNKDEAQNAVLSSSVNYVWCQGSHPNFRGFPCSLWT
    LFHFLTVQASEDTAAPPTEVLLGLRGYVKNFFG
    CRECAGHFESMAAESMNTVNTLDEAILWLWDRHNRVNKRLAGQPSED
    PEFPKLPWPSKTLCPFCQVEDGGDELAWDIPNVLNFMKTHYSRQNLANDYLEDEEVLLERQKNGTKKEVTKPNEDISVEE
    TSDKTESHINLRYPQRNAEDHENKNVPLTTQETNPDKNPTESEVQFAAHLRVEDEKNTGEGNSFLLSLLPSRSLQGSIEL
    GSDHALQAKIIIDIPEEEFDHIAVRKRLLRRGIDENFIGVVAEKGTVNVKGRLGKMLEVGFSRLDISLCVLLYFLSSMCL
    LCMYLYMSLRTRCLRQRTFYP

    >gi|301615209|ref|XP_002937068.1| PREDICTED: nucleoredoxin-like protein 2-like [Xenopus (Silurana) tropicalis]
    MDIFSGHILLNKYGERVDPEEALQNKIVGLYFSARWCSPCRDFTPVLCDFYAELVEESDPPAQFEIVFISSDKSPEDMVD
    YIHDMHGDWLALPFHDPYKHELKNKYKITALPKLVIVKQNGDVITDKGRKQIRDRGLSCFRTWLEVGDVFQNFTGK

    >gi|90017453|ref|NP_001034820.1| prolyl 4-hydroxylase, beta polypeptide [Xenopus (Silurana) tropicalis]
    MMRAVLLFGCSLLIVARANIPEERDVLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLG
    KVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGF
    FKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKDGIVLFKKFDEGRNAYEGDITKEEVLSFIKANRLPLVIEF
    TEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITL
    EEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPW
    CGHC
    KQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAAD
    EDLEDLEDADESDLEEGDEAHTKDEL

    >gi|301616276|ref|XP_002937587.1| PREDICTED: methionine-R-sulfoxide reductase B3, mitochondrial-like [Xenopus (Silurana) tropicalis]
    MSAFNLLHLVTKSQPVTLRACGLPSGSRRGKKNYKVAFTQQELRERLTPEQYHVTQEKGTESAFAGEYTHNTADGMYKCV
    VCGAVLFKSEKKFDSNSGWPSFYDVINPEAVSFTDDFSYGMHRVEVGCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLNFV
    PEVPDAAIDSTSASSEKNEL

    >gi|118405096|ref|NP_001072538.1| thioredoxin domain containing 9 [Xenopus (Silurana) tropicalis]
    MAADTSVDIFAKVMENQLLQTAKIMEEQLDAELEKLDKIDEDEMDRLKERRLEALKKAQQQKQEWLSKGHGEYREIPSER
    EFFQEVKESKNVVCHFYKDSTFR
    CKILDKHLAVVAKKHVETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTKDYIVG
    FTDLGNTDEFTTETLEWRLGCAGIINYSGNLMEPPFQNQKKYGTQFTMLEKKTIRGKKYDSDSDDD

    >gi|301616959|ref|XP_002937915.1| PREDICTED: thioredoxin domain-containing protein 9-like [Xenopus (Silurana) tropicalis]
    MAKRFYSTEEAARYCMDSSSEEFSDSESEYVPSDNSTEESAIDDSDTVSAEVSSGGTLTAEEAEAGGSARDVPMDVEEVS
    TLFGHDSFQRHSYSSSTCSLEESSGTETHQPVSGPSKRKRSNKEARGQAVAFIGRVQTHTKMAADTSVDIFAKVMENQLL
    QTAKIMEEQLDAELEKLDKIDEDEMDRLKERRLEALKKAQQQKQEWLSKGHGEYREIPSEREFFQEVKESKNVVCHFYKD
    STFR
    CKILDKHLAVVAKKHVETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTKDYIVGFTDLGNTDEFTTETLEWRL
    GCAGIINYR

    >gi|55741988|ref|NP_001006831.1| chloride intracellular channel 4 [Xenopus (Silurana) tropicalis]
    MTDSAPTNGEERDPDIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGE
    VKTDVNKIEEFLEESLAPPRYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQDNAGLEKGLTKALKKLDTYLNSPLPEEI
    DANSREEEKVSKRKFLDGDEFTLADCNLLPKLHVVKIVAKKYRNYEIPAEMSGIWRYLKNAYARDEFTNTCAADKETELA
    YADVAKRLSK

    >gi|301617371|ref|XP_002938124.1| PREDICTED: thioredoxin reductase 1, cytoplasmic-like [Xenopus (Silurana) tropicalis]
    MGNSVKKGKAVFVDQTQVKSMRLYKAALEDQSSKSPEIPKCKTNENEDNGWRTDKNKSGLKIEIEEYICSSDVVIFSKTS
    CNSCAKVKDHFDQMGITYLTVELDQIENGHKLEELLYEQTMETSLPSVFVKEKHIGNYDDILKLSKENLFQKLLETKEDN
    PDRSGYDYDLIVIGGGSGGLAASKEAANYGKKVLVLDFVTPTPLGTKWGLGGT
    CVNVGCIPKKLMHQAALLRQALKDSQK
    YGWQIEDNIQHNWEIMTDSVLNYIGSLNFNYRVSLMQNNVKYENGYGEFVEPHTIKSTNSRGKEKYFTAEKFLIATGERP
    RYLGIPGDKEY
    CITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDVTVMVRSILLRGFDQQMANMIGEYMEEHGV
    KFIKQCVPTKIEQIEAGTPGRLKVTSQASDGAETTEEYNTVLLAIGRDACTRNIGLEIPGVKINEKTGKIPVNDEEQTNV
    PYIYAIGDVLQDKLELTPVAIQAGRLLARRLYGDSTVKCDYVNVPTTVFTPLEYGACGLSEEHAIRQYEEENIEVYHSYF
    WPLEWTVPARDNNKCYAKIICNLKDKGRVVGFHVLSPNAGEITQGFAVAIKCGLTKDQLDNTIGIHPVCAEIFTTLTVTK
    RSGGNILQSGC

    >gi|144925920|ref|NP_001004832.2| selenoprotein I [Xenopus (Silurana) tropicalis]
    MAWEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNSIVRFFPTWLAPNLITFSGFLLLVFTFLLMAFFDPDFYASAPG
    QEHVPNWVWIVAGLLNFTAYTLDGVDGKQARRTNSSTPLGELFDHGLDSWACIFFVVTVYSIFGRGETGVSAVVLYFLLW
    VVLFSFILSHWEKYNTGILFLPWGYDLSQVTISCVYLVTAVVGAETWYQPVVFNILYRDLFTTMIVGCAVCVTLPMSLYN
    VFKGYRNNTLKHTSLYEAMLPIISPVLLFILSTLWILASPSKILEHHPRLFYFMVGTTFANITCQLIVCQMSNTRCRPLS
    WLLIPLTLAVVVSLSTVTPRDETLALVLLTVLVTLAHIHYGVNVVNQLSKHFNILPFSLRKPSTD
    CLEEEKIGLQSAQVL


    >gi|118405088|ref|NP_001072534.1| thioredoxin reductase 3 [Xenopus (Silurana) tropicalis]
    MPPTGRELLQARVKELIDSNRVMVFSKSFCPYCDQVKELFSSLGAEYQALELDECDDGTAIQETLHELTGQRTVPNVFVN
    KTHVGGCDKTLKAHKDGSLAKLLGDNSVTYDYDLIVIGGGSGGLACSKEAASFGKKVMVLDYVVPTPKGTSWGLGGT
    CVN
    VGCIPKKLMHQAAILGQSLKDSRNFGWEYEEQVKHNWDTMREAIQNYIGSLNWGYRVSLRDKQVRYENAYGEFVEPHKIK
    ATNKRGKESFFTAEKFVVATGERPRYLNIPGDKEY
    CITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDATVMVR
    SILLRGFDQEMANRAGAYMETHGVKFIKQFVPISVELLEEGTPGRLKVTAKATEGDQIIEDEYNTVLIAVGRDACTRNIG
    LEKIGVKVNE

    >gi|45360655|ref|NP_989001.1| peroxiredoxin 2 [Xenopus (Silurana) tropicalis]
    MSCPVGPGVRAVKTHIGQPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQL
    IAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGNLRQITINDLPVGRSV
    EETLRLVQAFQYTDQHGEVCPAGWKPGSSTIKPNVKDSKEFFSKEY

    >gi|62857663|ref|NP_001017220.1| hypothetical protein LOC549974 [Xenopus (Silurana) tropicalis]
    MASVDLAKVGTILVKNALSGEMVELKSLWKEKTTVLLFLRRFGCQICRWIAKDIGKLKASCDAHQIRLVGIGPEEVGLKE
    FLEGNFFNGELYIDESKESYKTLGFKRYSALSVIPAALGKKVRDIVTKANADGVQGNFSGDLLQSGGMLIVSKGGEKVLL
    HFIQDSPGDYVPLESIVQTLGITANVTESQRPQCNDEVCTR

    >gi|194332745|ref|NP_001123670.1| hypothetical protein LOC100170420 [Xenopus (Silurana) tropicalis]
    MVRHVESLDEFQNILKEAGDKLVVVDFTATWCGPCKMISPVFEKLSVENPDVVFIKVDVDDAQDVAAHCDVKCMPTFHFY
    KNGQKVHEFSGANQASLIQKVQDLK

    >gi|301618478|ref|XP_002938644.1| PREDICTED: iron-sulfur cluster assembly 2 homolog, mitochondrial [Xenopus (Silurana) tropicalis]
    MAAGRFLFCVTGAARRSVLPALLSCELPVRYLSETLKEGQILLTDRCIKRLREVTSGSEFLRLHVESGGCSGFQYKFSLD
    TEITAEDRVFGISGARVVVDEHSLQLVTGSTVEYTEELIRSSFQLIQNPQAAQGCSCGASFSIKL

    >gi|163915087|ref|NP_001106525.1| peroxiredoxin 5 [Xenopus (Silurana) tropicalis]
    MSVKVGDQLPNVTVYEGGPGNKVSIRDVFANKKGVLFGVPGAFTPGCSKTHLPGYVAQAAELKSRGAAVIACISVNDIFV
    MSEWAKAYDAEGKVCMLADPCGDFAKACGLLLDKKELSELFGNQRCKRFSMVVEDGKVKAINVEEDGTGLTCSLAGNIMS
    QL

    >gi|213983177|ref|NP_001135714.1| arsenic (+3 oxidation state) methyltransferase [Xenopus (Silurana) tropicalis]
    MCSVLQSTECDCSTQGLQTYEDVKEYYGKFLKNSKDLKTNACVAPSRQLPKHIRDALKDVHEDVSSRYYGCGLVVPECLE
    TCSILDLGSGSGRDCYMLSKLVGQKGHVTGIDMTDEQVEVSKKYIDYHMQKFGFQPANVDFVQGYIENLHAVQIKDKCYD
    VIISNCVINLSPDKRAVLKEAYRVLKDGGEMYFSDVYSNRPVSEELKKNKILWGE
    CLSGALCWKELVQISEEIGFSPPRL
    VTSSFITVDNKELEEILSDYSFVSATYRLFKLPQGKAKEKWQVIYNGGITGCEEELQFDANFTFKEGEVVKVDEELGAIL
    KNSRFADEFLFRPCEKGDLSSKCQPKREIIRDPFQLAQKARNQHQAPNSGSCCGPKGCC

    >gi|206725479|ref|NP_001120227.1| hypothetical protein LOC100145277 [Xenopus (Silurana) tropicalis]
    MYSVPRSTDSDCSTQGLQTYQDVKEYYGKCLKNSKDLKTNACVAPSRQLPKHIRDALKDVHEDVSARYYGCGLVVPECLE
    TCSILDLGSGSGRDCYMLSKLVGQKGHVTGIDMTDEQVEVSKKYIGYHMQKFGFQPANVDFVEGYIENLHAVQIKDKSYD
    VIISNCVINLSPDKRAVLKEAYRVLKDGGEMYFSDVYSNKPVSEELKKNKILWGE
    CLSGALCWKELVQISEEIGFSPPRL
    VTSSFITVDNKELEEILSDYSFVSATYRLFKLPQGKAKEKWQVIYNGGITGCEEELQFDANFTFKEGEVVKVDEELGAIL
    KNSRFADEFLFRPCEKGDLSSKCQPKQEIIRDPFQLAQKARNQHQAPNSGSCCGPKGCC

    >gi|301619033|ref|XP_002938913.1| PREDICTED: maleylacetoacetate isomerase [Xenopus (Silurana) tropicalis]
    MAALGKPLLYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQSLAIIEYL
    EETRPNPPLLPRDPKKRAQVRMISDQIASGIQPLQNLCVLQKIGETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVT
    IADLCLVPQVANAVRFKVDLAPYPTIVGINESLLQLEAFQVSHPSCQPDTPEELRA

    >gi|89886155|ref|NP_001034826.1| thioredoxin-related transmembrane protein 4 [Xenopus (Silurana) tropicalis]
    MAACVRRESGAMVERTPAAPSRAALLLIAVVLWVPGECRGAQAESGVRAVTSTNWSALLEGEWMIKFYAPWCPACQQIQS
    AWESFAERSHALGVKVGKVDVTEEPGLSGRFFVTTLPTIFHAKDGVFRRYHGSRMVEDLQTFISEKKWEVIEPVAGWRSP
    SSILMSGMASLFQLSGWMRQLHNYFTGPLGIPAWGSYVIFVVATLFIGLLLGLILVLIVDCFCPSKAKYEVIREEVNEED
    LANVEADPKVLPMEKEADNAANEEGSDNDNEEENGEEISNSSEDDSEKENSNEDDSEDSNEDDDEDVSDGDANNAQNVAK
    DSDEDSAVAGSEAEEDNITEMAPQSPPESESALRQRRSEATVDNGH

    >gi|45360517|ref|NP_988889.1| chloride intracellular channel 1 [Xenopus (Silurana) tropicalis]
    MSEQPQVELFLKAANDGQSIGNCPFSQRLFMVLWLKGVTFNVTTVDMKKKPDILKDLAPGAQPPFLLFAGEVRTDTNKIE
    EFLEETLCPPKYPKLACRNQESNTAGLDVFARFSAYIKNSNPAPNQSVEKGLLKALKVLDIYLNTPQIDEIDENSAEDEP
    VSNRKFLDGNELTLADCNLLPKLNIVQVVCEHFRGFKIPAEFTGIHRYLQNAYKREEFASTCPDAAEIVRAYAEVAKPLK


    >gi|301620517|ref|XP_002939623.1| PREDICTED: spermatogenesis-associated protein 20-like [Xenopus (Silurana) tropicalis]
    MAARNSASNLPEPSNQRLLCSVNHALGVVRRLFLLLPLVVMLRCVSGLCRARGVLPRATLGFCPSPRNPGHRRGKWRGGE
    IFEVCKMASGSTQTPTGRVNRLINEKSLYLQQHARNPVDWVGYST
    CHWCHVMERESFEDEEIGRILNENFICVKVDREER
    PDVDKVYMTFLQATDSGGGWPMSVWLTPDLRPFVGGTYFPPEDGVRRVSFRTVLLRIVEQWKENRAFLCERSERILSVLQ
    SSSDIDGAAEPPPSLPVQKLCFQQLERIFDEEYGGFGEFPKFPTPVNFSFLFCLWALSKGSPEGTQALHMAVHTLKWMMY
    GGIHDHIGKGFHRYSTDQTWHVPHFEKMLYDQGQLAVAYAEAFQISGKEIFSDAAHDILQYVLQNLSDDAGGFYSAEDAD
    SLPNAQSKEKKEGAFATWTAKEIQQLLPDMEEANGNTFGDIFMHHYGMKEEGNVSASQDIHGELQGQNVLIVRSSLELTA
    AKFGLDVARVQTILSMCRDRLYKARRLRPPPQRDTNILASWNGLMLSGLARCGVILRDEEYIERAKLAASFLHENMYDLK
    SGILLRSFYKGHQPIADLVPGFLDDYAFMVRGLLDLYEACLDQFYLEWALQLQDRQDQLFWDAKGSGYFCSDASDSSILL
    RLKDDQDGAEPSGNSVSVVNLLRLACYTGRTEFTERSGQILAAFSERLLKVPASLPEMVRGNMIYHQTVKQVVVCGDKED
    PNTRELLEAAQSMYVPNKYAYPCPGEEKRGGRKIAPKNLCRNTLGHGSVLLTGIR

    >gi|301620609|ref|XP_002939661.1| PREDICTED: protein disulfide-isomerase TMX3-like [Xenopus (Silurana) tropicalis]
    MAATGFCFILATVASTSLLASLPVSALVEDLDDSFKENRKDDIWLVDFYAPWCGHCKKLEPVWNEVGIEMRSSGSPIRVG
    KMDATVHSSIASEFGVRGFPTIKVLKGDMAYNYRGPRTKEDIVEFANRVAGPLIRPLPSQQMFDHVQKRHSVLFVYVGVE
    STLKEKYIEVASELIVYTYFFSSSEDVLPKYVTLNEVPAVLVFKDSTYFVYDEYEDGDLSSWVNKERFEGYLHIDGFTLY
    ELGDTGKLVAVAVIDEKNNSVEHTRLKSIAQDVAKNYRDHFHRDFQFGHMDGNDYINSLLMDELSIPTFVVLNTSNQQYF
    LPSKQIENTEEMIQFINSILDGTAEAQGGDGILQRIKRVFYDAKSTVVSVFKSSPLLGCFLFGLPLGVISIMCYGICTAD
    TEDGSEEMTRKDVIDQNGSDEGSEEEQEEEKSREITDMSDEDQQEKDFMEKKID

    >gi|56118466|ref|NP_001007908.1| chloride intracellular channel 5 [Xenopus (Silurana) tropicalis]
    MSLSVPQNGVQEDKDNLVELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLQNLAPGTHPPFITYN
    HEVKTDVNKIEEFLEEVLCPPKYRKLAAKHPESNTAGMDIFAKFSAYIKNSRPDNNEALERGLLKTLQKLDDYLNSPLPD
    EIDENSMDDITQSNRKFLDGEEMTLADCNLLPKLHIIKVVTKKYRGFEIPKSMTGIWRYLSNAYSKDEFTNTCPGDREIE
    IAYADVAKRLAK

    >gi|301621655|ref|XP_002940166.1| PREDICTED: protein disulfide-isomerase A6-like [Xenopus (Silurana) tropicalis]
    MARAVLGAVACTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVKIGA
    VNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKDRLGGRSGGSDSGRQSYSSGGGSK
    KDVIDLTDDTFDKNVLNSDDVWFVEFYAPW
    CGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPT
    IKIFQKGEDPVDYDGGRTKADIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIVAVLPHILDTGASGRNSYLDV
    MMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVG
    GGAIPKINTVVPWDGKDGELPAEDDIDLSDVELDDFEKDEL

    >gi|301621954|ref|XP_002940305.1| PREDICTED: thioredoxin-like [Xenopus (Silurana) tropicalis]
    MDQVNDCDELHFALQEAGEKLVLVALSSRRCGHCKLTTPYLESLIPKMPDVVFLKADVSESQEFMELFQVKGVPAFHFFY
    KCNRLYYFQGANTEFLGNKIEELRRNCNQQTS

    >gi|301621956|ref|XP_002940306.1| PREDICTED: thioredoxin-like [Xenopus (Silurana) tropicalis]
    MVRYLKNMEELQYALQQAGPKLLVVKFFASWCGNCRRIAPEFEKLSGDYPNILLCQVDVDNASILAQQFQIRSVPTFFFY
    KDQNKIEAFSGADVPKLRGTVDRLC

    >gi|301621958|ref|XP_002940307.1| PREDICTED: thioredoxin-like [Xenopus (Silurana) tropicalis]
    MIRYLRSVEELQYALRDAGQKLVLVNFSSHKCGQCTIVAPEYEKLCTEYPDILLYKVLDDAPKLCQHCEITSTPTFVFYK
    DRLKIKQFSGADIVQLRETIRKLY

    >gi|301621960|ref|XP_002940308.1| PREDICTED: thioredoxin-like [Xenopus (Silurana) tropicalis]
    MIRYLRSVEELQYALRDAGQKLVLVNFSSHKCGQCTIVAPEYEKLCTEYPDILLYKVLDDAPKLCQHCEITSTPTFAFYK
    DRLKIKQFSGADIVQLRETIRKLY

    >gi|58331956|ref|NP_001011127.1| thioredoxin [Xenopus (Silurana) tropicalis]
    MVKYLASVEEYQCALKDAGEKLVVIDFTAKWCGPCQRIAPDFEKLSTEFPDIVLYKVDVDDASDVAQVCGISSMPTFIFF
    KSGKQVERFSGADIKKLKETIKRLC

    >gi|71896087|ref|NP_001025608.1| peroxiredoxin 3 [Xenopus (Silurana) tropicalis]
    MAACGRLLASWVRRSGRLAGSPVLRNAAAATPSRCAIHKLQFSTSSVRFLPAVTQHAPHFKGTAVVNGEFKELSLEDYKG
    KYLVLFFYPLDFTFV
    CPTEIVAFSNKANEFHDVNCEVVAVSVDSHFCHLAWTNTPRKSGGLGQMNIPLLSDLNKQISRDY
    GVLLETPGIALRGLFIIDPNGIIKHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPDSPTIKPSPEGSKDYFE
    KVH

    >gi|62858325|ref|NP_001015996.1| hypothetical protein LOC548750 [Xenopus (Silurana) tropicalis]
    MSVSIVVEYCEPCGFKSHYEELASAVLEEFPDVTIDSRPGGTGAFEIEINGQLVFSKLELGGFPYAKDLIEAIRKASNGE
    PVEKITNSQAPCVIL

    >gi|170016047|ref|NP_001116198.1| ubiquitin-like modifier activating enzyme 3 [Xenopus (Silurana) tropicalis]
    MADAEEPMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPEFEPSNESLQFLLETCKILVVGAGGLGCELLKNLALSGFR
    QIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFINTRIPDCCVTPHFTKIQDFDETFYREFHIIVCGLDSIIARRW
    LNGMLMSLLNYEDGVLQQSTVIPLIDGGTEGFKGNSRVILPGMTACVECTLELYPPQINFPM
    CTIASMPRLPEHCIEYVR
    ILQWPKEQPFGEGVQLDGDDPEHIQWIFMNSLERAKQFNIRGVTYRLTQGVVKRIIPAVASTNAVIAAACATEVFKIATS
    AYIPLNNYLVFNDVDGLYTYTFEAEKKENCPACSQLPQNIQFPSSAKLQEVLDYLTNDTSLQMKSPAITATLDGKNKTLY
    LQTVASIEERTRPNLCKTLKELGLVDGQELAVADVTTPQTVLFKLHFTT

    >gi|56118833|ref|NP_001008167.1| chromosome 9 open reading frame 21 [Xenopus (Silurana) tropicalis]
    MSAPSNPVTQQICTDEKGNTEEEFAALFHPDLELAADCLLRDPHGNSHRFGDLYRDQKTIVVLVRNFLCYTCKEYVEDLA
    KIPSSALEDANVRLIVIGQSSYIHIKHFCSLTSYPYDMYVDTDREIYCKLGMMKGETSTSSGKSTHVKSNIISGSIKSVW
    RAMTSPAFDFQGDPAQQGGSLVVGPGNRVHFLHRDMNRLDQAPIGSLLQHAGVQGVHFGDRSVIIDV

    >gi|58331952|ref|NP_001011125.1| endoplasmic reticulum protein 44 [Xenopus (Silurana) tropicalis]
    MRRGIFVPYFCPAYLLMPLVMWVYTPVKSEILTLQSGNIDDILRNADVALVNFYADWCRFSQMLHPIFEEASNIIQEEYP
    DKNKVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADYIRQQKSNPIREIGDLEELKTVDRSK
    RNIIGFFESKEIDNFRTFEKVANILHDDCVFLAAFGDVAKPERFSGDNVIYRPIGESAPDMVYLGSLTNFDLTFAWTQDK
    CVPLVREITFENGEELTEEGLPFLILFHLKDDTESLEKFQQEVARQLISEKGTINFLHADCEKFRHPLLHIQKTPADCPV
    IAIDSFRHMYVFSDFKDLSISGKLKQFVLDLHSGKLHREFHHGPDPTDVAPDQPTEDIISNPPESSFQKLAPSEHRYTIL
    RRDRDEL

    >gi|118403774|ref|NP_001072283.1| thioredoxin domain containing 11 [Xenopus (Silurana) tropicalis]
    MQRPGWLDVKRLLGVMGRRPELLCGAIALSFALIVALRFTCSRAKDVVRPAKPPVHFFSSHSPVVDLFLGQLDYAEYIRQ
    DSEITMFFLYAPWCGQSITARAEIEQVASKLADQVLFVAVNCWWHQGKCKKQKTFYYFPVINLYHKNFGPIEYKGPITAA
    YIEKFVRRVMSPLLYIPSQERLQEFLSNYEPGVLGFFEFNASPQPPGYLTYFKSALHSLQKDYLGTIRFGVITDRKVAKE
    ISLSNPGSIYLHRNLNSSLVYPDNEMNFTATNICKWALDNRENLFYWLRPHGGKSLLLHNELKKGPALFMFIPYNPLSEE
    QPLLHEITEVALEYNSCTKSLPVHEDHDQKDSYKKSSSDTTLHNTGSYKGFSCCNTVVLPQWHLMSRIHNICELCVNLSA
    GIRPSKVYMHQCNFLDIEAALDLFYLKENSFMGFLSKVRECSNFPRFYSPYNYYTACCQTLSKGFIASSSFLKNTHIIPS
    SNGKNFKEDNTHLVPHIEEKILLSPSYHISGNSITGLSCRTNKTLNLYLLDSNLSWMYAERLGASGSASGKEFAAIVDIK
    EEVHYILDHWHPLIKPNLEAFIQNYSKVYSPLQRHLVGDAPPYASNEQLITEVTSNTFYPVVLESKKDVLLVYYTTW
    CGF
    CVALNHIFIRLSQLLATDSLVVTRINIAHNDLPWQFMVDRVPTILFFPQNRKDRSVKYPEDQQITLPNLLKFIIKHATLP
    STASDPPASCPKHYLQYKEDHVSYLEREMQRLRAEIEVLHKAQDLLLSHISDARKNTQDLKVQKEKLEHHNKALELHKEH
    LQVLYEQKQKEVGTMADKLKELAAASESLLAENAVLKFLMVSLESKSKSKSETEGVNNADKHISSALENMGHSEGNHDTL
    TGTLASEQIKENTTE

    >gi|62859537|ref|NP_001016070.1| phosducin-like [Xenopus (Silurana) tropicalis]
    MTTLDDKLLGEKGQYYYSSSSDDEDSEQDNKTIKFSGEQEGGKEGSVVNTGPKGVINDWRRYKQLETEQNEDQKREMEQL
    IKRLSMTCKSHLDEEKDKQKEKELEERLQGKMTMQEYKMMNDGDDEEFLQQYRKQRIEEMKKQLSQPQLFKKVFDIASGE
    EFLDMVDKEHMKTRVLILIYEDDVLG
    CEAANGSIICLASEYPGVKFCRVKSSLLGTSAKFTTYALPALLVYKAGELIGNF
    VRITDQLGVDFFAVDLEAFLHECGLLPEKDIVATSICNPSIQGYSSDSDLDID

    >gi|301624264|ref|XP_002941424.1| PREDICTED: protein disulfide-isomerase A4-like [Xenopus (Silurana) tropicalis]
    MAKKNGYLLLLLLGLAHVAIITCNQEEKGPEEHSDDEDTSEDETEVKDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCG
    H
    CKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPIDYDGARTQEAIVTKVKEIAQPDW
    KPPPEATIVLTKDNFDEVVSDADIILVEFYAPW
    CGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGF
    PTLKIFRKGKVFDYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHEFFRDGDDVGILGVFSDEKDRAYHLYQDAANNLRE
    DYKFYHTFSSEIFNFLKVSPGQLVVMQPEKFQSKYEAKKYILSFKDSTTAADIKQHISEHSLPLVGHRKNSNEAKRYSKR
    PIVVVYYSVDFGFDYRTATQYWRSKILEVAKDFSEYTFAIANEDDYATELKDLGLSDSGEEVNVAIFDASGKKYAKEPEE
    FDSDGLREFVMAFKKGKLTPIIKSQPVPKNNKGPVKVVVGKTFDQIVMDPKSDVLIEFYAPW
    CGHCKSLEPIYNDLGKKY
    RSAEGLIIAKMDATANDITSDKYKAEGFPTIYFAPRNNKQNPIKFSGGNRDLESLSKFIEEHSVNLKKKDEL

    >gi|301625356|ref|XP_002941869.1| PREDICTED: glutathione S-transferase omega-1-like [Xenopus (Silurana) tropicalis]
    MGVTWWWITGGVILHLTAYTAHQSPIMAGSTKSLAKGSPAPGPVPDGLIRAYLMRFCPFAQRAQLVLIAREINYEVVYVN
    TLNKPDWFFEKSPFGLVPAIETSEGQLIYESLIVCDYLDEVSPGKKLTPEDPFQKAQQRMLLEHFFKVENLVFKILGALK
    NNADTSALKAEFLKKLIQFDEIVSKLNTPYVGGSSVSMADYMMWPIFERFSIFGVKDCLEKTPHLHQWYQLMLQDPAVKA
    TFTKPEVQEGFFKLYLQGIPEAVDYGI

    >gi|301625462|ref|XP_002941923.1| PREDICTED: hypothetical protein LOC100486547 [Xenopus (Silurana) tropicalis]
    MAESAGQPHVEAETNLNDKEPKSPVGETDPTAHIEKNPKTEEEDGKPGLVNEGQGSGGMNGKAEKDPDVTTDSSQEPPGN
    QGEKQVAEGEPPKPQTEKEPPGGQEAMQEAEGRPCQPPTENEPAGDEPQQTELGDNTKEGSEGDVPQEQTKGDDADKEEE
    GKEEGTEIENESISSESSEESSSSDEEEEKEQYEVNREEENVQDVVAGEEGNVQDVVAGEEGNVQDVVAGEEGNVQDVVA
    GEEGNVQDLVAGEEGNVQDLVAGEEGNVQDLVAGEEGNVQDLVAGEEEKVQDVETGKEGKEQDGGVGEEEKVQDVATGKE
    LDGGVGEEEKVQDVATGKEGKEQNGGVGEKQTEQDVVSKETGEDQKETKIEGYLASEEQGAEGGTEEKQQAAEDKEEESE
    SEEEEEREEEEEAEGQSGEVEDNKDVEEAVGEGHIDQVENNDGRTEGEVEGEETDIGQDTKKQGKESEQGDAVKKLVEPS
    GAGEDVPDAPQVDNVKIKEPSSENGKNTNIPSQIDLVVEPCAVPEQSPEDGRTEESPSKEEGHTAEESLDAEPGSGGETE
    IKENGMNPTSSPETPLQTPEAPQEHDISLFVKPPEPISEPSVCLVPQAGSDGESIGN
    CPFSQRLFMILWLKGVVFNVTTV
    DLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEERLTMPRYPKLAPKHPESSSAGNDVFAKFSAYIKNPRKDLN
    AALEKGFLRSLRKLDDFLNTPLPDEIDAYSTEDITISDRKFLDGNELTLADCNLLPKLQIIKVVAKKYRNFEIPTDMTGI
    WRYLNSAFARDEFTNTCPADSEIEYAYFRVAKKIQ

    >gi|301625657|ref|XP_002942018.1| PREDICTED: chloride intracellular channel protein 3 [Xenopus (Silurana) tropicalis]
    MAEQGNFTLELFVKASDDGESIGHCPFSQRLFMILIHKGVPFTLTTVDMKRAPEVLRDLAPGSQPPFLLYNNEVKTDTNK
    IEEFLEELLQPPSYPKMAPEHKESFQAGSDVFHKFSAYIKNQLPAQEDALQRNLLKSLLLLDKYMLVPLPQELKANPNQS
    VSQRKFLDGDTLTLPDCNLLPKLNIINTVCKYYRKFEIPKDLKGVTRYMENASQMKEFKYTCPNTEEILLFYRSWVKPMN


    >gi|301625952|ref|XP_002942164.1| PREDICTED: thiosulfate sulfurtransferase-like [Xenopus (Silurana) tropicalis]
    MEKQVFCRALVSASWLSGALKSRPTLRVLDATYDKDAGKQFSERHIPHARFFDLDQCKDQASPYEMMLPSERHFAEYVGR
    LGITNNSHVVVYDTDKMGILSAPRVWWMFRVFGHRNVSVLDGGLRNWLKQGLPVTSENPQFGAETFRAKLDPSLLHRFED
    VRDNISSKRFQLVDARSPARFRGPEPKPGEGIEPGHIPGAVNLPFSTFLTKEGYEKSPEEIRRLFQEKGLDLNKPMAAT
    C
    RRGVTACHVALASFILGKENTAVYDGSWSEWFHRAKPEHKVFEKN

    >gi|187608038|ref|NP_001120626.1| glutathione reductase [Xenopus (Silurana) tropicalis]
    MHKPVPDSHSSDGHLPRYFDYLVVGGGSGGLASARRAAELGARTAVVESSKLGGTCVNVGCVPKKIMWNAAIHSEYIHDH
    EDYGFETSAIKFTWKVIKEKRDAYVSRLNDIYQNNLQKAQIEIIRGQANFTSDSEPTVEVNGQKYIAPHILIATGGKPSM
    PSDAEVPGASLGITSDGFFQLTDLPRRSVVVGAGYIAIEIAGILSALGSKASLLIRQDKVLRTFDSMISSNCTEELENAG
    VEVWKYAQVKSVKKSATGLEINVQCSMPGRKPTVRTIQDVDCLLWAIGRDPNTEDLGLENLGLELDEKGHIVVDEFQNTS
    RKGVYAVGDVCGRALLTPVAIAAGRKLSHRLFEGQEDSKLDYDNIPTVVFSHPPIGTVGLTEEEAVTAKGRENVKVYTTS
    FSPMYHAVTRRKTKCVMKLVCVGKEEKVVGLHMQGLGCDEMLQGFSVAIKMGATKKDFDNTVAIHPTSSEELVTLR

    >gi|301628961|ref|XP_002943601.1| PREDICTED: putative iron-sulfur cluster insertion protein erpA-like [Xenopus (Silurana) tropicalis]
    MSAVAENVSTDMPAPIHFTDSAAAKVADLIAEEGNPDLKLRVFVHGGGCSGFQYGFTFDEITNDDDTTMTKNGVSLLIDA
    MSYQYLVGAEIDYKEDLQGAQFVIKNPNAETTCGCGSSFSV

    >gi|301629367|ref|XP_002943814.1| PREDICTED: disulfide bond formation protein B-like [Xenopus (Silurana) tropicalis]
    MNTVLSLLDQCPRRLLALISAACVGMLAFGIYLQYGVGLEPCPMCIVQRYALIAVAVFTGLASARGGKGWRASWGVLALA
    CAGFGAFTAARQSWLQWFPPEFAT
    CGRDFYGMIENYSLSRAIPMIFRGSGDCMAVDWTLLGGSIANWSFVCFVLIGMVLL
    VLLVRSRKA

    >gi|301629815|ref|XP_002944029.1| PREDICTED: thioredoxin reductase-like [Xenopus (Silurana) tropicalis]
    MKPGAETADPVATSAXXXXXXXXXXXXXXXXXDVAGVQGPELMQRFLEHAERFKAQIVFDHIGKVDLSRRPFSLTGDSAT
    YTCDALIIATGASAKYLGLPSEAAFMGRGVSA
    CATCDGFFYRDQDVCVIGGGNTAVEEALYLSNIARRVTLVHRRDKFRA
    EPILIDKLHEKVAAGKIVLKTFFTLDEVLGDASGVTGIRIKSTQDGHSEDLALQGCFIAIGHAPNTQIFQGQLQLENGYI
    VTQGGLKGFATQTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRFLEQQA

    >gi|301630264|ref|XP_002944242.1| PREDICTED: peroxiredoxin-2D-like [Xenopus (Silurana) tropicalis]
    MIKVADELPAATLMEFVEVESQGCSLGPNPVDVQKATAGKTIALFAVPGAFTPTCSAQHLPGYVAQAEAFKAAGVDEIWC
    LAVNDAFVMGAWARDQKTAGKVRMLADGDAVFAKATGLTLDLHGKGLGLRSKRYSMLVKDGKVVALNVEAPGKFEVSDAA
    TLLAQAKG

    >gi|301630266|ref|XP_002944243.1| PREDICTED: thiol-disulfide oxidoreductase resA-like [Xenopus (Silurana) tropicalis]
    MTIKHWITGVALAAFAGIGAHVYLGAGRQAAPPSTFVLLDGSQQTSADLHGKVTLVNFWATSCAPCVAEMPDIVHTYDKY
    HTQGFETLAVAMHYDPPSYVAHFAESRRLPFKVAIDNTGAVARAWGDIKITPTTYIVNKRGEIVKSYVGAPDFAELHRLI
    EKLLAET

    >gi|301630305|ref|XP_002944262.1| PREDICTED: thioredoxin-like [Xenopus (Silurana) tropicalis]
    MARIYLSLLPSSQGNSHMTSNLIKHVSDTSFQADVLQSSTPVLVDYWAEWCGPCKMIAPILDDVAGAYQGKLTIAKMNMD
    DNQEIPAKFGIRGIPTLMLFKNGQLAATHVGALGRAQLTAFIDQQLA

    >gi|301631271|ref|XP_002944723.1| PREDICTED: alkyl hydroperoxide reductase subunit C-like [Xenopus (Silurana) tropicalis]
    MSLINTQVQPFKTTAFVNRNGKGEFIPVTEQTLKGKWSVLIFMPAAFTFNCPTEIEDAAEHYTEFQDAGAEVYIVTTDTH
    FSHKVWHETSDAVGKAKFPLVGDPTHQLTNAFGVHIPEEGLALRGTFVINPDGVIKTAEIHSNEIARDVSETLRKLKAAQ
    FTAAHPDQVCPAKWKEGAKTLTPSLDLVGKI

    >gi|301631273|ref|XP_002944724.1| PREDICTED: alkyl hydroperoxide reductase subunit F-like [Xenopus (Silurana) tropicalis]
    MLDDQLKSQLATYLERVTQAFELVASLDDSETAAQMRELLTTIQGLRSDKITLRLDGQDARKPSFTLQRAGTPQSLRFAG
    LPLGHEFTSLVLALLWTGGHPPKVEQDLIEQVQALDGDFNFEIYMSLT
    CHNCPDVVQALSLMAVLNPRVKTTVIEGGAFQ
    QEVTEREIMAVPMVYLNGQVFGAGRMELAEIVAKLDTGAAAREAAKLSAKEAFDVLVIGGGPAGAAAAVYAARKGIRTGV
    AAERFGGQVNDTLDIENYISIPKTEGPQFAAALERHVREYEVDVMNLQRAKALRPAAMAGGLIEVEMDNGAVLKARSIIL
    STGARWRNMNVPGENQYRTKGVAY
    CPHCDGPLYKGKRVAVIGGGNSGIEAAIDLAGVVAHVTVFEFMPQLKADAVLQKKL
    ASLPNVDVVLNAQTTEVLGDGSKVNALAYKDRATGEEKRVALEGIFVQIGLLPNTDWLKGTLELSKFGEIVIDAKGHTSG
    FMGSYLEKNIQTFTDVQMRLAEQTQGMTPEMWKQFLGGQGLLGGYAEQSRAMLTQMQEQLQKQTGQMLGAFGIKR

    >gi|301631320|ref|XP_002944746.1| PREDICTED: peptide methionine sulfoxide reductase msrA-like [Xenopus (Silurana) tropicalis]
    MTQEETITLGGGCFWCTEAIFDRVRGVTDVQSGYANGHVPHPSYEQVCTGSTGHAEVVRLRFDPAQIGLRAILEIFLATH
    DPTSLNRQGHDVGTQYRSGIYYSDPAHEAVARAVLRELEASGACAAPIVTEVAPLAAYWPAEDYHQDYFLKHPHQGYCAF
    VVAPKVARFQATFARFARHGHATGADQR

    >gi|301631385|ref|XP_002944778.1| PREDICTED: hypothetical protein LOC100493435 [Xenopus (Silurana) tropicalis]
    MTTDAQAKALNIDFHLDIVCPWCWIGLRHLRSALAGWRERHPDAHDANDANWQVTWHAAPLQPQIPDEGIPFQAFYEARL
    GSPQAVQARRAQVQAVAQTVGLHIRFDAIHTFPSSRLACALINFAQTRLPTEHMFAWVESLYAAYFHQGQNIGQPEVLKP
    LALAAHLPWPVAHLHTPNPPPGAGHSGGVPHFVFNGRRSLTGAVPAAELLQAMQP

    >gi|301631505|ref|XP_002944838.1| PREDICTED: peptide methionine sulfoxide reductase msrB-like, partial [Xenopus (Silurana) tropicalis]
    MTYPIQKTEAEWQALLRDKAAEPAAFQVTRHAATERPFTGRYEQHWAEGRYHCVCCNALLFQSHTKFDAGCGWPSFWQAV
    PGAVAEHVDRSHGMVRTETVCAQCGAHLGHVFEDGPAPTGLRY
    CMNSASLAFASPPTSL

    >gi|301631827|ref|XP_002944996.1| PREDICTED: protein yffB-like [Xenopus (Silurana) tropicalis]
    MTWWCKLLPESEEMGVMEDGNTSLFIIQNKAGRHTPRRTARHQITASWRWSWPAPVLQVLQTTFLRFFSNPMTQPSTPTV
    YGIPN
    CTTVKKARAWLSAQGVDYQFHDFKKQGVPAERLPQWIAALGWEKLVNRQGTTWRKLDAATQARVHDAASAMALMR
    EQPSVIKRPVVEWPAGAITMGFDSTHWSELSGPD

    >gi|118403886|ref|NP_001072180.1| selenoprotein K [Xenopus (Silurana) tropicalis]
    MVYIANGQVLDGQSRSPWRLSFLTDMFWGITDFIVMFFQSIIHPNVTRRGCQNSSSRTRFDDGRGPPGNPRRRMGRIDHN
    SGPNAPPMSGGG
    CGR

    >gi|56118348|ref|NP_001007974.1| protein disulfide isomerase A6 [Xenopus (Silurana) tropicalis]
    MARAVLGAVACTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVKIGA
    VNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKDRLGGRSGGSDSGRQSYSSGGGSK
    KDVIDLTDDTFDKNVLNSDDVWFVEFYAPW
    CGHCKNLEPEWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPT
    IKIFQKGEDPVDYDGGRTKPDIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIVAVLPHILDTGASGRNSYLDV
    MMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTSPVG
    GGAIPKINTVVPWDGKDGELPAEDDIDLSDVELDDFEKDEL

    >gi|301632488|ref|XP_002945317.1| PREDICTED: iron-binding protein iscA-like [Xenopus (Silurana) tropicalis]
    MAISLTDAAARHVSRYLARRGKGIGVRLGVKTTGCSGLAYKLEYVDEQSPEDVVFENHGIKVLVDPKSLAYIDGTELDFV
    REGLNEGFKFHNPNERDRCGCGESFRI

    >gi|301632641|ref|XP_002945390.1| PREDICTED: hypothetical protein LOC100489244, partial [Xenopus (Silurana) tropicalis]
    MPCVFPVLAIKVVGFARHAQDTRAHRISGLAYSAGVLLSFLGLGALMLGLRAAGEAVGWGFQLQSPAIVATLAALFTLIA
    LNLAGVYEFGQMLPSSLARLQARHPVVDAFLTGVLAVAVASPCTAPFMGASLGLTATLPAAQALGIFAALGLGLALPYLL
    ASWLPAFARALPRPGAWMQTLRRLLAFPMLATVVWLVWVLGQQTGIDGAATLLALLVALSMAVWALTLHGTARRLIAPLS
    IAAGAWLAWNWIPNIVETKEQQAQPALISGAWKPWSENLPERLLAEGRPVFVDYTAAW
    CVTCQYNKKTTLADAEVLADLA
    ARNV

    >gi|301632687|ref|XP_002945413.1| PREDICTED: hypothetical protein LOC100493802 [Xenopus (Silurana) tropicalis]
    MTCGHCERAVVHAVRELDNDALIQIDLPTGQVVVESEKSRDAIASAIQEEGYKVAA

    >gi|301632783|ref|XP_002945460.1| PREDICTED: selenide, water dikinase-like [Xenopus (Silurana) tropicalis]
    MATTSSPRLTSLSHGGGCGCKIAPGVLSEILQSSGTAAVLPPELLVGIETSDDAAVYRLNDAQALVATTDFFMPIVDDPY
    EFGRIAATNALSDVYAMGGKPIMALALVAMPVNQLPLQVIGAIVRGGQDVCRAAGIPIAGGHTIDAVEPIYGLVAMGLVH
    PDHVRRNADARPGDTLVLGKPLGVGVYSAALKKERLGDAHYREMIATTTRLNTPGPLLAALPGVHAMTDVTGFGLAGHAL
    EMARGAGVTIAIDWARVPLLSGAAELAAAGCVTGASGRNWAGYGADVALAPGLPATAQALATDPQTSGGLLVACAPQSVQ
    EVLAVFQHEGFAQAAVIGCVQQGPARLNLYA

    >gi|301632852|ref|XP_002945494.1| PREDICTED: high-affinity branched-chain amino acid transport ATP-binding protein livG-like [Xenopus (Silurana) tropicalis]
    MKRREFSLTAASVALAVGAISLPTMAQPREGKDYRKLSKPAATDVPAGKVEVIEFFWYSCGHCNTFEPTFAAWLKTAPKD
    LVVRRVPVAFNSSFVPQQKIYYALEGLGKTEEIHAKVFRAIHVERQKLAKDDEIFDWMGKQGLDLAKFKEVYNSFTVSNQ
    VRKAAQIQDAYGVEGVPSMGXXXXXXXXRLGLSYLPQEASIFRKLSVQDNVRAVLELQTGANGQPLPKPVIEERLTALLE
    ELRVQHLRESPALALSGGERRRVEIARALATQPRFILLDEPFAGIDPIAVIEIQRIIGFLKERGIGVLITDHNVRETLGI
    CDRAFIISDGTVLACGTPSEIVDNDEVRRVYLGPHFRM

    >gi|194332757|ref|NP_001123676.1| hypothetical protein LOC100170428 [Xenopus (Silurana) tropicalis]
    MIRYLRSVEELQYALRDAGQKLVLVNFSSHKCGQCTIVAPEYEKLCTEYPDILLYKVLDDAPKLCQHCEITSTPTFLFYK
    DRLKIKQFSGADIVQLRETIRKLY

    >gi|301633016|ref|XP_002945575.1| PREDICTED: thioredoxin reductase-like [Xenopus (Silurana) tropicalis]
    METEKVKCLIVGSGPAGYTAAIYAGRANLSPVLYEGIQPGGQLTTTTDVENFPGYPQGISGPQLMEDLRAQAERFGADIR
    FGIATASDLSKAPYKVTIDGDKVIEADTLIIATGATAKYLGLEDEKKYAGMGVSA
    CATCDGFFYRKKVVAVVGGGDTACE
    EAIYLAGLASKVYLLVRKPFLRASKIMQERVMKHEKIEVLFEHNAVGLFGDNGVEGVSLVKRWGQPDEERYSLAIDGFFL
    AIGHQPNSYIFKPYIDTDEVESTILPCCLRTFVSADVYIRAGE

    >gi|301633020|ref|XP_002945577.1| PREDICTED: glutathione peroxidase 2-like [Xenopus (Silurana) tropicalis]
    MDNSYEHESKMFEYCHKGAAQGKSFYDFTVKTIDGKEFQLSQLKGKKVLVVNVASKCGLTPQYAELQELYDKYKDKGFVI
    IGFPANNFMGQEPGTDKEIATFCTLNYDVTFPMMAKISVKGKDMAPLYQWLTEKQLNGKQDAPVQWNFQKFMIDGNGHWV
    GFVAPKESPFSETIVSWIEKK

    >gi|189230264|ref|NP_001121456.1| thioredoxin domain containing 6 [Xenopus (Silurana) tropicalis]
    MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGK
    CEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDEDEIVPVQAQTEDEELVPAGKSY
    TVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDED
    VIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALI
    RPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLG
    PASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQ
    IKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQ
    NAVHGSSNGEHAMEKMKFIFGDIDLDRIVHESFGETPETSASDISKNADAQGENV

    >gi|62860202|ref|NP_001016646.1| thioredoxin-like 4A [Xenopus (Silurana) tropicalis]
    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY