Vitis vinifera

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|225461146|ref|XP_002280066.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAGNQQLKESRVVKVDSEESWDLFFSQATNQGCPVVVHFTAAWCIPSVAMTAVFEDLALNYQDMLFLVVDVDEVKEVASK
    LEIKAMPTFLLMREGAQVDKLVGANPDEIRKRTEAFIRSSRSHKMT

    >gi|225470790|ref|XP_002269656.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MEGRLSVMGVGVATLSIFALLFSSVSSHDFPTDGTVLELHDSNFDSAISAFDFILVDFYAPWCGHCKRLAPELDAAAPVL
    ASLKEPIVIAKVNADKFTRLAVKYDIDGFPTLKLFIRGVPMDYYGPRKADLLVRFLKKFVAPDVSVLVSDSAISSFVEAA
    GTHFPIYIGFGLNESMISNLAIKYKKKAWFSVAKDFSEDVMVAYDFDKVPALVSLHPSYNEHSVFYGPFDGEFLEDFMKQ
    TLFPLVLPINYDTLKLLKDDDRKIFLTFVDDELDEKSKKLINLLKAAASANRDLVFGFVGIKQWGEFADSFGANKKTKLP
    KMVVWDGDNQYFEVIGSESFDEIDQGSQITRFIEGYKEGRTVEKKIGGPSLIGYINSLIGIRTVYIIVFVVAVMMIIQSI
    NKEEPLTIGSGEDQTDQAWSSSLTDESREEYRPRDKED

    >gi|225431669|ref|XP_002263864.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MKCCPDFLRKARKLVGFIATTSAAAASLSSATSPKLSAASAMDDLKTLNTRLCIIGSGPAAHTAAIYASRAQLRPILFEG
    WMANDIAPGGQLTTTSDVENFPGFPDGINGNEIMDRCRAQSLRFGTEIFTETVTRVDFSSTPFKVFTDSKTVLADAVIVA
    TGAVAKRLPFPGSGDGPGGFWNRGISA
    CAVCDGAAPIFRDKPLAVIGGGDSAMEEATFLTKYGSKVYIIHRRDAFRASKI
    MQQRALSNPKIEAIWNSVVVEGHGDEKGRLLGGVKVKNVVSGEVSDLKVSGLFFAIGHEPATKFLDGQLKLDSDGYVVTE
    PGTTKTSVRGVFAAGDVQDKKYRQAVTAAGTGCMAALDAEHYLQEIGSQEGKSD

    >gi|225431914|ref|XP_002276853.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MHSSLSLSFSSSTAIPRSGHSSELSCAAPPSPLNLRFCGLRREALGFSSPKRNDSCRVIVSSRGRFKKVSASVSDNGSAP
    KAFDYDLVIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGT
    CVNRGCVPSKALLAVSGRMRELQSEHHLKALGLQVSAAG
    YDRQGVADHANNLASKIRNNLTNSMKALGVDILTGVGTILGPQKVKYGKVGFSENVITAKNIIIATGSVPFVPKGIEVDG
    KTVITSDHALKLESVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVF
    ASKITPAKDGKPVRIELIDAKTKEPKDALEVDAALIATGRAPFTNGLGLENISVVTQRGFIPVDERMRVIDADGNLVPHL
    YCIGDANGKMMLAHAASAQGISVVEQVTGKDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKAN
    TKALAENEGEGLAKLIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQDIKFAVHAHPTLSEVLDELFKSAKVHAH
    VPSPVSEPVTV

    >gi|225442595|ref|XP_002279221.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MFAAKPTSRFVYLTVTLLLLLSFFVSITAYETSDGNGDGEDEFEGIEELIALDEEEESQQNQGSHVKSTEAEVIVKAQRI
    VLELNSDNTKRIIDGNEYVLVLGYAPW
    CPRSAELMPQFAEAATSLKELGSPLLMSKLDAERHPKTASSLGISGFPTLLLF
    TNGTSQPYTGGFSSEEIVIWVRKKTGVPVIRINSVTEAEEFLKKHHTFAIGLFKKFVGCEYEEFVKAATSHNEIQFVEVN
    DIEVAKVLFPNIKPNSLFLGLVKSEMERYTTYEGTFEMDQILDFLDYNKFPLVTILTELNSIKVYSSPVKFQVFVFAKAD
    AFKNLLKLLQDVARKFVSKIMIVYVDITEDNLAKPFLTLFGLEDSEDTIVTAFDNKISSKYLLESDPTPSKIEEFCSGLL
    QGTLSPHFRSQAIPDNKEESVQIVVGKTFDNLVLSGDKNVLLEVYSPW
    CIDCETTSKQMKKLAKHFKGLDNLIFARIDAS
    ANEHPKLKVDDYPTLLFYKADDKSNPIKLSTKSSSKDLAAFINKNIGVQDQVSKDEL

    >gi|225469388|ref|XP_002263922.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAVISCAQALQFLQPRNLSFPPSGRLPSQFPRVCHVKTRVSFKSRKTTDITPNLLVRASSSSSDFTSTIGEILGEVSIFT
    ASGEPVLFKDLWDQEEGMAVVALLRHFG
    CPCCWDLASALKESKERFDSAGVKLIAVGVGTPDKARILAERLPFPLDCLYA
    DPDRKAYDVLGLYYGFGRTFFNPASAKVLLRFEALQKAVKNYTIKATPDDKSSVLQQGGMFVFKGKQLVYARKDEGTGDH
    APLDDVFDVCCKVPVA

    >gi|225469390|ref|XP_002263959.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAVIASAQTLHVLQPRSVSSPQSRRFPPRFPRAPHVKTSLSLKSTEAPNIRHSLLVRASSTSDFNPDIGEILGEVSVFTA
    SGESVLFKDLWDQKEGVAVVALLRHFG
    CFCCWELASALKESKARFDSAGVKLIAVGVGTPNKACILAERLPFPMDCLYAD
    PDRKAYDVLGLYYGLSRTLFSPASAKVFSRFESLQKALKNYTLEGTPDDKSGVLQQGGMFVFKGKQLLYAWKDEGTGDHA
    PLDDIFDACCRVPVA

    >gi|225425184|ref|XP_002264542.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MPPTHPHYKPTFSHHHSLHASRAVQMYYHHSESWGYYTAAAAAAAAARVMADPLERVARLASENAVVIFSLSSCCMCHAV
    KRLFCGMGVNPTVYELDQDPRGKEIERALMRLLGNSPAVPVVFIGGKLVGSMDSVMASHINGTLVPLLKEAGALWL

    >gi|225423716|ref|XP_002277886.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MIYFFTKPNTLLGGKENSVTFVQASFKHTLLMARSALDEMSESGAFMRTASTFRNFVTRDPNSPFPAESGRYHLYVSYAC
    PWASRCLAYLKIKGLDKAISFTSVKPKWERTRDTDEHMGWVFPASDTEEPGAGPDPLNGTRSIRELYELASTNYSGKYTV
    PVLWDKKLKTIVNNESSEIIRMFNTEFNDIAENPSLDLYPPHLQAQIDKINDWIYSGINNGVYKCGFAKKQEPYDEAVKN
    LYEALDKCEEILSKQRFLCGNTLTESDIRLFVTLIRFDEVYAVHFKCNKKLLREYPNLFNYTKEIFQIPGMSSTVHVEHI
    KKHYYGSHPSINPFGIIPQGPDVDYSAPHDRERFSS

    >gi|225429512|ref|XP_002278652.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MQGVRRFRTLTEGGVRLELTPTTTSPLAIDVTESTEMRIQRLISENPVIIFSRPSCCMCHVMKRLLSTIGVHPTVIELDD
    EEIGALAAHSADSTSTAPVAPAVFIGGTRVGGLESLVALHLSGHLVPRLVEVGALWV

    >gi|225448831|ref|XP_002282399.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSFEVCVKAAAGDPEILGDCPFSQRVLLTLEEKKVPYKMHLINVNEKPQWFLEMNPEGKVPVIKVDDKWVPDSDVITGVL
    EEKHPSPPLAPPPEHSSVGSKIFPAFVKFLKSKDPNDGSEQALLDELKALDDHLKDHGPYINGENICAVDLSLAPKLYHL
    QVALGHYKNWTIPESLSHVHNYMKLLFSRESFEKTKPAPDHVVAGWAPKVNA

    >gi|225467374|ref|XP_002269002.1| PREDICTED: hypothetical protein, partial [Vitis vinifera]
    APHVKTSLSFKSTEAPNIRHSLLVRASSTSDFNPDIGEILGEVSVFTASGESVLFKDLWDQKEGVAVVALLRHFGCFCCW
    ELASALKESKATFDSAGVKLIAVGVGTPNKACILAERLPFPMDCLYADPDRKAYDVLGLYYGLSRTLFSPASAKVFSRFE
    SLQKALKNYTLEGTPDDKSGVLQQGGMFVFKGKQLLYAWKDEGTGDHAPLDDIFDACCRVPVA

    >gi|225428957|ref|XP_002263818.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSETPFHPLFQTLEKLSHCIQNHLSNFIGGTPSHSSPTNERPHFSITSSSKANSSNKDFTLRQQKANPVTKVELGRATWT
    FLHTLAAQFPDNPTRQQKKDVKELMAILSRMYP
    CKECADHFKEVLRANPVQAGSQAEFSQWLCHVHNVVNRSLNKPIFPC
    KRVDARWGKLDCELRACDLQGTPDFGERSH

    >gi|225450563|ref|XP_002277564.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MALRLSSSQRHHTTPFIFPPPSISTPLSLIRRLSSRHVSLRHRRTAAPKACVKLEEKNVPETGKSQWGKVSAVLFDMDGV
    LCNSEEPSRRAGVDVFHEMGVQVTTEDFVPFMGTGEANFLGGVASVKGVKGFDPEAAKKRFFEIYLEKYAKPNSGIGFPG
    ALELINQCKSNGLKVAVASSADRIKVDANLAAAGLPLSMFDAIVSADAFENLKPAPDIFLAASKILDVPPGECIVIEDAL
    AGVQAAKAAQMRCIAVTTTLPEETLKAAGPSLIRKEIGNVSVHDILTGGSDCPNEKIQGSQYINSFEQTSPEVLKEGAES
    VSIQETNSDGGGVLSIAGLQGSRRDMVRYGSLGIALSCLAFAVSNWKAMQYASPKAIWNLLFGVNRPTFGKNEGESQTGR
    IQQFVNYISDLESRGNATTVPEFPSQLDWLNSAPLQLRRDLKGKVVVLDFWTYC
    CINCMHVLPDLEFLETKYKDKPFTVV
    GVHSAKFDNEKDLEAIRNAVLRYGINHPVVNDGDMYLWRELGVNSWPTFAVVGPNGKLLAQLSGEGRRKDLDDIVAAALI
    FYGEKKMLDNSPLPLSLEKENDPRLLTSPLKFPGKLAIDVINNRLFISDSNHNRIVVTDLNGNYILQIGSTGEEGLRDGS
    FDDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNETVQTLAGNGTKGSDYQGGGKGATQLLNSPWDVCFEPINEIV
    YIAMAGQHQIWEHNTLDGVTRAFSGDGYERNLNGYSSTSTSFAQPSGISLSPDLKEVYIADSESSSIRALDLKTGGSRLL
    AGGDTVFSDNLFRFGDHDGVGSEVLLQHPLGVSCGKDGQIYVADSYNHKIKKLDPATGRVSTLAGTGKAGFKDGRALAAQ
    LSEPSGIVEVENGVLFIADTNNSVIRYLDLKKKEADLVTLELKGVQPPIPKSRSLKRLRRRSSADTQTITADGTSSNEGN
    LYIRISVPEGYHFSKEAQSKFSIETEPETTMVIAPLDGILSPGGFATLHFRRSSPSAFMARVNCKVYYCKEDEVCLYQSV
    AFEVPFRDAIPGSSPAEISLDYAVKPKTPTNSLLAVAR

    >gi|225435482|ref|XP_002282923.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MEINGKDELKLPLLQPLDGVVVTASQPSTIIDKKIKTVMFKIGNIACASCATSIESVLLELNGVESVMVSVLQGQAAVKY
    IPELITANAIKEAIKDAGFPVDDLPEQEIAVCRLRIKGMA
    CTSCSESVEHALSLVDGVKKAVVGLALEEAKVHFDPSITD
    FNHIVEAVEDAGFGADVINSGNDVNKVHLKLEGISSEEDINIIQSYLESVEGVNDVEMDLAENKVTVSYDPDLTGPRSLI
    CCIEKAGQGSNFYHATLYSPPRQRETERQQEIWMYRNQFIWSCLFSIPVFIFAMVLPMLHPYGNWLDFKVQNMLTVGMLL
    RWILCTPVQFIIGRRFYVGSYHALRRRSANMEVLVALGTNAAYFYSVYIVIKALTTDMFEGNDFFETSAMLISFILLGKY
    LEVVAKGKTSDALAKLTDLAPDTAHLIALDDEDNVISDIEISTQLIQRNDILKIVPGEKVPVDGIVVNGQSHVNESMITG
    EARPIAKKPGDKVIGGTVNENGCILVKATHVGSETALSQIVQLVEAAQLARAPVQKLADQISRFFVPTVVVVAFITWVAW
    FTLGELGSYPKHWMPKGMDGFELALQFAISVLVVACPCALGLATPTAVMVATGKGASLGVLIKGGNALEKAHKVKTIVFD
    KTGTLTVGKPVVVSAVLFSSFSMEEFCDMTTAAEANSEHPLAKAVVEYAKRLRQKFGPQTEQMTDIKEFEVHPGAGVSGK
    VGDKLVLVGNKRLMQDSSVPVSPEVENHIAETENLARTCVLVAINGKVAGAFAVTDPVKPEAGRVISFLHSMDISTVMMT
    GDNWATATAIAKEVGIKEVYAETDPLGKAERIKNLQMKGMTVAMVGDGINDSPALVAADVGMAIGAGTDVAIEAADIVLI
    KSNLEDVITALDLSRKTMSRIRLNYVWALGYNVLAMPVAAGILFPLDGIRIPPWLAGACMAASSVSVVCSSLLLQSYKKP
    LHVEDARDVSHNSNSK

    >gi|225429325|ref|XP_002271696.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MENPNVQEILEKQVLTVAKAVEDKIDEEIAALERLDLDDIEALRERRLQQMKKMAEKRSRWISLGHGEYSEIPSEKDFFA
    AVKASERVVCHFYRPNWP
    CKVVDKHLSILAKKHIETRFVKINAEKSPFLAEKLKIVVLPTLALIKNAKVDDYVVGFDELG
    GTDEFSTEELEERLAKAQVIIFEGESSLHASKSSSQPRSVRQSSNSYSSDSD

    >gi|225446341|ref|XP_002272256.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATALHSVVLPCSSSSDPRAALLPGVMPSPTVVSVGRSSFSLPEFSGLKIHTNSSSALASLNSRTSRVCRRGGRIVCEAQ
    ETALDVPIVTDTTWQSLVLKATGPVLVEFWAPW
    CGPCRIIHPVVAELSEEYAGKLKFFKLNTDDSPSIATQYGIRSVPTT
    MIFINGEKKDAVLGAVPKTTLTASIEKFL

    >gi|225457383|ref|XP_002284847.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MACSLKTGLCISGMMEASFRPKSKGVHESCASFGSLKFKESLVLGSRFTGKHVFITDQKCLRDWSFKAPYKFSVHAQASI
    CVSRALRWWEKTLKTNMVEIHSAQELVDSLLNAGDRLVVVDFYSPR
    CGGCKALHPKICQLAELNPNAIFLKVDYEELKTM
    CHALHIHVLPFFRFYRGAEGRV
    CSFSCTNATIKKFKDALAKHGANRCSLGPAKGLDESELLKLAAVGEIPLNLPLPSSKG
    EVMEDSALKGAHMSGFWGKAGSNMELEEESAILKV

    >gi|225462568|ref|XP_002268262.1| PREDICTED: hypothetical protein [Vitis vinifera]
    METMVSNSMPISVSSLPPVRVVASPRKLEFSSFTPKTTLFGSRSQRKIGFRCSPVRRAAVTCGVVTEIKESQFSDVVLKA
    DEPVLVEFVATW
    CGPCRLISPAMEAIAQEYGDRLTVVKIDHDANPRLIEEYKVYGLPTLILFKNGQEVPESRREGAITKG
    KLKEYVDALLESISVA

    >gi|225441181|ref|XP_002269130.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MARSISYITGSQLLALKRRPNIAIVDVRDDERSYDGHIAGSLHYASDTFSDKISNLVQEVKGKDTLVFHCALSQVRGPTC
    ARRLATYLTGVENEEIKNILVLERGFNGWEASGRPVCRCTGIPCKGDNAQ

    >gi|225424879|ref|XP_002274663.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGASHSSSSKSSRVLTFNSSASWKIHFEEAKSTGKLMVIDFSATWCGPCRFMEPVINEFAEKYTDVEFVKIDVDELSDVA
    QEFGVQGMPTFLLIKRGTEVDKVVGAKKEELQKKIEAHRKN

    >gi|225446791|ref|XP_002283209.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MVVKVYGPAFACPKRVLICLVEKEIEFETVPVDIIKGEHKDPEYLKLQPFGVVPVIQDGDYTLYESRAIIRYYAEKYKSQ
    GTDLLGKTIEERGTVEQWLEVEAQNYHPPIYNLVLHVLFSDKMGFPADAKVIEESEKNLGKVLDIYEERLSKSKYLAGDF
    FSLADLSHIPFTNYLGAMGKMYLIKEREHVSAWWDDISSRPSWKKVLELYPAPILE

    >gi|225455185|ref|XP_002269275.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGEEAKEQAPAEVKPEAEEKKEEKAEEKKEEKPEEPKEEPKPPLPFVLFVDLHCVGCAKKIERSLMKIRGVEEVMIDMAQ
    NQVTIKGIVEPQAVCNRIMKKTKRRAKVLSPLPEAEGEPMPEVVSSQVSGLTTVELNVNMHCEACAAQLKRKILKMRGVQ
    TAETELSTSKVTVTGTMDADRLVDYVYRRTKKQARIVPQPEPEKQEENKEGEKPAEETKPEEKKEENAEKAEEGKPPEEA
    KKGEEGNGGENNESKEEKGGENKEEGKVGEIPMDDETMKRMMYYYQPLYVIERMPPPQLFSDENPNACCIS

    >gi|225466265|ref|XP_002271709.1| PREDICTED: glutathione S-transferase [Vitis vinifera]
    MVMKVYGPVRAACPQRVLACLVEKGVEFEVVHVDLDSGEQKRPDFLLRQPFGQVPVVEDGDFRLFESRAIVRYIAAKYAE
    QGPDLLGKSLEEKAVVDQWLEVEAHNFNELVYTLVMQLVILPRMGERGDLALAHTCEQKLEKVFDVYEQRLSKSRYLAGD
    SFTLADLSHLPAIRYLVKEAGMAHLVTERKSVSAWWEDISNRAAWKKVMELAA

    >gi|225466854|ref|XP_002263393.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MARNSVLLRHLLRFSPSSRARSSSLIETLASSPIAVPSPPIHTISSFFTTATANSQFSRPCLNYRTLCSSSGQSKIALIK
    SEEEFNTSLSKVQDESLPAIFYFTAVW
    CGPCRFIAPIIAELSEKYPHVTTYKIDIDQDGLENTLRRLNIASVPTLHFFQN
    GKKAAEIIGADVARLKDTMDKLYKKD

    >gi|225438351|ref|XP_002273664.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAAVVKYGKKMNKGRGKKVPISAVEGEFVVTLDYSNFTETVAKQDFIVVEFYAPWCGHCQQLAPEYEKAASVLSSHDPPI
    ILAKVNGDDAANRQLGQKFDIKGFPTLFIVKDGGKKVQEYNGPPDADGIVNYLKRQLGPASTEIKSSEDAATFIDEKGVA
    IVGVFPDFSGEEFDNFISIAENLRSDYVFGHTLDAKLLPRGESSVKGPIVRLFKPFDELYVDFQDFEVDALEKFVKEASM
    PLVTIFDSDPSGHGYVAKFFDLPNDKVMLVVEFNSEEFDAFNSKYRDAAELYKGKNLGFLLGDVNVSEGAVEYYGLKADQ
    TPLIIIDNNDLDTRYFEAKIKPDQIAPWLEEYLDGRLKPFIKSQPIPETNDGPVKVAVFETLEEIVFNSGKNVLIEFYAP
    W
    CGHCQRLAPILEEAAVSFQNDPDIIIAKLDATVNDIPKKFKVEGFPTMYFKPANGELVEYGGDATKEAIIDFIKEKRDK
    SIQEGSARDEL

    >gi|225451695|ref|XP_002278830.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSFATTLHSPQPLLKDQTPLFALRVGSLAARPSLVAYRRGSFRTLTIGDGLVIGAKSGRIGSFRCFSALTPELKTTLDKV
    VTSNKVVLFMKGTKEFPQ
    CGFSNTVVQILNSLNVPFETINILENEILRQGLKEYSNWPTFPQLYIEGEFFGGCDITVDAY
    NSGQLQEQLEKAMCS

    >gi|225466269|ref|XP_002272053.1| PREDICTED: similar to glutathione S-transferase [Vitis vinifera]
    MVVKVYGAVMTACPQRVLACLVEKGLEFEVVHVDLDFGEQKRPEFLIRQPFGQVRVMEDGDFRLFDSRAIIRYIVAKYVD
    EGPNLVGRNLEERSLVDQWLEVEENNLNPLIFTVVLQLVILPRMGEKGDLTLVRNCEQKLDKVFDAYEQRLSKSSYLGGD
    SFTLADLSHLPGIRYLVNEVGIGHLITERKNVSAWWENISNMPAWKKVMNLAS

    >gi|225441195|ref|XP_002266281.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAHNWAALIYVVLTNRLRRKREAAGGGHKPNVNQEMSETDLEGTGLNLAVNRHGNLTSASNDQDLTNVLHQIKSSKSPAV
    INYGSTW
    CRVCNQILPAFCQLSNNFPKLSFIYADIDECPETTQHIRYTPTFHFYRDGERVDEMLGAGEERLHDRLWLHS

    >gi|225465619|ref|XP_002266846.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDPDSVKSTLSNLAFGNVMAAAARDYQKEVLSQQKAQASNSINQEVDLDELMDDPELERLHADRIASLKKEAEKRQALKK
    QGHGEYREVTEADFLGEVTGSEKVICHFYHREFYR
    CKIMDKHLKSLAPRHMDTKIIKLDAENAPFFVAKLGVKTLPCVIL
    FRKGIAVDRLIGFQDMGGKDDFATRTLEALLIKKGIVSEKKKDEDDEDRGYPESRRNTVRSSVDPNSDSD

    >gi|225444633|ref|XP_002275936.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASLFLPKHSLPSLLSTQIPKTPSLHSLPLVSKSSHSQFYGLTFSSSPSLPLPSSSSPKKASIFAKVSKGQVPPPFTLKD
    QDGKTVSLSKFKGKPVVVYFYPADETPG
    CTKQACAFRDSYEKFKKAGAQVVGISGDDPSSHKAFAKKYRLPFTLLSDDGN
    KVRKDWGVPADLFGTLPGRQTYVLDKKGVVQLIYNNQFQPEKHIDETLKLLQTL

    >gi|225459587|ref|XP_002285864.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATRVSICLFVLAFAFSILASSPVKISAAEDEAKEFVLTLTHSNFSDIVSKHDFIVVEFYAPWCGHCKKIAPEYEKAASI
    LSSHDPPIILAKVDANDDANKELASEFEIRGFPTLKILRNGGKSIEEYKGPREADGIVEYLKKQSGPASAEIKSAEDASS
    LIVDNKIVIVGVFPKFSGEEFENFTAVAEKFRSDYDFVHTSDAKFLPRGESSVTGPLVRLLKPFDELFVDFQDFHVDALE
    KFVEESSVPIVTLFNKDPSNHPFVIKFFNGPNAKAMLFLDHSSELFDAFKSKYHEVAEQYKGKGINFLLGDLEASQGAFQ
    YFGLKDDQVPLIVIQTNDGQKYLKPNLEPDHIAPWVKEYQDGKVLPYKKSEPIPEVNNEPVKVVVADTLQEIVFNSGKNV
    LVEFYAPW
    CGHCKKLAPILDEVAISFENDADVVIAKLDATANDIPNDTFDVKGYPTLYFKSASGNISQYEGDRSKEDIIE
    FIKKNRDKAAQQEGSKDEL

    >gi|225450619|ref|XP_002278080.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSSLSLRISSSVAATARSESDHRLRLLSSSSPTVATSPALHFCGLRTEALKLGANSNRWKVVSAAVAPQNGSASDEFDYN
    LVIIGAGVGGHGAALHAVEKGWKTAIIEGDVVGGT
    CVNRGCVPSKALLAVSGRMRDLQDEHHMKAFGLQVAAAGYDRQGV
    ADHANNLASKIRSNLTNSLKGLGVDILEGVGTILGPQKVKYGKVGSSGNVITAKDIIIATGSVSFVPKGVEVDGKTVITS
    DQALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFVEALDQLMPGFDPEIGKLARRVLINPRKIDYYTGVFASKITP
    AKDGKPVMIDLIDAKTKEPKDTLEVDAALIATGRAPFTKGLGLENIRVETQCGFVPVDEHMQVIDADGKLVPHLYCIGDA
    NGKMMLAHAASAQGISVVEQISGKDNVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTGFKANTKVLAE
    NEGEGLAKLIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQDIKFAVHAHPTLSEVLDELFKSAKVKINISSPGV
    APVTV

    >gi|225431368|ref|XP_002271073.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MEKEMIAKSFISSAAYAPSLLPLLSPSRNLNFRCLSPLKANPQRCVVGGTKRFCRVVAARGNLESTGVPTSVPVRVALEL
    LQAGHRYLDVRTPEEFSAGHASGAINVPYMLRFGSGMAKNPKFLVEVSSHFRKDDEIIVG
    CQKGKRSLMAVNDLLAAGFT
    AITDIAGGYDAWSQNGLPTDS

    >gi|225450626|ref|XP_002282603.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
    MSIWWALQTLALLLVFTAVSADDVVVLTEANFEQEIGKDRSALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVD
    CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARSAEALAEFVNNEGGTNVKIAAVPSNVVVLTSDSFDEVVLNEKKD
    VLVEFYAPW
    CGHCKSLAPIYEKVATAFKSEGDVVIANLDADKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLEDF
    VTFINDKCGTSRDGKGQLTSKAGTVASLDSLVKEFISASDDEKKAVFARIEEEVEKLEGSAARYGKIYVKAAKSSLQKGA
    DYAKNEIQRLERMLEKSINQAKADEFILKKNILSTFA

    >gi|225450628|ref|XP_002282610.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
    MSIWWALQTLALLLVFTAVSADDVVVLTEANFEQEIGKDRSALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVD
    CDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGARSAEALAEFVNNEGGTNVKIAAVPSNVVVLTSDSFDEVVLNEKKD
    VLVEFYAPW
    CGHCKSLAPIYEKVATAFKSEGDVVIANLDADKYKDLAEKYGVSGYPTLKFFPKGNKAGEDYDGGRDLEDF
    VTFINDKCGTSRDGKGQLTSKAGTVASLDSLVKEFISASDDEKKAVFARIEEEKGADYAKNEIQRLERMLEKSINQAKAD
    EFILKKNILSTFA

    >gi|225439398|ref|XP_002263823.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATISLSSIHTSPSSLRLLSSYSSQNTPTLSFYSHTKPSLSFSSVSLKPITTARSRTLTVVSAFGKLSETEPIPLPPAPE
    EIAGKFPSESGVYAVYDQSDVLQFIGITRSIAASVLAHRKSVPELCCSVKVAVVDEPDRTALTQAWKSWMEEHIGATGKI
    PPGNESGNTTWVRQPPKKKPDLRLTPGRHTQLTVPLETLIDRLVKENKVVAFIKGSRSAPL
    CGFSQRVVGILESEGVDYE
    SLDVLDEEHNYGLRETLKKYSNWPTFPQIFVNGELVGGCDILTSMHEKGELVGLFKK

    >gi|225456991|ref|XP_002282196.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGSVLGKGKSKEEVEMALAKAKEIVSSTPVVVFSKTYCGYCKRVKQLLSQLKATHKTIELDQESDGAEIQSALREWTGQS
    TVPNVFIGGKHMGGCDSVMEKHQEGKLVPLLKEAGAIAEVSTQL

    >gi|225424162|ref|XP_002284039.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSPLVVLLILLLFSCSPSSSVPIGSRDILRAIDIDSNTGPDLHDAAVDLNTTNFDQVLRNTPATYAIVEFFAHWCPACRN
    YKPHYEKVARLFNGPDAVHPGIILMTRVDCASKINTRLCDNFSVGHYPMLLWGNPSKFVSGSWDPKKDKNEIRLIDDGRT
    AERLLNWINKQIGSFFSLDDQKFENDHLASNASDPEQIARAVYDIEEATSTAYDIILEQKMIKSETRASLIKFLQILVVH
    HPSRRCRKGSAEVLVNFDDLCPSDMGTPNKQEATDGNGKGALRNFQICGKEVPRGYWMFCRGSKNETRGFSCGLWILLHS
    LSVRIEDGETQLAFTAICDFIHNFFI
    CEECRQHFYEMCLSVSSPFNKTRDFALWLWSAHNKVNVRLIKEEASLGTGDPKF
    RKIIWPSKQLCPSCYFSLSKNNDGTSQIDWNRDEVFKFLVSYYGKMLVSLYKDKGLLGDDGTDRVSLEDLATTTNAVVVP
    VGAALAIALASCAFGALACFWRSQQKNRKPRRSWN

    >gi|225447176|ref|XP_002276520.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MARSPPLITLPFLTIFIVVQLSATAYGLYGPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAASVL
    KGVATVAALDADANQALAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQIKALLKERLSGKATGGSSEKSEI
    SSSVELTSSNFDELVLKSKDLWIVEFFAPW
    CGHCKKLAPEWKKAANNLKGKVKLGHVDCDSDKSLMSRFSVQGFPTILVF
    GADKDTPVPYEGARTASAIESFALEQLETNVAPPEVTELTGPDVMEEKCGSAAICFVAFLPDILDSKAEGRNKYLEMMLS
    IAEKFKRSPYSYVWAAAGKQADLEKQVGVGGYGYPALVALNVKKGAYAPLKSAFELDQIIGFVKEAGHGGKGILPLASTP
    VVVKTEPWDGKDGEIIEEDEFSLEELMGDDATS

    >gi|225433440|ref|XP_002285672.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MARKMLIDGELSKPNEEETHYDFDLFVIGAGSGGVRAARFSANFGAKVAICELPFHPVSSEVIGGVGGTCVIRGCVPKKI
    LVYGASFRGEIEDAKNYGWELNDKVDFNWKKLLHKKTEEIVRLNGIYKRLLTNAGVKLYEGEGKIVGPNEVEVTQLDGTK
    LCYSAKHILIATGSRAQRPTIPGQELSITSDEALSLDELPKRAVILGGGYIAVEFASIWNGMGVAVDLFFRKELPLRGFD
    DEMRAVVARNLEARGINLHPRTTLSELVKTEDGIKVITDHGEELTADVVLFATGRAPNTKRLNLEVVGVELDKMGAVKVD
    EYSRTNIPSIWAIGDVTNRMNLTPVALMEGTYFAKTVFGGQPSKPDYKDIPCAVFCLPPLSVVGLSEEQATDQAEGDILV
    FTSTFNPMKNTISGRQEKTIMKLLVDAETDKVLGASMCGPDAPEIMQGIAVALKCGATKAQFDCTVGIHPSAAEEFVTMR
    SVTRRIAAGNKPKTNL

    >gi|225441603|ref|XP_002276765.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATSVAWLLFLYIGAVSSLPGTLSSSVCPLQSDFLVAFLQSQCPLSLSSHALLDVDGNFLDRALTSKQGNGFTSVLFHAS
    W
    CPFSCKMRPKFEVLSSMFPQIEHLAIKESSASPSMFSRYGIHSLPSILIVNQTSRMRYHGPKDLPSLVKFYRKTTGLEP
    VQYFAEDQTISFEKSEGQSILQPWNGSYVKEIFTREPYLAFSILFFCLRVVLALFPGLLSQLKAFWVLYVPHLNLEIFGE
    TSQMLGRVLNMIDVQRVWAKLKLCKIRNFREGAKSARVWASSLASVSLGETSSSGSSSGTGSILQTPHEMDLEEWEYLPD
    DGFLDFSEDGGRKIFIRDSDPNSKGVFDMNYFICPTPKRETWVEPPPLSPRLPKQLLPLQIRLDPPPIVDEEVVKHITKI
    PLQIEALPPPVIRVPSLEALKEADQDTVSQVFFKKMKENEFVDMKMDSPKSGSRGILPQIEAGGFQFEEKDEKMENTHNP
    SKKNNLGPAPGPDIKEDEEGSWTESSGRFNVWKWSLTGIGALCSFGVAATTICIIIFASSQRNKHHQHNQRLRFQIITDD
    KRIKRVVHHATQLNEAFSAVRGVPLTRAHITFGGYYDGL

    >gi|225439410|ref|XP_002264265.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDRAQLLLVGLPLFLFFSDIINLFTPPPPKPPPHHHHQQPQPKPQSAPLDFPTQKESGIGGIGFGNTVNINFCSSCSYRG
    NAVTMKNMLESQFPGVTVVLANYPPPLPKRLLSKVVPVVQIGVIGIVMAGEQIFPRLGFIAPPPWYYSLRANRFGTISTT
    WLLGNFLQSFLQSSGAFEVYCNGELVFSKLKQQRFPGEIELKDLVGQRLVASRIVDDVGAGVWSQPL

    >gi|225460612|ref|XP_002264005.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MANMKNQSHCLLLLLVLITIFSSLKTTKAEVITLTADTFSDKVKEKDTAWFVQFCVPWCKHCKNLGSLWEDLGKIMEGED
    EIEIGQVDCGVSKSVCSKVDIHSYPTFKVFYDGEEVAKYQGNF

    >gi|225463236|ref|XP_002268501.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MANGSGTYGDFFQQEKLKTVEDGSCRVSSGREEGGTWAAGRGSLSRLNNQSYNIKLCFGWKPLVHATIFIGELVTSKSRV
    VTTAPIAVDGVIPDSTLGYSDEKDKLQQASVPSLAAGKKVIICCVLGALTPT
    CNVKHVPSFIEKDEIIQTRGVGGKLLVP
    SIIHNSWNSTPPKSRNSYVMFGFR

    >gi|225452402|ref|XP_002276266.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MALQKAQEMVSSNPVVVFSKTYCPFCVSVKKLLSELGATFKVVELDTESDGADLQSALAGWTGQRTVPNVFIGGKHIGGC
    DTATALHSDGKLVPLLTEAGAITSSSNEGSSVTC

    >gi|225440888|ref|XP_002282626.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSRSVLRRLHTFIAARIRQNQALLLTTSALHHSPSPSQSPSLDAIQMTDNCVQRIKELQTNEASMKDKMLRLSVETGGCS
    GFQYVFLLDDKTNSDDRIFERDGVKLVVDKISYDFVKGATVDYVEELIRSAFLVSTNPSAVGGCSCKSSFMVKE

    >gi|225440900|ref|XP_002282752.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASSFLAAAAAKAGPSLRRQALTLTDAAASRIRHLLQQRQRTFLRLGVKARGCNGLSYTLNYADDKGKFDELVEDKGVKI
    LIDPKALMHVIGTKMDFVDDKLRSEFIFINPNSKGQCGCGESFMTTGNPGAAK

    >gi|225448275|ref|XP_002274497.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MESTLCTMSKTLASTSNPFFFTSSLHRRFPKALFSQCLRSRLTSPNLSSPSLRALSAFRSPLRCFSSSAASFAAGGGGGG
    PNGEFGGDGGGGDGGDTNPKAAAAEEVTGFSPDVIILDVGGMT
    CGGCAASVKRILESQPQVSSVSVNLTTETAIVWPVSE
    AKVIPNWQQQLGEELAKHLTNCGFKSNPRDSVRDNFFKVFERKMDEKRNKLKESGRELAVSWALCAVCLFGHLSHFLGTK
    ASWIHAFHSTGFHLSLSLFTLLGPGRGLILDGLKSFLKGAPNMNTLVGLGAVSSFSVSSLAALIPELGWKAFFEEPIMLI
    AFVLLGRNLEQRAKIKATSDMTGLLSILPAKARLFINGDSEEFSSTVEVPCNNLSVGDQIVVLPGDRVPADGIVRAGRST
    VDESSFTGEPLPVTKLPGAEVSAGSINLNGTLRVEVRRPGGETAMGDIVRLVEAAQSREAPVQRLADKVAGHFTYGVMAL
    SAATFMFWNLFGARILPAAFHQGSSVSLALQLSCSVLVVACPCALGLATPTAILVGTSLGATKGLLLRGGNILEKFSEMN
    TIVFDKTGTLTIGRPVVTKVVTPGCEKDTDSRKSSKSIWSEVEVLKLAAGVESNTIHPVGKAIVEAARAVNCQNVKVVDG
    TFVEEPGSGAVATVENKKVSVGTFDWVQRHGVQENPFQEVDELKNQSVVYVGVDGTLAGLIYFEDQIRDDARHVVESLSR
    QGISVYMLSGDKRNAAEHVASSVGIPKDKVLSGVKPNEKSKFIRELQKAHNTVAMVGDGINDAAALASSDIGIAMGGGVG
    AASEVSSIVLMGNRLSQLLDAFELSRLTMKTVKQNLWWAFAYNIVGIPIAAGMLLPITGTMLTPSIAGALMGLSSVGVMT
    NSLLLRSKFSAKQKQIYEASPNSKAYLVPDRPGDQKEKLKQHSYSPSR

    >gi|225460881|ref|XP_002278487.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MESNGEDASRILREIETLKAAKADIEHRISVLEARLRDIPLPNDAISGVSCSSMSIADSAAGHGLSPDMIYRYSRHLLLP
    SFGVQGQSSLLKSSILVVGAGGLGAPALLYLAACGVGCIGTVDHDVVELNNLHRQIIHTEAYVGQPKVQSAAAACRSINS
    TIQIVEHKEALCTSNALEILSKYDLVIDATDNVPSRYMISDCCVVLGKPLVSGAALGLEGQLTVYNYKGGPCYRCLFPTP
    PPTTACQR
    CSDSGVLGVVPGIIGCLQALEAIKIASAVGEPLSGRMLLFDALSARIRIVKIRGRLSQCEVCGENATFTQQK
    FQDFDYEKFTRSPLSTTPLKLNLLPADSRITSKEYNDRLVNGEAHVLVDVRPSHHFNIVSLPKSLNIPLSSLETRMSEIS
    SALKEEEEQKGSNHSGTSIYVV
    CRRGNDSQRAVEYLHKIGFTSAKDIIGGLESWAHDVDPNFPTY

    >gi|225469189|ref|XP_002275683.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MENQEPEENKSRVIKVVSEELWDFYISQATTQGCPVVVHFTAAWCIPSVAMNQFFEELASNYPDALFLTVDVDEVKAVAV
    KMEVKAMPTFLLMKEGAQVDRLVGANPDEIRKRIDALVQSFRVYVA

    >gi|225439771|ref|XP_002273449.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAISLSTTILPNTIQRRRITILPSPRVSRNLGFSLSFRPCNESIELSSSRRVITASAASGSPGIESSTVSDDTTNLLDRA
    QVFDLNGNGIPISDLWKDRKAVVAFARHFG
    CVFCRKRADLLASQKDRMDASGVALVLIGPGSIDQAKAFSEQTNFKGEVY
    ADPSHSSYEVLGFVSGVLSTFTPQAGLKIIQLYMEGYRQDWGLSFQRDTVTRGGWQQGGIIVAGPGKSNISYIHKDKEAG
    DDPDMEDILTACCS

    >gi|225460644|ref|XP_002266350.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATSLTFSTVRALNSQRPTPLAFSSSSPSSKLFSSSPLQFPRQLRPIRIGNNGISSPSRPRTLPVVEAKKQTFSSLDELL
    ANSEKPVLVDFYATW
    CGPCQFMVPILNEVGASLKDKIQVVKIDTEKYPSIADKYRIEALPTFIIFKDGKPYDRFEGALTA
    DQLIQRIETTLKVKQ

    >gi|225439775|ref|XP_002275882.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATTCVEEVLPPVLDSTSDQPPLFDGTTRLYISYSCPFAQRVWITRNYKGLQEQIKLVPLNLQNRPAWYKEKVYPENKVP
    ALDHNNKVIGESLDLIKYVDSNFGGPSLCPDGPGKREFAEELISYTDTFNRILYTSLKGDPTKEVGGPFDHLETALHKFD
    DGPFFLGQFSLVDIAYIPFVERFQIFLSEVWKYDITVGRPKLAAWIEELNKIGAYKQTKCDPKELVEAYKKRFLTQ

    >gi|225466810|ref|XP_002276283.1| PREDICTED: hypothetical protein, partial [Vitis vinifera]
    EKPPVEPGSVNDNVTQAASSSTDPGLPEFPSKDINRRIAVVSSLAAVGLFLSKRLDFGVSLKDLSAAALPYEEALSNGKP
    TVVEFYADW
    CEVCRELAPDVYKVEQQYRDRVNFVMLNVDNTKWEQELDEFGVEGIPHFAFLDKEGNEEGNVVGRLPKQYF
    QENVEALAHGEASIPHARVVGQYSSAESRKVHQVVDPRSHGRG

    >gi|225439785|ref|XP_002276301.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATTCVEEVLPPVLDSTSDQPPLFDGTTRLYISYSCPFAQRVWITRNYKGLQEQIKLVPLNLQNRPAWYKEKVYPGNKVP
    ALEHNNKVIGESLDLIKYVDSNFGGPSLCPDGPGKREFAEELISYTDTFIRIVYTSFKGDPAKEVGATFDHLETALHKFD
    DGPFFLGQFSLVDIANIPFVEKFQIFLSEVWKYDITAGRPKLAAWIEELNKIGAYKQTKCDPKVVVEAYTKLFLTQ

    >gi|225431104|ref|XP_002265009.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDSQSSATEVVTIDVHAAKDLINSGYRYLDVRTVEEFKKGHADVENILNIPYLFTTPEGRVKNPEFLEQVQFACSKEDHL
    IVG
    CQSGVRSLAATSVLVSAGFKDVKDIGGGYLAWVQNGLVATKPKEEL

    >gi|225431108|ref|XP_002265164.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDSEKSPATEFISADAHEAKDLIASGYRYLDVRMVEDFNKGHVDVESVFNIAYFIMTPEGRVKNPQFLEQVLSVCSKEDG
    LIVG
    CGTGDRSRLATVDLLNADFKHVRNMGGGYRSWHEAGLGVKKEA

    >gi|225444425|ref|XP_002270415.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
    MGGSVKDVESKEELDNVVRQGAPVILHFWASWCEASKHMDQVFSHLSTDFPQAVFFRVEAEEQPVISEAYSVSAVPYFVF
    FKDGKTVDTMEGADPSSLANKVAKVAGSINPGEAAAPASLGMAAGPTVLETVKEFAKENGASQVESQLPSGLSDTLKIHL
    QKVIETQPVMLFMKGSPEEPK
    CGFSRKVVEILREEKVKFGSFDILLDTEVREGLKKFSNWPTFPQLYCKGELLGGCDIAI
    AMHESGELKEVFRDHGIETSDLNEAKETKPGSGKGGISESTGLSVTLTSRLESLINSSPVILFMKGKPDEPR
    CGFSRKVV
    EILQQEKVDFGSFDILSDDEVRQGLKVHSNWSSYPQLYIKGELIGGSDIVLEMQKSGELERVLAEKGITQKETLEDRVRN
    LINSSPTMLFMKGTPDAPK
    CGFSSKVVDALRAENVSFGSFDILTDEEVRQGLKVFSNWPTFPQLYYKGELIGGCDIIMEL
    RNNGELKSTLSE

    >gi|225444427|ref|XP_002270454.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
    MGGSVKDVESKEELDNVVRQGAPVILHFWASWCEASKHMDQVFSHLSTDFPQAVFFRVEAEEQPVISEAYSVSAVPYFVF
    FKDGKTVDTMEGADPSSLANKVAKVAGSINPGEAAAPASLGMAAGPTVLETVKEFAKENGASQVESQLPSGLSDTLKIHL
    QKVIETQPVMLFMKGSPEEPK
    CGFSRKVVEILREEKVKFGSFDILLDTEVREGLKKFSNWPTFPQLYCKGELLGGCDIAI
    AMHESGELKEVFRDHGIETSDLNEAKETKPGSGKGGISESTGLSVTLTSRLESLINSSPVILFMKGKPDEPR
    CGFSRKVV
    EILQQEKVDFGSFDILSDDEVRQGLKVHSNWSSYPQLYIKGELIGGCDIIMELRNNGELKSTLSE

    >gi|225429688|ref|XP_002280050.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MANCNRYKPAAGGIQLVLTLLTQRLPTSSAPLFLTTRSAGAEDIEITDVSRAHSTGFQGFNERLSLRYQSSLSFGSHQFS
    FSSPSLAMTSDLLRISLYPPRNLCFSYDSKSNVHGFSFSSLPQRRRSQRLWKVSGRRAPNFNFIFSKAIDIRAPVKSTPL
    TEEQRPRGDSPLLLDVTGMV
    CGACVARVKSVLSADERVESAVVNMLTETAAVRIRPEVVEETVGESLARRLTECGFPTKE
    RVSGTGVEENVKKWREMGEKKEALLVKSRNRVAVAWTLVALCCGSHASHILHSLGIHVDHGSFWELLHNSYVKGGLALGA
    LLGPGRELLFDGLRAFSKGSPNMNSLVGFGSVAAFGISMVSLFNPGLQWDASFFDEPVMLLGFVLLGRSLEEKARIRASS
    DMNKLLSLISTRSRLVITSSESDSSTNSILCSDAMCIEVPTDDIRVGDSVLVLPGETIPVDGRVLAGRSVVDESMLTGES
    LPVFKEEGFVVSAGTINWGGPLRIEASSNGSNSTISKIVSMVEDAQGRAAPIQRLADSIAGPFVYIVMTLSAATFTFWYY
    LGTHIFPDVLFNDIAGPDGNPLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLASVDHVAF
    DKTGTLTKGKPAVSAVASLAYEEQEILRIAAAVEKTAVHPIAKAIVNKAESLNLTIPITTAQLVEPGFGSLAEVDGRLVA
    VGSLEWVQDRFQRRTNHSDLMNLENAMMHHLSNEVSLSNHSRTVVYVGREGDGVIGAIAVCDSLRHDANSAVTRLQEKGI
    KTILLSGDREEAVATIAKTVGIESEFINSSLTPQQKSGVIKSLQTAGHRVAMVGDGINDAPSLALADVGIALQVESQQSA
    ASDAASIILLGNKISQVADALDLAQATMAKVYQNLSWAVAYNVVAVPIAAGVLLPRFDLAMTPSLAGGLMALSSIFVVTN
    SVLLQLHGSDKNRKS

    >gi|225436960|ref|XP_002276256.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGASQSGSEKSIHEFRVKDYKAKDVDLSVYKGKVLLVVNVASKCGLTDSNYTQLTELYNKYKDRGFEILAFPCNQFLKQE
    PGSSEQAQEFACTRYKAEYPIFHKVRVNGPDAAPVYKFLKAHKSGFLGSRIKWNFTKFLVDKEGTVLARYGPTTAPLTIE
    ADIQKALGDK

    >gi|225435231|ref|XP_002284947.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MANMKNQSHCLLLLLVLITIFSSLKTTKAEVITLTADTFSDKVKEKDTAWFVQFCVPWCKHCKNLGSLWEDLGKIMEGED
    EIEIGQVDCGVSKSVCSKVDIHSYPTFKVFYDGEEVAKYQGPRNVESLKTFVLEEAEKAAMKAELENEKDL

    >gi|225436662|ref|XP_002276538.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MLRAAHLPPGASPALVALKLSLIPTLNLTSPSIIRKFSSFSSLHAFLPKTFLPSSPYPLSLGLKRFPPMVAQPCPRASFS
    SGGNTGSGREILVQHLLVKEDDLKLLLELQQRISGGVDLSDLAVEYSICPSKEEGGMLGWVRKGQMVPEFEEAAFKAPLN
    KVVRCKTKFGWHLLQVISEREESLLQDIQPVELHAKMQDPNFFEEVQLIDVREPEEVAQASLPGFQVLPLQQFGNWGPEI
    TTKFDPEKDTYLM
    CHHGMRSLQVAKWLQTQGFKRVFNVSGGIHAYATKADPSIPTY

    >gi|225441658|ref|XP_002282457.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSMAQILSKTSVFSPCHHHHRRCCVSAFPNNDYGHHRSAAPASARGFPSLKLKHRNLRSLSSSSSNSDFHGGRIVLQEIG
    SMPKRRNAQASCTLMGLAIGKAQKWWEKGLQPNMKEVTGAQDLVDSLLNAGDKLVVVDFFSPG
    CGGCRALHPKICQLAEM
    NPDVEFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFKDALAKHTPDRCSLEPTKGLEEKELLAL
    SANKDFSFNYSPKPVPTPAQEEIAVEATSAAAFSNEELPLPLPLPLSLPLPSTSLKGFHDSEVKEKTVAMI

    >gi|225459288|ref|XP_002285789.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
    MAAGLWETGIVLLLVFGRLTCAEPVRVSLSPVCPTESVADSISGFRDSHCTVNEGDGSLDFVGVTEGDEVSLQKALDMVH
    KNTHEYVAVLFYASW
    CAFSRTLSKYGVHGFPTLFLLNSTMRVRYHGSRTLGSFIAFYGDVTGMKTEPLERASLDKMASPS
    HHAKRDNSEQESCPFTWARSPENLLQQETYLALAVTFVVLRSLYFILPALLVCVQCAWRRHLQYTSLGGLWSLWEYPLTY
    LNRAIQLFNSLKEPCKRSNLQEGAMNARAWASKSLASVSIGDGSTSRVVASK

    >gi|225459290|ref|XP_002285788.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
    MAAGLWETGIVLLLVFGRLTCAEPVRVSLSPVCPTESVADSISGFRDSHCTVNEGDGSLDFVGVTEGDEVSLQKALDMVH
    KNTHEYVAVLFYASW
    CAFSRTCRPTFSILSSLYPSMPHFAIEESAVRPSILSKYGVHGFPTLFLLNSTMRVRYHGSRTLG
    SFIAFYGDVTGMKTEPLERASLDKMASPSHHAKRDNSEQESCPFTWARSPENLLQQETYLALAVTFVVLRSLYFILPALL
    VCVQCAWRRHLQYTSLGGLWSLWEYPLTYLNRAIQLFNSLKEPCKRSNLQEGAMNARAWASKSLASVSIGDGSTSRVVAS
    K

    >gi|225443812|ref|XP_002273741.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MRVHMDCAGCESKIRKALQKLDGIDDIDVDMAMQKVTVMGWADQKKVLKAVRKTGRKAELWPFPYNPEYYNYTDQFYQNY
    YHHHHRRRFPFAYSDSRPSSSYNYYKHGYNGHDHGYYHQPIHSTVIDARAEAMFSDENPNACSIM

    >gi|225458147|ref|XP_002280573.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAEEGQVVGCHSVESWKEQFQHGIESKKLVVVDFTASWCGPCRVISPFLAELAKKMPNVIFLKVDVDELETVAKEWEVEA
    MPTFLFLKEGNVVDKVVGAKREELVQKTEKHATA

    >gi|225432360|ref|XP_002275384.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MERAVARLASERPVVIFSKSSCCMCHTIKTLFSDFGVNPAVHELDEMPRGREIEQALARLGCNPTVPTVFIGGERVGGTN
    EIMTLHLNRSLIPMLKRAGALWV

    >gi|225432362|ref|XP_002275412.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDRVGKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIHELDEDSRGKEMEWALMRLGCNPSVPAVFIGGKFVGSANT
    VMTLHLNGSLKKMLKEAGAIWL

    >gi|225439464|ref|XP_002267105.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASSRQLLSLILRISTLLTFFFTSPSHSSSDVFSGVSVSSVDPNRVTLSVYYETLCPYCSNFIVRDLLKIFENGLISIVN
    LRMIPWGNAVLRPDKTFQCQHGPAECVLNTVEACVINIYPRVDMHFRFIYCVEYLALEGKQAEWASCFDRSQLGKVPIDC
    YTSGYGNQLELKYAEETALLNPPHTGVPWVVVNDQPLKEDYNNFVAYVCRAYRGGNVPEACRSFQLNINSTVEENPINPL
    CYVNEAKNLTTSSPGKKITNL

    >gi|225458149|ref|XP_002280947.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSKQVVVDFTASWCGPCRVISPFLAELAKKMPNVIFLKVDVDELETVAKEWEVEAMPTFLFLKEGNVVDKVVGAKREELV
    QKTEKHATA

    >gi|225425698|ref|XP_002270113.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MEKQSEVKLFGTWSSGYCTRIKLALKLKGIPYEYVEEDLSNKSDLLIHHNPVHKKVPVLVHNGKAIAESLVILEYIDEHW
    NHTPKLLPEDPYERAKVRFWANFYDQKFKPSIYNIMTSKGKEQEKAIEDSREVLMVFEEGIERDFPAKSPFLNGGPLGFL
    DIVVGSSACNYKAMNEVVGVVVDPKKNPAFCYWMAAMKDCPLMKETLPPHDRLVAKMRSKFSLQPPKT

    >gi|225451397|ref|XP_002266106.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSSVRIPPTASAVSSTIKHLGYNPRFFTSHGGAKGVKRVGGERRKYSITMSSPLEVCVKASVIIPNKLGDCPFSQRILLT
    LEEKHLPYEMKLVDLTNKPEWFLKISPGGTVPVMKLDEKWIADSDVIAQSLEEKYPDPPLGTPPEKASVGSKIFPAFIGF
    LKSKDPSDGTEQTLLNELASFDDYIKENGPFINGKDISAVDLSLGPKLYHLEIALGHYKKWTVPDSLPFVKSYMKNIFSM
    ESFVKTRGLPEDVIAGWRPKVMS

    >gi|225454994|ref|XP_002281325.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MFNALASSSTSTKATPLLSCFSRPSISLPKKFFLSPSKNPKPSSLLTSMSWLGKLGFGARTPPEPSLDPHSSAIAQGPDD
    DLPAPGQQFAQFGAG
    CFWGVELAFQRVSGVTKTEVGYTQGFVHNPTYNDVCSGTTNHSEVVRVQYDPKECGYGALLDVFW
    ARHDPTTLNRQGNDVGTQYRSGIYFYTPEQEKAARESLEQHQKLMNRKIVTEILPAKKFYRAEEYHQQYLEKGGRFGFKQ
    SSEKGCNDPIRCYG

    >gi|225439468|ref|XP_002267395.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MEIELVLSSSLHYMLPRKRAVGGEAVVAEGEEDNCSAGSLKKPRISTATTGTTETTGNVNSNSNSNSSIGNNNSNHSRGD
    AKPPIMALGEGNPPDIDEDLHSRQLAVYGRETMRRLFASNVLISGMQGLGAEIAKNLILAGVKSVTLHDEGSVELWDLSS
    NFIFTEDDVGKNRALASVQKLQELNNSVVISTLTTELTKEQLSDFQAVVFTNISIEKAIEFDDYCHNHQPPISFIKSEVR
    GLFGSVFCDFGPEFTVFDVDGEDPHTGIIASISNDNPALVACVDDERLEFQDGDLVVFSEVQGMTELNDGKPRKVKNARP
    YSFSLDEDTTNYGAYEKGGIVTQVKQPKVLNFKPLKEALKDPGDFLQSDFSKFDRSPLLHLAFQALDKFIMELGRFPVAG
    SEEDAQKLISFACNINDSSTVGKLEKIDQKLLHHFTFGARAVLNPMAAMFGGVVGQEVVKACSGKFHPLFQFFYFDSVES
    LPTEPLDPSDLKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVCCGNQGKLIITDDDVIEKSNL
    SRQFLFRDWNIGQAKSTVAASAAASINRRLHIEALQNRASPETENVFDDTFWENLSVVINALDNVNARLYIDQRCLYFQK
    PLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPM
    CTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAFLVNPIEY
    ASAMKNAGDAQARDNLERVIECLDKERCETFQDCITWARLKFEDYFANRVKQLTFTFPEDAATSNGAPFWSAPKRFPRPL
    QFSIDDPGQLHFVMAASVLRAETFGIPIPDWVKSPMKFADAVSKVIVPDFLPKKDVKIVTDEKATSLSTASVDDAAVINE
    LIMKLEKCQKKLPPGFRMNPIQFEKDDDSNYHMDLISALANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVC
    LELYKVLHGGHKMEDYKNTFANLALPLFSMAEPVPPKVIKHQDMSWTVWDRWILGDNPTLRELLQWLRDKGLNAYSISYG
    SCLLYNSMFPRHKERMDRKLVDLAKEIGKAELPTYRRHFDVVVACEDDEDNDIDIPQISIYFR

    >gi|225465012|ref|XP_002264748.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAAALFARTLFGNRLIRSSLALYQKPQIFTSFFNKRPFYSRPNAVYLVYRSSGFSTCAMASSTSGTRSSFSTQSVSPNEP
    VVSVDWLHANIREPDLKVLDASWYMPDEQRNPLQEYQVAHIPGALFFDVDGISDQTTNLPHMLPSEEAFAAAVSALGIEN
    KDGVVVYDGKGIFSAARVWWMFRVFGHERIWVLDGGLPTWRASGFDVESSASGDAILKASAASEAIEKVYRRQAVGPITF
    QTRFQPHLVWTLEQVNQNIENKTHQHIDARSKARFDGIAPEPRKGIRSGHVPSSKCIPFSQMLDSSQKLLPADELKKRFD
    QEGISLDSPVVTS
    CGTGVTACILALGLHRLGKSDVTVYDGSWTEWGAHPDTPVATSSASS

    >gi|225435594|ref|XP_002285614.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MLSHLSSASLPLKPSTVTATAFLRLSSRNLHFSYSSCPIFSPFFRSHPSLSSKLSRSFHFRPGVSSESAFSPSRSMEASP
    SADAAATVESLADGLRNQRLGSENRVLLRLEDLNWDHSFVHELPGDPRTDPIPRQVLHACYTKISPSAEVENPQLVAWLE
    SVAELLDLDPKEFERPDFPLIFSGASLLVGGLPYAQCYGGHQFGMWAGQLGDGRAITLGELLNSKSERWELQLKGAGRTP
    YSRFADGLAVLRSSIREFLCSEAMHSLGIPTTRALCLVTTGKYVTRDMFYDGNPKEEPGAIVCRVAQSFLRFGSYQIHAA
    RGKEDLGIVRALADYTIRHHFPHIENMTRSEGLSFSTGEQDESIVDLTSNKYAAWSVEVAERTASLVASWQGVGFTHGVL
    NTDNMSVLGLTIDYGPFGFLDAFDPSYTPNTTDLPGRRYCFANQPDIGLWNIAQFTSTLMSAELINDKEANYAMERYGTK
    FMDEYQAIMTRKLGLPKYNKQLISKLLNNMAVDKVDYTNFFRLLSNIKADPTIPQDELLTPLKAVLLDIGKERKESWISW
    VQSYIQELAASGISDEERKASMNSVNPKYVLRNYLCQSAIDAAEQGDFGVVRRILKIMERPYDEQPGMEKYARLPPAWAY
    RPGVCMLS
    CSS

    >gi|225425013|ref|XP_002267536.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASFSMEDFIGNGALKGLLPKLVEEGWDDVPTLKIMNSEDMDAINMTQQQKAALELRSYLHDRALMQYGDKLESSGKFLP
    ELLNLSITDLSSQFGMKRGHIARFTDRNSACADPLPAGYTLRTKRMMSTPSRNNSILKSELSSVNSRKILSISRAPTRAN
    SIYDRSLEQAVSEIKIKDGLVIKGIVAAEPAEPRACGCVQPPPIVEDVCPYSAIENVSVQKLAPEYKIGMERLVKTTPPM
    KASELWRDKPAVLLCIRRPG
    CIMCRAEAHKLYAKKPIFDALGIQLFAILHEHIESEVRDFWPRYWGGVVIFDRTMGFFKA
    LGGGKLLKDRFITGFIFNPRAIANYKRAKATGIEQNFKGEGEIKGGLFLVGSGRSGIAYQFIERNFGDWAPLPEVIEICT
    QLQNPQEAQGESMSTVI

    >gi|225447633|ref|XP_002274469.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MTIFSFFSGASRALGSSSKLLVILSISSGGLVAYSESQTDAGAQSAEIKQKEPQKKRVVVLGTGWAGTSFLKDLDISSYD
    VKVVSPRNYFAFTPLLPSVT
    CGTVEARSIVEPIRNIIKKRNGEIQYWEAECVKIDAANKKIRCRSVIDNSLVGNEEFLVD
    YDYLVIAMGAQVNTFNTPGVNEHCHFLKEIEDAQKIRRSVIDCFERAVLPDLTDEERRRNLHFVIVGGGPTGVEFAAELH
    DFILEDLVKLYPMVKDLVKITVIQSGDHILNMFDERISSFAERKFGRDGIEVQTGCRVTGVSDKAMTVKVKSKGEICSVP
    YGMVVWSTGIVTRPVLRDFMDQIGQNKRHVLTTNEWLRVEGCDGVYALGDCAAVAQRRVMEDISTIFKTADKDNSGTLTV
    KEFQDVIDDILVRYPQVELYLKNKHLNDVKDLLKDPQGHERKEVDIEGFKSALRHVDSQMKSLPATAQVAAQQGAYLSSC
    FSRRQQCQETPEGPLRFRDSGRHHFRPFRYKHLGQFAPLGGEQAAAELPGDWVSIGHSTQWLWYSVYASKQVSWRTRFLV
    VSDWTRRFIFGRDSSRI

    >gi|225433843|ref|XP_002263327.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAEAAPKSIYDFTVKDIRGNDVSLSDYNGKVLLIVNVASKCGLTHSNYKELNVLYEKYKSQGFEILAFPCNQFLGQEPGS
    NEEILEAACTMFKAEFPIFDKVEVNGKNTAPLYKFLKLQKGGLFGDGIKWNFTKFLVDKEGKVVDRYAPTTSPLKIEEDI
    QNLLGSA

    >gi|225447635|ref|XP_002274523.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MRTFTIFERAFKAFRDNPSLSKLMVVCTVSGGGLLAFAETRPFSGSDSVPKKKVVVLGTGWAGTSFLKNLKSSTFEVQVV
    SPRNYFAFTPLLPSVT
    CGTVEARSIVEPIRNIVRKKGINIEFKEAECYKIDTDNNKVYCRSGQDTNLGGEEEFSVDYDYL
    VIAMGARSNTFNTPGVVENCHFLKEVEDAQRIRRTVIDCFERASLPNLSEEERKRILHFVVVGGGPTGVEFAAELHDFVL
    EDLAKLYPSVKNLAKITLLEAGDHILNMFDKRITAFAEEKFQRDGIHLKTGSMVIKVDDKHISTKERSTGEVSEIPFGMV
    VWSTGIGTRPVIMDFMNQIGQTNRRALATDEWLRVEGCNNIYALGDCATINQRKVMEDISVIFSKADKNNSGTLNLKDFQ
    EVIDDICERYPQVGLYLKKRQMRNIADLLKSSQAEKQGTELDIALFTSALSEVDSQMKNLPATAQVAAQQGQYLANCFNR
    MEECERNPEGPLRFRGTGRHRFHPFRYKHLGQFAPLGGEQAAAQLPGDWVSIGQSTQWLWYSVYASKQVSWRTRALVVSD
    WGRRFIFGRDSSRI

    >gi|225469004|ref|XP_002265334.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MENQEPEENKSRVIKVVSEESWDFYISQATTQGCPVVVHFTAAWCIPSVAMNQFFEELASNYPDALFLTVDVDEVKAVAV
    KMEVKAMPTFLLMKEGAQVDRLVGANPDEIRKRIDALVQSFRVYVA

    >gi|225441002|ref|XP_002283652.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATTLTMARLLSSAKSLSFSSSASALFPPASLSLKLRHPKPLRFSTAISATIAVGDKLPESTFSYFDSAGELQTTTVSDL
    TKGKKAILFAVPGAFTPT
    CSQKHLPGFVEKSGELKSKGVETIACISVNDAFVMKAWKADLKIEDQVLLLSDGNGDFTKAI
    GCELDLSDKPVGLGVRSRRYAMLVDDGVVKVLNLEEGGAFTFSGAEDILKLL

    >gi|225432095|ref|XP_002274816.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MPSLGLGDTIPNLEVETTHGKFKLHDFFGDSLAIIFSHPRKSELTLCIREAVQHPGSKVSYPIVSDPKSDIILLLNMVDP
    AIDSYGNNLPSRVLYIIGPDKKIKLGFLYPGSTGRNVDEVMRVLDALQKAAKHRIATPVNWKPGELVVIQPGVSDDEAKQ
    LFPQGFQTVALPSNKSYLRFTQL

    >gi|225457739|ref|XP_002278020.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAMAAGTVASTGAYLMQFPRTLAALRTSFIPTRSFSKLGFHPLRLRTTAPVRKLQVRAARTGSKGVSLGFRAPHFELQEP
    LTGKMWTLEDFESYPALLVMFICNH
    CPFVKHLKKDIVKLSNFYMKKGLAVVAISSNSIATHPQDGPKFMAEEAKLFNYPF
    PYLYDESQDVARDFGAVCTPEFFLFKKDGRRPFELVYHGQFDDSRPSNNVRVTGRDLSLAIDCVLSGQPISLVQKPSVGC
    SIKWHPET

    >gi|225439844|ref|XP_002277868.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MKGIDIFCASQASTAICVSMEPGSSSSSAIDQGGRAIDRHNPIIRDARRSSVKTLTTPCSSQSPINPKPYHQLHQKNRKT
    TGKSNDQIKKASAKNVDQYGKSSAKPLDMLRKSSAKFVDLISPPGSSRYLLSEPPFFDVLPDFDPVLALVPVEPKKAKAV
    NLDDDSPVLKPSSSSGSSDSKPSSSSGSADQVVVLRVSLH
    CKGCEGKLRKHISRMEGVTSFNIDFAAKKVTVVGDVTPLG
    VLASVSKVKSAQLWTPAMASSLPHGLARVK

    >gi|225428380|ref|XP_002283529.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASHQRSPAIKGAKVLMVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDAVLRFRP
    HISITSYHANVKDPDFNVDFFKQFNVVLNGLDNLDARRHVNRLCLASDVPLVESGTTGFLGQVTVHVKGKTECYECQPKP
    TPKTYPV
    CTITSTPSKFVHCIVWAKDLLFAKLFGDKNQENDLNARSSNAASSSQQAEDVFERQNDEGIDEYAKRIYDHVF
    GYNIGVALSNEETWKNRNRPKPLYSRDVFPEEPSQQNGNMDKNCATDDPLSVSAMASLGLKNPQDIWSLLENSRIFLEAL
    KLFFGKREKEIGNLSFDKDDQLAVEFVTAAANIRAASFGIPLHSLFEAKGIAGNIVHAVATTNAVIAGLIVIEAIKVLQR
    DANNYRMTYCLEHPSRKMLLMPVEPFEPNKSCYVCSETPLLLEVNTHRSKLRDFVEKIVKAKLGMNCPLIMHGPALLYEV
    GDDLDKDMAANYAANLEKVLSELPSPVTGGTMLTVEDLQQEFTCNINIKHREEFDEEKEPDGMLLSGWTQAPRVEKDDNK
    TVGNGGSSTSNASSAMPVEAEEDDDIEFVPTGKKRKVGEISKATNPNLSDVADDDVLVMLDGENLDINKKKKLQ

    >gi|225451823|ref|XP_002281555.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAQSEGSSTGKKLIQIDISSDTVCPWCFVGKRNLDKAIASSQDQFDFELRWHPFFLNPSAPKEGINKIEFYKNKFGPRSE
    QIAARMTEVFRGLGLQYNLSGLTGNTLDSHRLIYFAGKQGLDKQHNLVEELCLGYFTQGKYIGDREFLVESAKKVGVEGA
    AEFLQDPNNGLNEVNEEFKKYSAHLSGVPYYVINGKQQLSGGQPPEVFLRAFQAAAV

    >gi|225428828|ref|XP_002285134.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASCSNPPPLSSPLSPSLQTRKLFAPLSYPRSGGPSYALHFHAKRGIRFSNPPLRLKVLCSADYDKAAVVTGDSWEKSIL
    NSEIPVLVEFYASW
    CGPCRMVHRVIDEIAEDYAGRLKCFVLNTDHDLHIAENYEIKAVPVVLLFKNGEKRESVVGTMPKE
    FYVAAIERVLSS

    >gi|225430510|ref|XP_002285564.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASMPFSVSFTAHSPGFAQTKAAHHHSWPSSPYPSMAFLMPSTKSSFGASNSAFLRTGFSLCSSEIPGVSLKSRFSGGVY
    ARAATEKSLYDYTVKDIEKKDVPLSKFKGKVLLIVNVASK
    CGLTASNYSELSHIYEKYKTQGFEILAFPCNQFGGQEPGS
    NPEIKQFACTRFKAEFPIFDKVDVNGPTTAPVYQFLKSNAGGFLGDLIKWNFEKFLVDKNGKVVERYQPTTSPFQIEKDI
    QRLLAA

    >gi|225434490|ref|XP_002275261.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
    MLTGEAVVTSESLPSESSMDSLSFSHLPCLLLIISSLFSAATARASISASEAEKVPLALYYETLCPYCSNFIVNHLIKLF
    NNGDGLVSIVDLKLLPYGNAKIGPNGTITCQHGPAECLLNTVEACAIDVWPDLSQHFSFIYCIETLVYERKYPQWETCFE
    KLGLDPKPISDCYNSGYGKELELKYAAETNGLQPPHKYVPWVVVDGQPLYEEYENFISYICKAYKGPSIPSACNELSLNT
    IVKENVNPAGPVCYTEETIKPTLSSIIGSTIKAWMQRMNRAALI

    >gi|225434492|ref|XP_002275283.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
    MASRSFVAVSLLSFLFLFSSASGALPSDSDKVSLGLYYESLCPYSANFIINYLVKIFENGLISIVDLNLVPFGNAKIRGN
    NTIDCQHGPAECLLNTVEACAIDVWPDLSQHFSFIYCIETLVYERKYPQWETCFEKLGLDPKPISDCYNSGYGKELELKY
    AAETNGLQPPHKYVPWVVVDGQPLYEEYENFISYICKAYKGPSIPSACNELSLNTIVKENVNPAGPVCYTEETIKPTLSS
    IIGSTIKAWMQRMNRAALI

    >gi|225435313|ref|XP_002285136.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSGRLVLLLFLSSLLLFSQFSPSLSTDKNDDDLDEDLSFLEQDDVVEPHHSKSGHTSDLDEFDDDALDDDFDNHSDFDEP
    DSDYGKYSQSEIDEKDVVVLKEKNFSDVIENNQYVMVEFYAPW
    CGHCQALAPEYAAAATELKGEKVVLAKVDATEESELA
    HEYDIQGFPTVYFFIDGVHKPYPGQRTKDAIITWIKKKIGPGVYNITTIEDGERILTSENKVVLGFLDSLVGPESEELSA
    GSKLEDDVNFYQTVNPDVAKLFHIDPKVKRPALVLLKKEAEKLSHFNGNFTKSAIAEFVFANKLPLVTTFTRDSAPLIFE
    SPIKKQLLLFATANDSEKVVPAFQEAAKSFKGKIIFVYVEMDNEEIGRPVSDYFGVTGDAPKVLAYTGNDDARKFILDGE
    VTLDKVKAFGEDFLEDKVKPFFKSDPIPESNDEDVKIVVGDNFDEIVLDESKDVLLEIYAPW
    CGHCQALEPTYNKLAKHL
    HGIESLVIAKMDGTTNEHHRAKSDGFPTLLFFPAGNKSSDPITVDTDRTVVALYKFLKTHASIPFKLQKPASASKPEGSD
    AKESDESSSPSDLKDEL

    >gi|225445188|ref|XP_002284177.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAPIAVGDVIPDGTLAYFDEQDQLQQASVHSLAAGKKVIIFGVPGAFTPTCSVKHVPGFIEKAGELKSKGIDEILLVSVN
    DPFVMKAWAKTYPDNKDVKFLADGSATYTHALGLELDLSEKGLGTRSRRFALLVDDLKVKVANVEAGGEFTVSSADDILK
    AI

    >gi|225448990|ref|XP_002273467.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGKIERMGSSGKKGNGGEVVGGRKRGEVERREKGKKRGRKRKEEGRERGNQGELAWERKLVVGKLSQVPNLQAIAGARSD
    DLRTSGVASGPSFGGHGALAGELLIEDNAQEAQIHPPRPPILRQRLKGSCRVAIEQTPQTPLQLQPFLLFIMSDTFRFYP
    SLTPLLPTTPRGSSRILQQFSIPGLSISDFPRKSLNFPQKIGVSGGKVWALAAWNQEGPLQDLDDSPVSVELKPISSDTQ
    FDRILGEAQQLEESVAIVWMATW
    CRKCIYLKPKLEKLAAEYYPRLRFYCVDVNTVPHKLVARAAVTKMPTIQLWKDSKKQ
    AEVIGGHKAYFVVNEVREMIENECAM

    >gi|225434502|ref|XP_002275617.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MALGDGHPPDIDEDLHSRQLAVYGRETMRRLFASNVLVSGLQGLGAEIAKNLILAGVKSVTLHDEGTVELWDMSSNFIFS
    ENDVGKNRALASVQKLQELNNAVVISTLTTKLTKEDLSDFQAVVFTDIYFEKAIEFNDYCHSHQPPIAFIKAEVRGLFGS
    VFCDFGPEFTVFDVDGEEPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKNARPYSFTL
    EEDTTNFGTYEKGGIVTQVKQPKVLNFKPLREALSDPGDFLLSDFSKFDRPPLLHLAFQALDRFISELGRFPVAGSEEDA
    QKLIFISSNINEGLGDGKLEDINPKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPTEA
    PDSSDFKPLNSRYDAQISVFGSKLQKKLEDAVVFMVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFL
    FRDWNIGQAKSTVAASAAQTINPCLHIEALQNRVGPETENVFNDAFWENLSVVINALDNVNARLYVDQRCLYFQKPLLES
    GTLGAKCNTQMVIPHLTENYGASRDPPEKQAPM
    CTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAFLSNPTEYASAMR
    NAGDAQARDNLERVLECLERERCETFQDCITWARLRFEDYFVNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSAA
    DAGHLYFVMAASILRAETFGIPIPDWAKHPKKLAEAVDKVIVPEFQPKTDVKIVTDEKATSLSTASVDDAAVINELLAKI
    EQSWKSLPPGFRMNPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYK
    VLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELLQWLKDKGLNAYSISCGSCLLY
    NSMFPRHRERMDKKVVDLAREVAKVELPAYRSHLDVVVACEDDEDNDIDIPQVSIYFG

    >gi|225426391|ref|XP_002269758.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAPKFLSSTRNERSGKGVPEKEENAEGSQAKAMYSVTGMTCSACSGQVERALRQLPGIQDAVVDALSNRAQVTFYPALIN
    VSTIRETIEDVGYQATLIQDHQTNAKSTQMCRIRINGI
    CTSCSTAVESALQALRGVLMAQVASADEEAQVHYDPKMVSYK
    ELLEAIEDTGSVAILITTGYMSKLQLKVDGV
    CTDHSMRLIENSLRSLPGVQDIVIDPTLNKFSVSYKPDVTGPRNFIQVI
    ESTGSGRYKAMIFPEGGREVHEKEIERNYRSFLWSLVFAIPVFLTSMVFMYVPGLKHGLDSNVVNMLSVGEILRWALSTP
    VQFVIGRRFYTGSYKALRRGSANMDVLIALGTNAAYFYSVYSVLRAAASKDFKSTDFFETSSMLISFILLGKYLEISAKG
    KTSDAIAKLMDLAPETAILLTLDCEGNVITEEEIDSRLIQKNDVIKILPGAKVASDGFVIWGQSHVNESMITGEARPVAK
    RKGDTVIGGTVNEDGVLHVEATQVGSESALSQIVQLVESAQMAKAPVQKFADRISKYFVPLVIILSFSTWLSWFLAGKFH
    RYPKSWIPSSMDSFELALQFGISVMVIACPCALGLATPTAVMVGTGVGASQGVLIKGGQALESAHKVNCIVFDKTGTLTV
    GKPVVVNTRLLKNMALQEFYELVAATEVNSEHPLAKAIVEYAKKFREDEENPTWPEAKDFVSITGNGVKAIVRNKEIIVG
    NKSLMLDQNIAIPFEAEDMLAETEAMAQTGILISIEGELAGVLAISDPLKPGARDVISILKSMKVKSIIVTGDNWGTANS
    IAKEVGIETVIAEAKPEQKAEKVKDLQASGNIVAMVGDGINDSPALAAADVGMAIGAGTDIAIEAADIVLMKSNLEDVIT
    AIDLSRKTFSRIRLNYIWALGYNLLGIPIAAGALFPSIGLRLPPWIAGAAMAASSVSVVCCSLLLKNYRRPKKLDGLEMQ
    GVTVE

    >gi|225426393|ref|XP_002269802.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MVAKFLTLECIRGESFGHLSPRPHYPSMPKYPKGVSETEKDVRGSEAKAVYSVIGMTCAACAGSVEKAVKRLPGIREAVV
    DVLNNRVQVMFYTSFVNEETIRETIEDVGFQATLMPDEANEKSTQVCQIHINGMT
    CTSCSTTVESALQALQGVQKAQVAL
    ATEEAQVHYDPKIINYNQLLEAIEDTGFEAILISTGEDMSKIQLKVDGV
    CTDHSMRLIENSLRALPGVQDIDIDPTLNKF
    SLSYKSNVTGPRNFINVIESTGSRCYKATIFPEGGRAIHKKEEVKQYYRSFLWSLVFTIPVFLTSMVFMYIPGLKHGLDT
    KVINMLSVGETLRWVLSTPVQFIIGRRFYTGSYKALRHGSANMDVLIALGTNAAYFYSVYSVLRAATSEDFKSTDFFETS
    SMLISFILLGKYLEVLAKGKTSDAIAKLMDLAPETAILLTLDKEGNIISEQEIDGRLIQKDDVIKILPGAKVASDGFVIR
    GQSHVNESMITGEARPVAKRKGDTVIGGTVNENGVLHIKATRVGSESALSQIVQLVESAQMAKAPVQKLADHISKYFVPL
    VIILSFSTWLAWFLAGKFNGYPKSWIPTSMDGFQLALQFGISVMVIACPCALGLATPTAVMVGTGVGASQGVLIKGGQAL
    ESAHKVDCIVFDKTGTLTVGKPVVVSTRLLKNMVLQEFYELIAAAEVNSEHPLAKAIVEYAKKFREDGESPTWPEARDFV
    SITGHGVKAIVRNKEIIVGNKSLMLDQNIAIPADAEDMLAETEAMAQTGILISIDGELTGVLAISDPLKPGARDVISILK
    SMKVKSIMVTGDNWGTANSIAKEVGIETVIAGAKPEQKAEEVKNLQASGHTVAMVGDGINDSPALVAANVGMAIGAGTDI
    AIEAADIVLMKSNLEDVITAIDLSRKTFSRIRLNYIWALGYNLLGIPIAAGALFPSTGFRLPPWIAGAAMAASSVSVVCC
    SLLLKYYKRPEKLNALEMQGVMVENRF

    >gi|225426395|ref|XP_002269839.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAAKFLTLACIRNESFGGLSPRPHYPSMPKYPKGVSETERDVEGSEAKAVFSVIGMTCSACAGSVEKAVKRLPGIREAVV
    DVLNSRAQVMFYPSFVNEETIRETIEDVGFQATLIQDETNEKSIQVCRIRINGMT
    CTSCTSTVESSLQALHGVQKAQVAL
    ATEEARVHYDPKIINHNQLLEAIEDAGFEAILISAGEDMSKIQIKVDGVGTDNSMRILENSLRALPGVQDIDVDPTVRKF
    SLSYKPDVTGPRNLINVIESTGTGRYKAAISPEGGREVHRKEEIKQYYRSFLWSLVFTIPVFLTSMVFMYIPGLKHGLDT
    KVVNMLSIGEILRWVLSTPVQFVIGRRFYTGSYKALRHGSANMDVLIALGTNAAYFYSVYSVLRAATSEDFKSTDFFETS
    SMLISFILLGKYLEVLAKGKTSDAIAKLMDLSPETAILLALDSEGNVINEEEIDSRLIQKNDVIKILPGAKVASDGFVIW
    GQSHVNESMITGEARPVAKRKGDTVIGGTVNENGVLHIKATRVGSESALSQIVQLVESAQMAKAPVQKFADRISKFFVPL
    VIVLSLSTFLAWFLAGKFHGYPKSWIPSSMDSFQLALQFGISVMVIACPCALGLATPTAVMVGTGVGASQGVLIKGGQAL
    ESAHKVNCIVFDKTGTLTVGKPVVVNTRLWKNMVLQEFYELVAATEVNSEHPLAKAIVEYAKKFREDEENPTWPEAKDFV
    SITGHGVKAIVRNKEIIVGNKSLMLDQKIVIPVDAEDMLEEIEEMAQTGILISIDGELTGVLAISDPLKPGARDVITILK
    SMKVKSILVTGDNWGTANSIAQEVGIETVIAEAKPEHKAEKVKNLQASGYTVAMVGDGINDSPALVAADVGMAIGAGTDI
    AIEAADIVLMKSNLEDVITAIDLSRKTFSRIRLNYIWALGYNLLGIPIAAGALFPSSGFRLPPWIAGAAMAASSVSVVCC
    SLLLKYYKRPKKLDALEMQGVRIE

    >gi|225436697|ref|XP_002263424.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MALKLHGIPMSTCTTRVLTCLHEKGLDFELVPVNLFAGEHKQPPFLAKNPFGQIPVLEDGDFTLFESRAITAYLAEKYKE
    TGCDLLRHNDLKEAALVKVWLEVESQHYYPAIYQIVYQFFALPLQGKTADQAIIDVNLEKLGKVLDVYEARLGTTKCLAG
    DFYSLADLHHLSYTYYFMKTPWASLINSRPNVKAWWDDISSRPAFKKVAEGMTFGEK

    >gi|225436699|ref|XP_002263386.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MALKLHGIPMSTCTTRVLTCLHEKGLDFELVPVNLFAGEHKQPPFLAKNPFGQIPVLEDGDLTLFESRAITAYLAEKYKE
    TGCDLLRHNDLKEAALVKVWLEVESQQYHPAIYQIVYQFFVLPLQGKTADQAIIDVNLEKLGKVLDVYEARLGTTKCLAG
    DFYSLADLHHLSYTYYFMKTPWASLINSRPNVKAWWEDISSRPAFKKVAEGMTFGEK

    >gi|225426403|ref|XP_002272606.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASQSSPQSVHSFTVKDARGNDVDLSIYKGKALLIVNVASQCGLTNSNYTELHQLYEKYKDQGLEILAFPCNQFGAQEPG
    SNEEIEKFVCTRFKAEYPIFDKIDVNGDSAAPLYKFLKSSKGGLFGDNIKWNFSKFLVDKDGKVVDRYAPTTSPLSIEKD
    IKKLLGIS

    >gi|225426405|ref|XP_002272936.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSKQIQQGPESIYDFTVKDAEGKSVNLSIYKGKVLLIVNVASKCGLTNSNYTELNQLYEKYKDQGLEILAFPCNQFGEEE
    PGSNEQILEFVCTRFKSEFPVFDKIDVNGENAAPLYKFLKSGKWGIFGDDIQWNFGKFLVDKNGKIVDRYYPTTSPLTVE
    NDVKKLLEVS

    >gi|225432466|ref|XP_002278920.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MYIFPENRIKSLPTLVLTAWVGWNTLVVAVAAMAAEGSIQKSEEEWRAILSPEQFRILRQKGTELRGTGEYDKFYGDGIY
    NCGGCGTPLYKSTTKFNSGCGWPAFYEGLPGAINRTPDPDGRRTEITCAACGGHLGHVFKGEGFSTPTDERH
    CVNSVSIK
    FAPVNSSASS

    >gi|225446271|ref|XP_002266565.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATKKWQKSYFDVLGLCCSSEVPLIEKILKPLDGVKEISVIVPSRTLIVVHDNLLISQIQIVKALNQARLEANVRIYGEV
    AYQKKWPSPFAIVSGILLLLSFLKYVYQPFRWLALGAVAAGIFPIAWRGIVAIRNFTLDINILVLIAVIGTIALNDYWEA
    GSIVFLFTIAEWLESRASHKINSIFTLVSPVVVLISAGLAGIPAALRVHDLSHWFHLSLVVLVSACPCALILSTPVATFC
    ALSKAAVSGLLIKGGEYLEILAKIRIMAFDKTGTITRGEFVVKDFQSLRDDVSSDTLLYWVSSIESKSSHPMAAALFDYG
    LSQSVEPKPENVEEFQNFPGEGIHGKIDGKDIYVGNRKIALRAGCETVPTIGEDKEGKTIGYVYSDATPTGIFTLSDACR
    TGVVEAIKELKLLGIKSAMLTGDSHASAMHTQDQLGHTLEVVHAELLPEDKARIIKDFKEEGPTAMIGDGVNDAPALATA
    DIGISMGIAGSALATETGHVVLMTNDIRKIPKAVRLARKTHRKVVENVILSITTKAAILALAIAGHPLIWAAVLADVGTC
    LLVIFNSMLLLRGTHQHGGKCCKSSAASHVDKHGCKGGGSHSSHNHQHSCSNSISQKKCEPQKCSSQRCASRCQPDHSGL
    SSCVNTKCTDSADRHDCCVGNEGHHDMQHCDQRSGNTATHGLSEIITE

    >gi|225459403|ref|XP_002284291.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MENESSTEKNVVNSSTPEKEGEVCYPQKDHGEQMKALRISEESPNPDSNEGLDDSNNKVDDRKELGSENKKEMNQDDLNN
    QVDESKELESENKSETYQDIKENLSEEKEPEPVFDGTEIPGMEASRSMSTRPLDLDTETQGSAWPEKAVALKNFVKEKGT
    VAVSSVLRVLSGKTEEDVHAAQDDEDKNKTGVKEVVDSPKEGEAKEASQKPVERSAWNPLNYIKISREVDAENKTEQKEE
    IIEEPARPVGMKGRIILYTRLG
    CQESKEVRRFLLQRRLRYVEINIDVYPSRKLELEKIAGSCAVPKLFFNEVLIGGLNEV
    KGLDESGKLDEKINYVISEAPSFEAPLPPLSGEDDLSSSGAIDELAAIVLKMKESIVVKDRFYRMRRFTNCFLGSEAVDF
    ISEDQYLEREEAIEFGRKLASKHFFQNVLDENDFEDGNHLYRFLDHDPVVSSQCHNFLRGILDVKPKPIIEIASRLRFLS
    YAIFEAYTSEDGKHVDYRSIHGSEEFARYLRIVEELQRVDLQDMPREEKLAFFINLYNMMAIHGILVWGFPVGPLERRKL
    LGEFKYVVGGCTYSLSVIANGILRGNQRPPYNLIKPFGMRDRRAKVALPYPEPLIHFALVFGTRSGPPLKCYSPGNIDQE
    LVEAARNFVRSGGLILDVNAKVVSASKLLKWYSVDFGKNEVEVLKHAANYLEPPISEELLEVLATGQLKVIYQPYDWGLN
    C

    >gi|225459742|ref|XP_002285895.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MRKEVKETTSFKSEDGSGALNGVSDDLNYRSRFSSLLASTHRDFLLSPTGQQVKVSELNDKVIGLYFSANWYAPCRKFTQ
    VLAGAYEQLKSCGAGFEIVFVSSDEDSDAFDNFRACMPWLAVPFSDLETKKALNRKFDIEGIPCLVILQPNDNKDEATLH
    DGVELIYRYGVNAFPFTKVRLEELRKEEREKHESQTLPNLLTNHNRDFLLGRPTAKQVPISSLIGKTIGLYFSAQW
    CLPG
    VKFTPKLISIYQKIKQTLVDDNEEDFEIVFVSSDRDQPSFDSYFGTMPWLAVPFGDPTIKTLTKYFDVQGIPCLVILGPD
    GKTVTKQGRYLINLYQENAYPFTEAKLELLEKQMDEEAKSLPRSEYHAGHRHELTLVSEGTGGGPFICCDCDEQGLGWAY
    QCLECGYEVHPKCMRVVDRGSTLER

    >gi|225442839|ref|XP_002285353.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
    MARSLSNAFLKGISSFPSARFSTMVSGSIFQNGMRYSTTVPNDPDTHDDFKSTNKLESSGLALQDIVEQDVKDNPVMIYM
    KGVPDVPR
    CGFSSLAVRVLKEYNVPLSARNILEDPELKIAVKKFSHWPTFPQIFIKGEFIGGSDIILNMHQTGELKEKLK
    DVSAPQEKSE

    >gi|225429797|ref|XP_002282811.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAPKKRREGEAPVDTSTTSVRVTRSSTRRLGAKANDSVAPAPAPPERPKKKVKKTEDVKEPEKVADGSKTIVIEHCKQCN
    SFKTRATQVKDGLEKGVLGITVVVNPEKPRRGCFEIREEGGEKFISLLDMKRPFAPMKALDMDKVISDIIDKIK

    >gi|225442841|ref|XP_002285351.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
    MARSLSNAFLKGISSFPSARFSTMVSGSIFQNGMRYSTTVPNDPDTHDDFKSTNKLESSGLALQDIVEQDVKDNPVMIYM
    KGVPDVPR
    CGFSSLAVRVLKEYNVPLSARNILEDPELKIAVKKFSHWPTFPQIFIKGEFIGGSDIILNMHQTGELKEKLK
    DVSAPQEKSE

    >gi|225446591|ref|XP_002276519.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGIDSLSDRVRDTLSCESNKPDFRELDLGSPVSPLMTRGSGGGGGGSGGGGGGPAAMSSSSSSSGSVSGKTGGTQLVKRP
    DGSLNNYSGELSASSETSPYASETLRSVAGTRNSRPGHRRSSSAGPPLIYSGASFVSSSNGGCSGGGASSISSNPNANVL
    PSGNICPSGKILKAGMPCRSSGRSDVLGSGTGHYGHGSIMRGGAKLSSPRSIADVNMTGNIQFAGESVMVKRAMGSSDPE
    EVKKAGNELYRRGSFTEALSLYDRAISLSPDNAAYRSNRAAALTALGKLAEAVKECEEAVRLDPGYGRAHQRLASLYLRL
    GQVENARRHLFLPGQPPDPSELQKLLSLEKHLNRCADARKIGDWKSALRECDAAIAGGADSSPQLISCRAEALLKLHQIE
    DADSCLSSIPKFEHYSPSCSTKFVCMIAEAYVLYVRAQVEMALGRFENAVAAAEKAGLIDYSNVEVAKLLNNVKLVARAR
    ARGNELFSSGRFSEACSAYGEGLKYDTSNSVLYCNRAVCWSKLGLWEKSVEDCNHALKIQPNYTKALLRRAVSNGKLGQW
    AEAVKDYEVLRRELPGDIEVAESLSQAQAALSKSWEEETHSVKFGGEVEEVSGVDQFKAAISSPGVSVVHFKVASNYQ
    CG
    QVSPIMDKLCVQYPSIKFLKVDVEESPAVAKAESIKSVPTFKIYKNGGKVNEMICPSHQYLEYSVRYYSL

    >gi|225456818|ref|XP_002278258.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAANSTNPALERDPDRPDHPGLELAQFGAGCFWGVELAFQRLVGVVKTEVGFSQGHVPDPTYKLVCTGTTNHVEVVRVQF
    DPDVCPYSNLLSLFWSRHDPTSLNRQGADVGTQYRSGIYYYNEAQARLARESLEAKQKELNDKNIVTEILPAKRFYRAEE
    YHQQYLEKGGGKGLRQSAEKGCTDPIRCYG

    >gi|225438531|ref|XP_002279428.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAFSAIPRCCPSTLRLPRNSNSMPQPSTSVSLRSLSSNLSFPKRFSIRSSSVSAAPTTGGLMPAISLTDNALKHLNKMRS
    DRTEDLCLRIGVKQGG
    CSGMSYTMEFEDRAKTRPDDSIIEYNGFVIVCDPKSLLFVFGMQLDFSDALIGGGFSFKNPNAT
    QTCGCGKSFAAEM

    >gi|225461413|ref|XP_002282265.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATVLDSLAVPRSSALPSSAFAPIASSPVCFLSGRRGLARLPEFSGLKIQPSLASRSVAAAGRSSRVGRRVGGVVCEAQE
    TAVEVPAVIDATCQSLVLDADTPVLVEFWAPW
    CGPCRMIHPVINELAKQVIIFKSGEKKEAIIGAVPKSTLTTSIEKFL

    >gi|225458613|ref|XP_002284743.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MQRQSVLYNKASFNFGKNSDGFDTRIPCILPSLLPDRIHVRSCFLRAEIPSSIKIESLDFTKIGCTFRQAEVRSVAYENE
    GELSDEDDELCPVDCVREFKTDEEFSRILEKAKETNSLVVVDFYRTS
    CGSCKYIEQGFAKLCKGSGDEEAAVIFLKHNVI
    DEYDEESEVAERLRIKAVPLFHFYKDGVLLESFPTRDKERIIAAILKYTSPASQDV

    >gi|225446607|ref|XP_002276680.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MTTIEMRVHMDCAGCESKIKKTLQKLKGVDSIEIDMATQKVTVTGWADQKKVLKAVRKTGRRAELWSLPYNPEHHNGTDY
    FNISQHHCNGPSTHFTPQPSSYYNYYKHGYDSHDGSYYHRPPQSTIFGEQTGAAFSDDNPNACSIM

    >gi|225459760|ref|XP_002285902.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATIANFLSKPPSSLPPKINALSSVFSSSLSFTKPRPLMMKLGTSRSTNSFTVKATAAPSKTKKAESDERVKHVHSIEEF
    DEALRTAKNKLVVVEFGASHSIHSKKIYPFMVDLSRQCSDVEFLLVMGDESEKTRELCQRENIDQVPHFSFYKNKEKIHE
    EEGIGPDELMGDVLYYGDNHSAVVQLHSGEDVERLIQDHKADNKLIVLDVGLKH
    CGPCVKVYPTVIKLSRQMTDTVVFAR
    MNGDENDSCMKFLKEMDVVEVPTFLFIRDGEICGRYVGSGKGELIGEILRYQGVRVTY

    >gi|225440292|ref|XP_002279195.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDETRREFGEYSRGILIIRHRKLATLSSSSISSKRQRSVSRVSPSGDRSGLGSCGGAFTFGLIKSLPTKGITCMVQHHND
    DDDSDHNAAFASGNVHLITTKENWEEKLAEASKDGKIVIANFSATW
    CGPCKMIAPFYCELSEAHPSLMFLTVDVDELSEF
    SSSWDIKATPTFFFLRDGQQVDKLVGANKPELQKKITAILDSMTQCNK

    >gi|225445984|ref|XP_002266525.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAVKMKCGITLTLFVLTASLCLPSSAAADHSSSDAAADFVKKTISSHKIAIFSKSYCPYCKRAKAVFKELNQVPYVVELD
    QREDGWNIQDALSGMVGRRTVPQVFINGKHIGGSDDTVEAYQSGDLAKLLGIAEEDSDDL

    >gi|225462114|ref|XP_002262673.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MQEALPYKTWLPIPREPRINTPTTPLHNQLLLPGTTNITNMVSENAVIVFGRRGCCMTHVVKRLLLGLGVNPAVCEVNEE
    DEIGVLDELGMVGAGEGKQGAVQFPAVFIGGRLFGGLDRVMAAHITGELVPILKQAGALWL

    >gi|225431233|ref|XP_002273515.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MKARHHSVVLVILLGVLVANAPGQTLASNSVPAFVQNTIYANKIAIFSKSYCPYCLRAKRIFSELHEEPFVVELDHRDDG
    TQIQNVLLDLVGRSTVPQIFVNGKHIGGSDDLRNAVLSGQLQKQLGTS

    >gi|225457807|ref|XP_002266022.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MALENCFQVSTVSCARAGVLQSHHPFSAKEKLNLPTCKGVKPSILSFSSSPSSLDYSFHRICRKSRIVCKAREAVDEVQV
    VTDSSWSNVVIASENPVLVEFWAPW
    CGPCRMIAPVIDELAKEYAGKIVCCKVNTDDCPNIATQYGIRSIPTVLFFKNGER
    KESVIGAVPKSTLTATIEKYVDM

    >gi|225456069|ref|XP_002280532.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGEEVKVIGSILSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDKPIPESLVILEYIDETWKD
    NPLLPEDPYERAMARFWAKYADEKCLFGAWEAFKAEGEEKEKAMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIP
    HWLSVLEEVGGMKMLDAERFPSLHEWAENFIQIPLIKECIPPRDDLVNHFHASLSYVRSLSANKP

    >gi|225456071|ref|XP_002277759.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGEVKVLGASLSFFCCRVEWALKLKGVAYEYLEEDLRNKSPMLLQSNPVHKKVPVLVQDGRPIAESLVILEYIDEAWKGY
    PLLPEDPSERAKTRFWARFTDEKVNEHCFSLSIFHAEKAIESAQESLSFLEKQIEGKKFFGGETMGLLDLVVGSLPNWIE
    FLEEHGGMKLLDEEKFPSLYEWAQKFINIPIISERIPTKEGLINYFQGGQNSRLTTGK

    >gi|225456073|ref|XP_002280676.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGEEVKVIGSIKSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDKPIPESLVILEYIDETWKD
    NPLLPEDPYERAMARFWAKYADEKCMFGAWEAFKAEGEEKEKAMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIP
    HWLSVLEEVGGMKMLDAEKFPSLHEWAENFIQIPLIKECIPPRDVLVNHFHATFSSLRSLSANKP

    >gi|225461830|ref|XP_002285647.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASRSLGNLSFPTQHVSSKTQFVFGSKPQFVSFSGALRKPVRQKFSTRVMGSSASSSQKPDSIQEPGKVDYTSISDEEWK
    KRLTGEQFYITRQKGTERAFTGEYWNTKTPGAYHCICCDTPLFESSTKFDSGTGWPSYYQPIGNNVKSKLDLSIIFMPRQ
    EVLCAACDAHLGHVFDDGPPPTGKRY
    CINSASLKLKPK

    >gi|225456075|ref|XP_002277793.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGEVKVLGASLSFFCCRVEWALKLKGVAYEYLEEDLRNKSPMLLQSNPVHKKVPVLVHDGRPIAESLVILEYIDEAWKGY
    PLLPEDPSERAKIRFWARFTDEKCVLGAWAACCAKGHEREKAIESAQESLSFLEKQIEGKKFFGGETMGLLDLVVGSLPN
    WIEFLEEHGGMKLLDEEKFPSLYEWAQKFINIPIISERIPTKEELINYFQGGQNSRLTTGK

    >gi|225431247|ref|XP_002274205.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAEEGQVIGVHSVEAWNDHLQKCNESNKLIVVDFTASWCGPCRFITPFLVELAKKIPTVTFLKVDVDELKSVATDWAVEA
    MPTFMFLKQGKIVDKVVGANKDSLQQTIAKHMATA

    >gi|225425112|ref|XP_002272955.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MQYCNPIDTPFARSENLSKEMSPKTPKEKRKITNVPYFGVVGYLMYATMNGIAGYDMAGEYERKGEKNSKEDISGGYVCE
    NFSSSEIFSDGGGLISDDSGKQEAKRCPLDMIKDSQEAMELDQQFSEIEIEKRHVPVEDRQDMSIMTENLNEVQNVPLED
    LGSGADTAVSSETNGDEQIIPPHSQLPKPEAPPGLLNPPSMEDYYRVERSQSLTENLPAIGKYIRDRSNSLSAAIVKRIS
    SFKESDESKSKWNNVTEFNLSGLKVIVKQKDENRDFALKGRISFFSRSN
    CRDCTAVRLFFREKGLKFVEINVDVYPSREK
    ELMERTGTSSVPQIFFNEKFFGGLVALNSLRNSGDFDRRLTEMLGRKCPDDAPAPPVYGFDDYEEDTTDEMIAIVRVLRQ
    RLPIQDRLMKMKIVNNCFAGAEMLEVMIQHFDCGRKKAIEIGKQLARKHFIHHVFREHDFEAGNHFYRFLEHEPFIPRCI
    NFRGSTNDSEPKTAAAVGQRLTKIMSAILESYTSDDRRHVDYMGISNSEEFRRYVNLVQDLHRVDILALSTDEKLAFFLN
    LYNAMVIHAVIRGGRPNGVIDRRSFFSDFQYLVGGNVYSLNIIKNGILRNNRRSPYSLMKPFSNADKRIELALPKVNPLI
    HFGLCNGTRSSPSVRFFSPKGVEAELRCAAREFFQRDGIEVDLDKRTVHLSRTLKWFNADFGQEKEVLKWIMDYLDATKA
    GLLTHLLSDGGAVNVAYHNYDWSVNS

    >gi|225432110|ref|XP_002263180.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAMALARRSKNLYSCGVLRYSLSLTSFSRGFASAGSDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGTLGGTCLNV
    GCIPSKALLHSSHMYHEAKHSFASHGVKFPSVEVDLPAMMGQKDKAVANLTRGIEGLFKKNKVNYVKGYGKFISPSEVSV
    DTIEGGNAVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALSEIPKKLVVVGAGYIGLEMGSVWARLGSEVTVVEF
    APDIVPTMDGEIRKQFQRALEKQKMKFMVKTKVAGVDTSGDLVKLTLEPAAGGEQSTLEADVVLVSAGRSPFTAGLGLDK
    IGVETDKIGRILVNEKFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEMIAGKAAHVDYDMVPGVVYTHPEVASVGKTE
    EQVKALGVEYCVGKFPLLANSRAKAIDDAEGLVKILAEKETDKILGVHIFGPNAGELIHEAVLALHYGASSEDIARTCHA
    HPTMSEALKEAAMATYDKPIHI

    >gi|225467708|ref|XP_002272095.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MYYHHSESWGYYTTAEATRVMADPLERVAKLASENAVVIFSLGSCCMCHVVERLFRGMGVNLTVYELDQDPREKKMSGMV
    RMS

    >gi|225436755|ref|XP_002267103.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAERSMKTASHSHKYTNRLAAEHSPYLLQHAHNPVDWYPWGEEAFSESRKRDVPIFLSIGYSTCHWCHVMEVESFENEGV
    AKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPDDKYGRPGFKTVLRKVKDAWE
    NKRDVLVKSGAFAIEQLSEALSATASSNKLADGIPQQALHLCAEQLAGNYDPEYGGFGSAPKFPRPVEIQLMLYHYKKLE
    ESGKSGEANEVLKMVAFSLQCMARGGVHDHIGGGFHRYSVDECWHVPHFEKMLYDQGQLANAYLDVFSITKDVFYSCVSR
    DILDYLRRDMIGPEGEIFSAEDADSAESEDAARKKEGAFYIWTSKEVEDVIGEHASLFKDHYYIKPSGNCDLSRMSDPHN
    EFKGKNVLIERNCASAMASKLGMPVEKYLDILGTCRRKLFDVRLNRPRPHLDDKVIVSWNGLAISSFARASKILKSEAEG
    TKFRFPVVGCDPKEYMEVAEKAASFIRKWLYDEQTRRLRHSFRNGPSKAPGFLDDYAFLISGLLDIYEFGGNTNWLVWAI
    ELQDTQDELFLDKEGGGYFNTPGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLTSMVAGSWFERHRRNAEHLLAVFETR
    LKDMAMAVPLMCCGADMFSVPSRKQVVLVGHKSSVEFEDMLAAAHAQYDPNRTVIHIDPTETEQMEFWEAMNSNIALMAK
    NNFAPDKVVALVCQNFTCSSPVTDSTSLKALLCLKPSSA

    >gi|225458263|ref|XP_002281359.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAASVNNIAATFATAPIPSSSSSSSNQATFALSMSRKPISTSWNPHRSLHRSQKSFFINLYGPPGPPPPFQEISTARDPR
    LASISIGGKLPNATLSSLGPNGRVQNVDISSLAKGKKLLLVGVSAAFSPN
    CTRFVKRIEAMKGKSADLIACVAINDEFVM
    RAWGQHLGVGEKVMMLSDGRGELATALGLSTHIQNDVSAGSGLGVRSRRFCLAAVNGLITTVHLDDSDDYCISHATGRC

    >gi|225451521|ref|XP_002272852.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MHYQTESWGSYMPTRSVGDPLERIERLASENAVVIFSISSCCMCHAIKRLFCGMGVNPTVYELDEDPRGKEMEKALMRLL
    GSSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLKDAGALWL

    >gi|225449060|ref|XP_002275017.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAGRVVMILSILILLPFVAFSLSKADEPEDLTLLQSQDQNDVVSPPPDPNRFNGGGGGDDDDLSDSDGAGGDDDSDREVV
    DEKDVVVLKEANFSEFLERNPYVMVEFYAPW
    CGHCKALAPEYAEAATELKGEAVLAKVDGTEESGLMDKYEVQGFPTLYF
    YADGVHKAYSGLRTKDAIVAWVKKKMESGIHNITTTVEAESILTTESKIVLGFLDSLEGPESQELAAASRLEDDVNFYQT
    ASPEVAKLFHIDQQVKRPALVLLKKEAEKLSHFDGQFIKSAIAEFVFANKHPLVIIFTKESSRQIFENPIKKQLLLFATS
    KDSENVLPQFQEAAKAFKGKLIFVYVEMDNKDGKSVADYFGVTGDAPRVLAYTGNDDAKKYVLDGELTLTSIKSFGEDFL
    EDKLKRFYKSDPIPETNDGDVKIVVGDNFDELVLDESKDVLLEIYDPS
    CGYCQALEPTYNKLAKYLRGIDSLVIAKMDGT
    KNEHPRAKTDGFPTILFFPAGNKSFDPITFDGDRTLVAFYKFLKKYASIPFKLKKPASYQSSKGAEAKDGNESNNSVKDE
    L

    >gi|225470444|ref|XP_002274690.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MRSFSFYERVSRAFHDHSSLSRLVVLFTVSGGGLLAYSESKSYPGVRSLGSSEDDNKKKRVVVLGTGWAGTSFLKNLNNS
    SYDVQVVSPRNYFAFTPLLPSVT
    CGSVEARSIVEPIRNIVKKKNVEIHFWEAECIKIDAENKKVYCKSSQDTNLNGEEEF
    VVDYDYLVIAMGARSNTFNTPGVVENCHFLKEVEDAQRIRRSVIDCFERASLPNLTDEERKRILHFVVVGGGPTGVEFSA
    ELHDFVNEDLVKLYPTVKDLVKITLLEAGDHILNMFDKRITAFAEDKFHRDGIDVKTGSMVVKVSDKEISTKERGNGNIT
    SIPYGMAVWSTGIGTRPVIMDFMKQIGQTNRRALATDEWLRVEGRDSIYALGDCATINQRKVMEDISAIFSKADKDNSGT
    LTVKEFQEVIDDICERYPQVELYLKNKQMHDIVDLLKDSKGDVAKESIELDIEGFKSALSQVDSQMKNLPATAQVAAQQG
    AYLASCFNRMEECEQNPEGPLRFRGSGRHRFHPFRYKHFGQFAPLGGEQTAAQLPGDWVSIGHSSQWLWYSVYASKLVSW
    RTRALVISDWTRRFVFGRDSSRI

    >gi|225429254|ref|XP_002265129.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGSNILKLSPFSFSKTLVFPKTVFSKLLPSPQFASFSPKTSYAGGLRLSLPRSKRNFVAMAGPGSVQKSDEEWRAVLSPE
    QFRILRRKGTEYPGTGEYDKFFEEGVYNCAGCGTPLYKSTTKFNSGCGWPAFYEGLPGAINRTPDPDGMRIEITCAACGG
    HLGHVFKGEGFPTPTNERH
    CVNSISLKFTPANSSSSL

    >gi|225430920|ref|XP_002277021.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MALRLSLSPPPIRSSASPSWAAPHSIAISCSSSSSVGVSVPTQEKRRARVVVRSSSIDTAEAVVGQVTEVNKDTFWPIVK
    AAGDKAVVLDMYTQW
    CGPCKVMAPKFQELSGKYLDVVFLKLDCNQDNKTLAKELGIRVVPTFKILKDSKIVKEVTGAKLD
    DLVVAIETVRSS

    >gi|225432556|ref|XP_002280928.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MADSTAHVSRSRDLDKLLLRPGHLVGPTFEPGPELRDDLRKFATVLVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVS
    NLNRQFLFRLQDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDIEFYNHFNIIALGLDSIEARSYINAVACSFLEYDS
    DDKPLEETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPL
    CTLAETPRTAAHCIEYAHLIKWDEVHSGKA
    FDPDDPEHMKWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIVSGCSKTLSNYLTYNGAE
    GLHTKVTEFVKDMDCLICGPGVLIELDTSVTLQKFMDQLQEHPKLLLSKASVKHREKNLYIQAPPVLEELTRSNLNLPLF
    DLMGKIRKDIVHVTGSTTKNDKKTSCLRKLRVVFKGIDGATDMDTAGGA

    >gi|225461068|ref|XP_002281649.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MVSTSKIKSVDFYRKIPRDLTEASLSGAGLSVIAALSMMFLFGMELSNYLSVSTSTSVIVDQSSDGDFLRIEFNISFPAL
    SCEFASVDVSDVLGTNRLNITKTIRKYSIDPDLRPTGAEFHSGPVGKVIKHGDETDEEYSEGSASLTAQNFYKYSHQHAI
    LVVNFFAPW
    CYWSTRLKPSWEKAAKIIRERYDPELDGRIVMAKVDCTEEGELCRRHHIQGYPSIRIFRKGSDVRDDHGHH
    DHESYYGDRDTDTLVTTMETLVAPIPLESQRLALENKSDSTADHIKRPAPRTGGCRIEGFVRVKKVPGNLVISARSGSHS
    FDPSQMNMSHVISHLSFGRKIAPRVMSDMKRVLPYIGGSHDRLNGRSYISHPSDSNANVTIEHYLQVVKTEVITTRDHKL
    VEEYEYTAHSSLVQSLYIPVAKFHFELSPMQVLVTENRKSFWHFITNVCAIIGGVFTVAGILDSVLHNTMRLMKKIELGK
    NF

    >gi|225432560|ref|XP_002281011.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASRILKRSMMMKSTVESLRIAAAAASRHYASVAVGTDLVSAAPDVRLQKARTWDEGVSSKFSTTPLKELFKDKKVVIFG
    LPGAYTGV
    CSAQHVPSYKKNVDKFKAKGIDSVICVAVNDPYTLNAWAEKLEAKDAIEFYGDFDGSFHKSLDLEVDLSAAL
    LGPRSHRWSAYVVDGKVKALNIESAPSEVKVSGADVILEQI

    >gi|225436769|ref|XP_002267785.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDSVMALGTAKPVVIFTKNSLCCMSHSIKTLISSYGASPTVYELDEMPNGEQMEKALPILGCPNLPAVFIGKKLVGGARE
    IMSLQVRGELSDLLIEAKAIFFWNKK

    >gi|225426156|ref|XP_002278648.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASISNSLPLKHGISLWCPQHASLNRTRLPSSFGSSASARRYGVVSCAFANENREFVIVGGGNAAGYAARTFVEHGMADG
    KL
    CIVSKEAFAPYERPALTKGYLFPLDKKPARLPGFHTCVGSGGERQTPDWYKEKGIEMLYEDPVTGIDIEKQTLMTNSG
    KLLKYGSLIIATGCTASRLPDKIGGNLPGVHYIRDVADADSLISSLEKARKVVIVGGGYIGMEVAAAAAGWKLDTTIIFP
    EDHLLQRLFTPTLARRYEEFYQENGVKFVKGASIKNIEAGSDGHVTAVKLENGSTIEADTIIIGIGAKPAVSPFERVGIN
    TTVGGIQVDGQFRTSVPGIFAIGDVAAFPLKMYNRIARVEHVDHARRSAQHCINALLTAKTHLYDYLPYFYSRVFEYEGS
    PRKIWWQFFGDNVGETVEIGNFDPKIATFWIDSGKLKGVLLESGSPEEFQLLPKLARSQPHVDMTKLQKASSVEEALELA
    HAYVQAGAAV

    >gi|225437910|ref|XP_002267052.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAASISHFAPFSSSRGFSPSSSSSPLLLSYLLTRSVQFHSNHIPRSFGIGHAGNRRYGPVLVRAMASSFGSRLEETVKKT
    VDENPVVVYSKTW
    CSYSSEVKSLFKRLGVEPFVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYR
    KGELEPLLSEASTRKTES

    >gi|225436775|ref|XP_002267962.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDRVEELARKNAAVIFTKSSCCMCHSIKTLFYDLGASPAIHELDKDARGREMEWALRRIGCNPSVPAVFVGGKFVGSAKD
    VITSHVDGSLKQMLIAARAIWF

    >gi|225444940|ref|XP_002282326.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MADVFRLSSSLLTSFSSSLSFLQPGLAPTQKLDKRIYSVANWDVARLAFRPRKRLPSFKVNARVAETEQPKWWEKNAGPN
    MIDIHSTQEFLGALSQAGDKLVIVEFYGTW
    CASCRALFPKLCRTAEEHPEILFLKVNFDENKPMCKNLNVKVLPYFHFYR
    GADGQLESFS
    CSLAKFQKIKDAIRTHNTARCSIGPPKGVGDLSLESL

    >gi|225436777|ref|XP_002268050.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDKVTRLASEKGVVIFSKSSCCLCYAVNILFQELGVTPTVHEIDQDPDGREMEKALLRLGCNAPVPAVFIGGKLVGSTNE
    VMSRHLSGSLIPLLKPYQQTLS

    >gi|225437916|ref|XP_002268052.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MEKTLRISDHDDFFSRRCVWVNGPVIVGAGPSGLAVGACLKEQGVPFVVLERAECIASLWQKRTYDRLKLHLPKQFCQLP
    KMPFPEAFPEYPTKKQFIEYLESYAKRFEVNPRFNECVQSAKYDETCGLWRVRTVSTNAAAGAHSEVEYICRWLVVATGE
    NAERVVPDIEGLGAFGGNVMHA
    CEYKSGETFRGKRVLVVGCGNSGMEVSLDLCNHNATPAMVVRSSVHVLPREVFRKSIF
    ELATLMIKWLPLWLVDKLMLILAWLVLGDVEKYGLKRPSMGPLELKNTQGKTPVLDIGALEKIRSGDIKVVPGIKRFFPD
    SVELVNGEKLDIDSVVLATGYRSNVPFWLKESQFFCKNGFPKASFPNGWKGKAGLYAVGFSRRGLSGASLDAIRIAQDIG
    KVWKEETAQKPKTTACHRRCISQF

    >gi|225443926|ref|XP_002278846.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MQMKESGMIEEQLGMDGEAHEKPETTYEAVRRLGSSNAVVVFSLSGCCMCHVMKQLLFGLGVGPTIVELDKEKYGSEMQS
    VLYQLAGGQHSVPAVFVGGKFLGGIETLMSCHINGTLVPLLKAAGALWL

    >gi|225443928|ref|XP_002271644.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAVVKSEIAEKSHRRRWVWVVGALLVVLAMAMKPMISHFGGSNKPCHCGKDAHKYSGMVEDCCCDYVTVDHLNEEVLHPI
    LQELVTTPFFRYFKAKLWCDCPFWLDDGM
    CHLRDCSVCECPENEFPETFKKPFNHVLSSEDLICQEGKPQAAVDRTLDTK
    AFKGWVEVDNPWTNDDETDNAFDGSFSFAAEMTYVNLQLNPERYTGYTGPSARRIWDAIYTENCPKYPSGEFCQEKKILY
    KLISGLHSSISVHIAADYLLNEATSTWGQNLTLLYDRVIKYPDRVGNLYFTFLFVLRAATKAADYLEQAEYDTGNPDDDL
    KTQSLMRQLLYNPKLQAACPIPFDEAKLWKGENGPELKQQIQKQFRNISALMDCVGCEKCRLWGKLQVHGLGTALKILFS
    IDGQDLLGQSLQLQRNEVIALMNLLNRLSESLKVVHEMGTSAEMTIKGQISAPAAQSCPLQRIWASIVGTKEGQSSAPTS
    QGCPLQRMWASIVGSR

    >gi|225423631|ref|XP_002276004.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAPSFGGLQLTPFSSGGRKTLPDDDAGDLEDVRLLDAYKEDDSGLEEGMRGIQVRVTGMTCAACSNSVEGALRDVNGVLR
    ASVALLQNRADVVFDPKLADVCCNCSLVQEEDIKNAIEDAGFDAEIMSEPSRTKPHGTLLGQFTIGGMT
    CAVCVNSVEGI
    LRKLPGVKRAVVALATSLGEVEYDPTIISKDDIVNAIEDAGFEASFVQSSEQDKIILGVTGISNEMDALILEGILTSIRG
    VRQFLFDRTLGELEVLFDPEVISSRSLVDGIEGGSNAKFKLHVKNPYTRMTSKDLEESSNMFRLFTSSLFLSIPVFLIRV
    VCPHIPLVDSLLLLRCGPFLMGDWLKWALVSLVQFVIGKRFYIAAGRALRNGSANMDVLVALGTSASYFYSVCALLYGAV
    TGFWSPTYFEASAMLITFVLLGKYLESLAKGKTSDAIKKLVELAPATALLLVKDKGGRFIEEQEIDAMLIQPGDVLKVLP
    GTKVPADGIVMWGSSYVNESMVTGESAPVSKEVNSPVIGGTMNLYGALHIQATKVGSNAVLSQIISLVETAQMSKAPIQK
    FADFVASIFVPTVVAMSLLTLLGWYVSGTLGAYPKQWLPENGNYFVFALMFAISVVVIACPCALGLATPTAVMVATGVGA
    NNGVLIKGGDALERAQKVKYVVFDKTGTLTQGKATVTTAKVFTGMDHGEFLTLVASAEASSEHPLAVAIVEYARHFHFFE
    EPSTTKDAQDHSRETRFSGWLLDVSEFSALPGRGVQCFIKGKRVLVGNRKLLTESGVTIPTDVENFLVNLEESAKTGVLV
    AYDDTAVGVLGVADPLKREAAVVVEGLLKMGVIPVMVTGDNWRTARAVAKEVGIQDVRAEVMPAGKAEVIHSFQKDGSIV
    AMVGDGINDSPALAAADVGMAIGAGTDIAIEAADYVLMRSNLEDVITAIDLSRKTFSRIRLNYVFAMAYNVIAIPIAAGV
    FFPWLGIKLPPWAAGACMALSSVSVVCSSLLLRRYKKPRLTTILEITVE

    >gi|225423633|ref|XP_002275152.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MARNSVLLRHLLRFSPSSRARSSSLIETLASSPIAVPSPPIHTISSFFTTATANSQFSRPCLNYRTLCSSSGQSKIALIK
    SEEEFNTSLSKVQDESLPAIFYFTAVW
    CGPCRFIAPIIAELSEKYPHVTTYKIDIDQDGLENTLRRLNIASVPTLHFFQN
    GKKAAEIIGADVARLKDTMDKLYKKD

    >gi|225432145|ref|XP_002265597.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MPGLTLGDTIPNLEVETTHGRTKLHDYIGDRWTIIFSHPGDFTPVCTTELGKMAAYTEEFARREVKLLGLSCDDVQSHKE
    WIKDIEAYTPGSKVTYPIAADPKREIIKQLNMVDPDEKDSSGNNLPSRALHIVGPDKKIKLSFLYPASTGRNMDEVLRAL
    ESLQKAAKHKIATPANWKPGEPVLIPPSVSNEQAKRMFPQGFQTCGLPSKKEYLRFTQV

    >gi|225441487|ref|XP_002275794.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSILAANTHIVYREVLLRDPQNQLSGGGSCLFWSRSPGFGVDGRRGEWRKTKKRDFRVEAFWPDMTRPNVIEMQPIKDCD
    QLDQILARAQELPQPIIIDWMAAW
    CRKCIYLKPKLEKLAAEYDTKIKFYSVDVNNVSQALVKRGNITKMPTIQLWKDGEM
    KAEVIGGHKAWIVIDEVREMIKKFV

    >gi|225452680|ref|XP_002282318.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MGSVVSGLLGGGAADASDSTLEGSGVNVFHSSERWLLHFNASKESNQLMVIDFAATWCGPCKFMEPAVKSMASKYTDVDF
    VKIDVDELPDVAQEFTVQAMPTFVLLKKGKELERVIGAKKDELEKKIQKHRAVSNA

    >gi|225459495|ref|XP_002285840.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAYVERGVVKSNRSIWRLRTITDFFWAIVNFIGVFFVTMFSMEKSDAYRKSSGSGKKWDGGGPGGPGRGPYGGGPRGPPR
    GLDNVRGIDHSALPA
    CGSCCGG

    >gi|225465829|ref|XP_002264063.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAMMQTATRLPHSTITSVSPMIPLQGPPSHLCFSHSPMTHQPNLLFSTTNTRPFSLRPPRKLLCTPPRGKYVREDYLVKK
    MSAKEVQELVKEERTVPLIIDFYATW
    CGPCILMAQELEMLAVEYESNALIVKVDTDDEYEFARDMQVRGLPTLYFISPDP
    TKNAIRTEGLIPIQMMRDIIDNEM

    >gi|225438631|ref|XP_002281217.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
    MGVGGTLEYLSDLMSSGHKHKKRKQSQTVELKVRMDCEGCELKVKKTLSSLSGVKSVDINRKQQKVTVTGYVDANKVLKK
    AKSTGKKAELWPYVPYNLVAQPYAVHAYDKKAPPGYVRNVEQPPISGTVTRYEDPYITMFSDENPNACSIM

    >gi|225448755|ref|XP_002281575.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MEALNLSYCSCVGSSRLTSSRDLLNSFCLSTKKKITIKFSNTGAFSLKNQAFISLRRPRSRTISAAMATGSVREVLPPAL
    DSTSEPPPLFDGTTRLYISYT
    CPYAQRVWITRNCKGLQEKIKLVPIDLQNRPAWYKEKVYPANKVPSLEHNNEVKGESLD
    LIKYIDSNFEGPSLFPDDPAKREFAEELLAYTDSFSKAVMTLLKGDGVDEAGAAFDYIEMALSKFEDGPFFLGQFSLVDI
    AYAPFVERFVPFLREVKKYDAMAGRPKLEAWFEELSKNEGFQQTRREPKELVEAYKKRFAAHL

    >gi|225467025|ref|XP_002265898.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MLDSLNITVYDSNILCQEKPPVEPGSVNDNVTQAASSSTDPGLPEFPSKDINRRIAVVSSLAAVGLFLSKRLDFGVSLKD
    LSAAALPYEEALSNGKPTVVEFYADW
    CEVCRELAPDVYKVEQQYRDRVNFVMLNVDNTKWEQELDEFGVEGIPHFAFLDK
    EGNEEGNVVGRLPKQYFQENVEALAHGEASIPHARVVGQYSSAESRKVHQVVDPRSHGRG

    >gi|225457905|ref|XP_002271788.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MNKVNKLTVLGRAVGGRASAAGIGLTTQRRLLQPAMLGLNSASKLQRFPHKLAGHFPLPALAVSGTRLLSGLAQDVPAED
    PVHPKKFLPNDVVLYQYEA
    CPFCNKVKAFLDYYDIGYKVVEVNPINKKEIKWSQYKKVPILTVDGEQMVDSSDIINKLFQ
    RIHPEKYLDSVPDGDEERKWLGWVDNHLVHVLSPNIYRSASEAIESFDYITTHGNFSFTERIIAKYGGAAAMYFVSKKLK
    KRHSITDERAALYGAAETWVDALKGRKFLGGLEPNLADLAVFGVLRPIRHLKSGRDMVEHTGIGEWYSRMEAAVGESSRI
    KV

    >gi|225431301|ref|XP_002276296.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDPDSVKTTLSNLAFGNVMAAAARDYQKEVLSQQKALASSSINQEVDLDELMDDPELERLHADRIAALKKEAEKRQALKK
    QGHGEYREVTEADFLGEVTGSEKVICHFYHREFYR
    CKIMDKHLKSLAPRHMDTKFIKLDAENAPFFVAKLGVKTLPCVIL
    FRKGIAVDRLIGFQDMGGKDDFATRTLEALLIKKGIVSEKKKDEDDEDGGYPESRRNTVRSSVDPNSDSD

    >gi|225429279|ref|XP_002267357.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDQAQFLLVGLPLFLFFSDIINLFTPLPPKPPPHHHHHRHHHQQPQPKPQSAPLDFPTQKESGIGGIGFDNTVNINLCSS
    CSYSHHGLHVSSHGSPKLAM

    >gi|225425547|ref|XP_002264954.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDCEDGSAVHDVVSVLSSPNRDYLIRNNGNQVKITSLRGKKIGLYFSASWCGPCRRFTPELVEVYNGLSLKGDFEITFVS
    ADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPHLVIIGENGKVLTDSGVEIIREYGVEGFPFTSERIKELK
    EQEEVAKREQSLRSILVSDSRDFVISANGMKVPISKLEGRLVGLYFSLSSYKLCVDFTSKLVDVYAKVKAMGESFEIVLI
    SFDDDEESFNEGFGSMPCFALPFKDESCRKLARYFELSTVPTLVMIGPDGKTLHSNVVEAIEEYGIQAYPFTPAKFAELE
    EIEKAKQEAQTLESILVSGNRDYLIGKHGVKVPVSDLVGKNILLYFSAHW
    CSPCRAFLPKLTDAYHKIKAKDSGFEVIFI
    SSDRDQTSFDDFFSEMPWLALPFGDERKESLSKMFKVQGIPKVVAIGPTGRTITTQARDLVADHGADAYPFTDERLQEIE
    AQYEMAKGWPDKLSHALHEEHELALTQHQIYKCDGCDEEGHAWAFSCEECDFDLHPKCALEDGKGTEDDAMDEEKPEEGW
    ICDGKVCFKA

    >gi|225443584|ref|XP_002278515.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MHQALPYRTWVPTTGGGSSAGPSSATIEPSDGPMNPGVGMKDVTCVTKMVSENAVIVFGRRGCCMCHVVMRLLLGLGVNP
    TVFEVDEEDEAAVVDELSRVIAGEDAKEGRPQFPAVFMGGQLFGGLERVMATHISGELVPILKKAGALWL

    >gi|225456165|ref|XP_002282513.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MIQKTQKIPNPRFAMRRASALASSALSRALLSAQDGATTTAVIQHRIFQAALYGTTTSAAAQSTRRRWYSTALYSLSGGS
    AKTVSLSIAGALFSAAAATSLSEEVLAKEPPSPDLVPKDVVLYQYEA
    CPFCNKVKAFLDYYDIPYKVVEVNPLSKREIKW
    SDYKKVPILMVNDEQLVDSSAIIDKMSDKILPKKSADSASDDEERKWRQWVDNHLVHVLSPNIYRSTSEALESFDYITSN
    GNFSFTEKLTVKYAGAAAMYFVSKKLKKRHNITDERAALYEAAETWVDGLNGREFLGGSKPNLADLAVFGVLRPIRYLRS
    GRDMVENTRIGEWYTRMENAVGESSRIKA

    >gi|225433341|ref|XP_002282648.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MIQNFDQQDYVSRCIWVNGPVIVGAGPSGLAISAGLKKQGVPFVVLERANCIASLWKNHTYDRLKLHLPKQFCQLPYFPF
    PDNFPEYPTKVQFIDYLESYAKHFEITPRFNESVQSAKYDETCGLWQVKTISTSGSNWGEVEYICRWLVVATGENAEKVV
    PEFEGLQDFGGSVMHA
    CDYKSGESYQGKRVLVVGCGNSGMEVSLDLCNHKAIPSMVVRNSVHVLPREVLGRSTFELAVLM
    MKWLPLWLVDKILLIIARLLLGNIEKYGLRRPSMGPLKLKNTQGKTPVLDIGALERIRSGEIRVVPGIKRFSRGRVEFVN
    GENLEMDCVILATGYCSNVPSWLKDNDFFSEDGLPKTPFPNGWKGKAGLYAVGFTKRGLSGASMDAARPCNLLLVSTHGL
    ATTTKTLHFLPKSPSLFLHCCLLELGWCTLPYALVLQAPRSDIPMGRRLYQVDIYLNIAVTKMHKNMGPHCDMLIRELYQ
    VYVHFDITVTKKYKNMGCPPLYSPPHFHTAHSFLF

    >gi|225425549|ref|XP_002263549.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MATDKIDGVSHDLVLLLTSEDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRQFTPKLVEVYDEFSSKGDFEIIFV
    SLDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKMRGIPSLAMLDESGKVLSSEGVEIIKDYGVEGYPFTAEKIKEL
    KEKEETAKKEQSLRSILVSQSRDYVISADGRKVSVSELEGKLVGLYFSLSSYNACQEFTTTLAEVYEELRAKGESFEIVM
    ISLDDEEQSFKKYFESMPWFALPFNDKSCGKLARYFKLRVLPTLVVIGQDGKTLHSNVAEAIEQHGIQAYPFTPEKFVEL
    EEIEKAKREAQTLESILVSGDTDFVIGKDGVKIPVSHLAGKNILLYFSAHW
    CPPCRAFLPKLIEAYQNIKAKDEAFEVIF
    ISSDRDQASFDEFFSGMPWLALPFGDKRKASLGRTFKVRSIPKLIAVEPTGRTVTTEARNLVMIHGADAYPFTDEHIKEI
    EARYEEMAKGWPAKVKHALHEQHELVLTKHRMYRCNGCEKEGHLWSFYCAECDFDLHPKCALDEDKGIKDDNKLEKAKPG
    EGWKCDGEVCSRA

    >gi|225425551|ref|XP_002262828.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDSENVDGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAYNELSSNDDFEIIFV
    SGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVMLDESGKVLSEDGVDIIQEYGVEAYPFTPEKIKEM
    KEKEETARKEQSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLRAKGESFEIVM
    ISLDDEEESFKKYFGSMPWLALPFRDKSCEKLARYFELSALPTLVVIGPDGKTLHSNVAEAIQEHGIQAYPFTPEKFAEL
    EEIEKAKREAQTLESILVSGDRDFVIGKDGVKIPVSDLVGKNILLYFSAHW
    CPPCRAFLPKLIEAYQKIKTKDEAFEVIF
    ISSDKDQTSFDEFFSGMPWLALPFGDKRKASLSRTFKVHGIPSLIAIGPTGRTVTTEARNLVMIHGADAYPFTEEHIKEI
    EAQYEEMAKGWPEKMKHALHEEHELVLTKRRVYGCNGCEKQGHLWSFYCEECDFDLHPKCALEEDKGTKDDEMEKASPGE
    GWKCDGEVCYKA

    >gi|225441864|ref|XP_002278551.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAAKIGLGLGSVTQRAAMAAVTPSPSPSPLSNALPPPHSVIFLKSWSARRRSLRLDSSRKSPFSLRVKASTSSDSEASSA
    KGVENVVIIGSGPAGYTAAIYAARANLKPVVFEGYQVGGVPGGQLMTTTEVENFPGFPDGITGPDLMDRMRRQAERWGAE
    LFQEDVEFLDVKTTPFTVQSSERKVKCYSVIFATGATAKRLKLPREDEFWSRGISA
    CAICDGASPLFKGQVLAVVGGGDT
    ATEEALYLTKYARHVHLLVRRNELRASKAMQDRVHNNPNITLHFNTEAVDIVSNNRGQMSGILLRKVDTGEESVLEAKGL
    FYGIGHTPNSQLLKGQVELDSSGYVIVEEGSARTSVEGVFAAGDVQDHEWRQAVTAAGSGCVAALSVERYLVGNNLLIEF
    HQPQTEEVKKELTDRDVREGFDITLTKHRGQYSLRKLYHESPRLICVLYTAPT
    CGPCRTLKPILSKVIDEFDQNVHFVEI
    DIEEDPEIAEAAGIMGTPCVQFFKNKEMIKTLSGVKMKNEYREFIESNK

    >gi|225425553|ref|XP_002262857.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MDSENVDGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAYNELSSNDDFEIIFV
    SGDNDDESFHGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVMLDESGKVLSEDGVDIIQEYGVEAYPFTPEKIKEM
    KEKEETARKEQSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLRAKGESFEIVM
    ISLDDEEESFKKYFGSMPWLALPFRDKSCEKLARYFELSALPTLVVIGPDGKTLHSNVAEAIQEHGIQAYPFTPEKFAEL
    EEIEKAKREAQTLESILVSGDRDFVIGKDGVKIPVSDLVGKNILLYFSAHW
    CPPCRAFLPKLIEAYQKIKTKDEAFEVIF
    ISSDKDQTSFDEFFSGMPWLALPFGDKRKASLSRTFKVHGIPSLIAIGPTGRTVTTEARNLVMIHGADAYPFTEEHIREI
    EAQYEEMAKGWPEKVKHALHEEHELVLTKRRVYVCNGCEKQGHLWSFYCEECDFDLHPKCALEEDKGSKDDEMEKASPGE
    GWKCDGEVCYKA

    >gi|225447037|ref|XP_002269739.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
    MALAASSSSSAILGSVGSHDLNAAKISSFQRLNQPVILSASSNVIHGQSWMKPISADPKRSHAMIPFAATVAAPGNSSVL
    FSIDFRDYYGLYIGWLLLNDNVVYAEVLGKGESEVVEDYDKLAKDLESASPLEIMDKALQNFGNDIAIAFSGAEDVVLIE
    YARLTGRPFRVFSLDTGRLNPETYAFFDTVEKHYGIHIEYVFPDSVEVQALVRNKGLFSFYEDGHQECCRIRKVRPLRKA
    LKGLRAWITGQRKDQSPGTRAEIPVVQVDPTFEGMDSGVGSLVKWNPVANVDSMDIWNFLRAMNVPVNSLHSQGYVSIGC
    EPCTRPVLPGQHEREGRWWWEDSKAKECGLHKGNIKQEQVPELNGNGNGAAHKNGNAAVTDIFNSQNVVSLSRTGIGNLT
    KLENRADPWLVVLYAPW
    CRFCQAMEGSYDELAEKLAGSGIKVGKFRADGEQKKFAQQELQLGSFPTILFFPKHSPNPIKY
    PSEKRDVDSLTAFVNALQ

    >gi|225425555|ref|XP_002263480.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTPELVEVYDEFSSKGDFEIIFV
    SRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRGIPSLAMLDESGKVLSSEGVEIIKDYGVEGYPFTAEKIKEL
    KEKEETAKKEQSLISILVSQSRDYVISTDGKRVPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLRAKGESFEIVM
    ISLDDEIESFKTNFGSMPWLALPFKDRSCKKLARYFELSALPTLVVIGPDGKTLHSNVAEAIQEHGIQAYPFTPEKFAEL
    EEIEKAKREAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHW
    CPPCRAFLPKLIEAYQNIKAKDEAFEVIF
    ISSDRDQASFDEFFSGMPWLALPFGDKRKASLGRTFKVRSIPKLIAVEPTGRTVTTEARTLVMIHGADAYPFTEEHIKEI
    EAQYEMAKGWPEKMKHALHEEHELVLTKRGIYRCNGCEKQGHLWSFYCEECDFNLHPKCALEEDKGSKEDEEKARPGEGW
    KCDGEVCSRA

    >gi|225437227|ref|XP_002281935.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAAATSLSTPRLTFSSPKLQTLYRNFPISLSLNFSSSLSHSKTLTLAPGSLSQRTSSFSPRRCFAVRAESENGAEPRHYD
    FDLFTIGAGSGGVRASRFAANFGSSVAVCELPFATISSETTGGVGGT
    CVLRGCVPKKLLVYASKFSHEFDESGGFGWKFE
    AEPKHDWSTLMANKNAELQRLTGIYKNILKNAGVTLIEGRGKIVDPHTVDVDGKLYTARHILIAVGGRPFIPEIPGSEHA
    IDSDVALDLPSKPKKIGIVGGGYIALEFAGIFNGLNTDVHVFIRQKKVLRGFDEDVRDFVAEQMSLRGIEFHTEESPQAI
    LKSADGSLSLKTNKGTVEGFSHIMFATGRRPNTKNLGLETVGVKMTKTGAIEVDEFSRTSVPSIWAVGDVTDRINLTPVA
    LMEGGALAKTLFGNEPTKPDYRAVPSAVFSQPPIGQVGLTEEQAIQKYGDIDVYTANFRPLKATLSGLPDRVFMKLIVCA
    KTNKVLGLHMCGEDSPEIVQGFAVAVRAGLTKADFDATVGIHPTAAEELVTMRTPTRKIRNSSPPEGKTDPEVKAAAGV

    >gi|225447039|ref|XP_002269791.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
    MKPISADPKRSHAMIPFAATVAAPGNSSVEVVEDYDKLAKDLESASPLEIMDKALQNFGNDIAIAFSGAEDVVLIEYARL
    TGRPFRVFSLDTGRLNPETYAFFDTVEKHYGIHIEYVFPDSVEVQALVRNKGLFSFYEDGHQECCRIRKVRPLRKALKGL
    RAWITGQRKDQSPGTRAEIPVVQVDPTFEGMDSGVGSLVKWNPVANVDSMDIWNFLRAMNVPVNSLHSQGYVSIGCEPCT
    RPVLPGQHEREGRWWWEDSKAKECGLHKGNIKQEQVPELNGNGNGAAHKNGNAAVTDIFNSQNVVSLSRTGIGNLTKLEN
    RADPWLVVLYAPW
    CRFCQAMEGSYDELAEKLAGSGIKVGKFRADGEQKKFAQQELQLGSFPTILFFPKHSPNPIKYPSEK
    RDVDSLTAFVNALQ

    >gi|225462234|ref|XP_002270705.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAESREKKESRRQVWRWSLGAPLLAVLVATAITSIAFPEISLFNGNTNDNRKFCHCAQHLNSENGALIPTSGKKTERRLF
    LEIQGNVPETTEGHCWDSLKYTGIVEDCCCHYETVSLNEEVLHPWLQELVTMPFFRYFKVKLWCNCPFWPDDGM
    CKLRDC
    SVCECPESEFPEPFKSPFKRTLQSDNLACQEGKPQATVDRTLDSKAFRGWIETDNPWTNDDETDNAEMTYVNLQLNPERY
    TGYAGPSARRIWDAIYSENCPNHSHGETLQEKNLLYKLISGLHSSISIHIAADYLLDETTNLWGQNLGLMHDRVLRYPDR
    VRNLYFTFLFVLRAMRKASAYLEQAEYNTGNHAEDLKTQSLMRQLLCNPKLQAACPLSFDEAKLWQGQSGPELKQQFQKQ
    FKHISALMDCVGCEKCRLWGKLQILGLGTALKILFSVDDQNHTPLQLQRNEVIALVNLLSRLSVSFKLVNEIRPSAEKLM
    GGQISAAPVLENRPWQRIWEFMDRLRLSMHPNSPNPPRYSPSLIYLHVVSISRYPYPFFANVYESCVPMIIISFVLSLGH
    VLIPLFMLSGLGLGSQSGFTSLDQSRGEIDSVFLERSDMDQRVVTVDQFTTAMASIQEALASPRQEIDSQQSRQFVVQDE
    TACDSLPHLPPLGSTVPRAPPYMLHGHFEVASLAVV

    >gi|225456185|ref|XP_002282720.1| PREDICTED: similar to Hsp70 interacting protein/thioredoxin chimera [Vitis vinifera]
    MDDAKISELKQFVNSVKSDPSILYNPSLSFFKSYLQSLGARIPEKPDKCGCGTSDHGEHVDAKKTNLCSEDDKFEDDIVE
    SDIELDDTDVVEPDNDPPQKMGDLSIDVTEENQDAAQMLKSKAMEAISEGKLDEATDNLTEAIMLNPSSAILYATRASVY
    VKLKKPNAAIRDADAALKINPDSAKGYKIRGMARAMLGLWEEAATDLHVASRLDHDEEIALVLKKVEPNAHKIEEHRRKY
    ARLCKERELRKSGHQKQQQQAQPHDSEAAAAFKDGQVMAIHSSSELETKLKAASKTSRLAILYFTATW
    CGPCRYISPVFT
    SLSGKYPKVVFLKVDIDGAQDVAVSWNVSSVPTFFFIKNGKEIDKVVGVDKSALETKIAQYAGQS

    >gi|225440735|ref|XP_002280930.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MACSAPSTPTTLLSSNPRAFPSKSLSTVASFSKPLSPQTLTIPNSFNPLRKPFQSPVPRSISSRGSHSRRSLVVRASSEA
    PLVGNKAPDFEAEAVFDQEFIKVTLSEYIGKKYVILFFYPLDFTFV
    CPTEITAFSDRYEEFEKLNTEILGVSIDSVFSHL
    AWVQTDRKSGGLGDLKYPLVSDVTKSISKSYDVLIPDQGVALRGLFIIDKEGIIQHATINNLAIGRSVDETMRTLQALQY
    VQENPDEVCPAGWKPGEKSMKPDPKLSKEYFAAI

    >gi|225460191|ref|XP_002277099.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MAMLSQSSSFTNPPQKFSSNTQFSFPVSPFSVSTSKFSPFSPRLLGNGNWVSQGNRFRAKSADPDADPGFSQEEDAVSSG
    GTGTTPSTSFLSVLCPLLKLFSAGDPSQERNYLLEVATSSLSTLSRFPWGSRSLSDSSQSEEATTVDPPTRLQLFEFEA
    C
    PFCRRVREAITELDLSVEVYPCPKGSVRHREMVRRFGGKEQFPFLIDPNTGISMYESGEIVKYLFQQYGKGKSPSTGLLE
    STLFTGWMPTILRAGRGMTLWEKARLDPPAKKLELFSYENNLYARIVREALCELELPYILQNVGEGSPRTKLLIEASGSK
    EVPFIIDPNTGMQIGDYKKILSYLFQTYAMVTV

    >gi|225432821|ref|XP_002283622.1| PREDICTED: hypothetical protein [Vitis vinifera]
    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPST
    VMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY