Ustilago maydis uid14007

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|71003051|ref|XP_756206.1| hypothetical protein UM00059.1 [Ustilago maydis 521]
    MASTARPPTVPLVIAPKALASLIEADKASTSKVRILDATWFMPNTNPPRNAFEEFKAGPRLPRALFWNVDKVATVGESVR
    NLPHMMPSPATFAEAASMHGIEPDTHVVVYDTHGVFSAPRTAFTFKAFGHLNVSVLNGGLPAWVNNGLATESGEPASVSK
    SKYPEPVLQDGIIRSFDEMLANAKMGARAQTVFDARSKGRFQGTDPEPRPGLSSGHIPNSLSLPFPNLLKTETGKDGKQY
    TVLKDQIELWRTLSDTVGGMEALDKLRQASSGGELAATNT
    CGSGMTAAAIWLALQEIGVQSSIYDESWMGWASRESQGAP
    IHKIA

    >gi|71003387|ref|XP_756374.1| hypothetical protein UM00227.1 [Ustilago maydis 521]
    MSPTAPLLEEPQASGSTSPPMGAKVTATFQIGGMTCGACVETIERMIRSQPGIESISVALLAEKATITFDDSIWSLDKVA
    EEIEDTGFDATFLEVLRTERPDAGFASKEASSDPVPRLDTVQLSVYGMT
    CASCSSTIERETAKIDGIRSISVSLSTEKAA
    IVYDPSKLGIRDLIEHIEDLGFDAVVSDDRNSTQLASLGRIKEIAEWRSAFLFSLSMGLPVFFLSMVLPKFSVTHAILWW
    QPISGFYLQDLICLALTIPVQFGIGLRFYRTSWKAIKHGSATMDVLIVIGTTASWTFSVFSMIARLFCVDELATATKEAA
    SIVARSSGMIDMMVPGQCTKPATFFDTTTMLFTFVSFGRFLENTAKGKTSEALSRLIGLTPTSATIYTDGAEGKIEKKVA
    SELVQRGDYVKVVPGERIVADGVIVRGESTVDESMVTGEAVPIHKLRGSSVIGGTVNGTGTFDFLVQRAGKDTSLAQIVK
    LVDEAQTSKAPIQAFADRVAGYFVPTVVGLGALTFVAWMVIAHLLSGHMLPSIFNQQGVTKFMVCLKLCISVIVVACPCA
    LGLSTPTAVMVGTGVGAQNGILIKGGGPLEASTTIRRMLFDKTGTLTVGKLTLSQVIWPNGEEGGLDNIAVGGLSRRQVI
    RIIGAAETRSEHPLARAIASWAASQLETGITAVDEQADIVMSGTSIEAFQSFTGKGVVCRVQLEETMTLHEVRIGTPEFI
    LSDEKHALDHTEFGSQATEVLSQQQSQGRTAVLASVDGTLAAVLSLSDRLKPEAKQTLGALRRMGIQCSMVTGDAYATAR
    ALARELGMDEQNDVYAEMSPIDKQEIILQLRRESRVADLESGETFSPFRANGRSKSGGIAMVGDGINDSPALASADLGIA
    LGTGSDVAIEAASIVLMRSSLLDVAASIHLSRRIFRQIKLNFIWATVYNMIGIPLAMGIFLPWGLSLHPMMAGAAMAFSS
    VSVVASSLTLKWYKRPAELTLPTEVETPDSIQLQEMLARSDAGALDRVVANLKDVGYQVLGKFESILSKSRLSLGRGSSR
    RPAQTEGYQQVASDDV

    >gi|71004964|ref|XP_757148.1| hypothetical protein UM01001.1 [Ustilago maydis 521]
    MASIASSSTQNGTSAQPARYALAETILGKDAFHRTNTAKVLVVGAGGIGCELLKNLVLTGFGNIEIIDLDTIDLSNLNRQ
    FLFQKQHIKKPKSLVAKQTASSFNPLVNIVAHHANIKEPRFGVAYFQRFDLVLNALDNLDARRWVNKMCIAANVALLESG
    TTGFRGQVQPIRPGVTECYDCQPKETPKTFPV
    CTIRSTPSTPIHCIVWAKSWFFTQLFGADDETEDAELDKAIADGEDAQ
    EIDSLRKEAREMRDLRASLLQAAKQDDQQCVRTVVERIFNKVFKSDIERLLGMDEMWTHRPVKPVPLVFKDAVNGVSVVE
    SNAAGTEIAEAIVSDTTASTPAAISTASADQPLSNASTLKDQRTLSLQDNVELFLSSTAALAIRAAADLSNPLSFDKDDD
    DALDFVTSTSNLRSIVYHIDRKTRFQVKQMAGNIIPAIASTNAIIAGMLVLQALHILSGRWNKTRFITLTRGSDRYISGF
    PPAQPNPRCGVCQDVYVAVAVKSLKRVTLADVVERVAKEALEMDAEELVVYDGSRILADPDFDDNLDKSLDDVGLQQGSI
    LTITDEDQRLQAVNIVISVFEHEGDGAGSIKMLTENAMKPKPRFVERAEEQDDESDDDDDIIAVVDKANVPIKAAPAEAT
    TVAGKKRPHPDQDASPSPSPSSTALSVSNSALVSDKKQKIQPDGSSANAAIEFD

    >gi|71004990|ref|XP_757161.1| hypothetical protein UM01014.1 [Ustilago maydis 521]
    MLASTRWICALLPLLIATLIVVAGPLPSYDPAVQSLTERNFTSATDTGMWFIEFFSPHCGHCKRLAPTFHDIADDNRHLE
    DSSNFHIARVNCIAQGDLCARQNIDGYPSLELFSNGRWSESYEGGRSYEELNAYIQAKAADNRKLMALFGAAHHS

    >gi|71005242|ref|XP_757287.1| hypothetical protein UM01140.1 [Ustilago maydis 521]
    MSSSAETSPPRAGSYILISSSTAALDAPAPAADESARVFGSRPRLFFFLPLLAALDVATTLTLGILVLNQLAKHDEPAAH
    ILGGPLSHDPVMTSSLPGRTDPRLDDAAWERRKIVLLVIVFSIARAFSYGIVGFSIRIRQLGVTVAAISILSTLFYVSVA
    NLLFQARPKPGIVDKRSNSWSGVLASDAWRWPDAFRHFEPTMPILVGVQMAFTLFEWILYIAIVGVKIPPGGNPVEAKRW
    ARDLADDPQYRRGADMHSLYLSDDGHDQDITEEVRQPLEHLDAQDGGELQEVRTQLSSPISNLSCRGKSDGSDQPLLGAS
    SSTPRGYGSTLADPKTPQGPGSVRSVRSPVALQQHGMSRSSSALSGLYSRSPGTAELGPADRYEEVLADDDDDEDEQDGE
    GDEDAEGSDPDDIIDITPNRAVARKEARLRLARAALPARRASGGTLSTLNLFGGGGGSTNGSSGDAVSTRTGGGGTGGAG
    IFSDEAGSPLGRNAREGDVSRPALLSVATSDEASRGESLAADPSIQSSNSMTLPSSSSTRTASTRASSFKDRKFKLPKWI
    KRGNSRSSCERQACPPTTKSRMSAQLSRADFVLHLARASLSPPIDRECEITNRESRFVISTGLARIQNPYKLTSSTVTAL
    FKALRSAARSVKITPLALFSSVRVLRASRALGPSTTTTFTRAISVGVATIDKLRSSTTSACARLPIATASVAANRLQQTS
    THLSSFSHFSTSSAVKMPPVPKPTSTHYDMVVIGGGSGAMGVSRRAAAYGKKVCVIEEDGRLGGT
    CVNVGCVPKKLMWHA
    ADMAEHLKEAPEYGFGDVVNKPKVPEFAWKYFAEKRDAYVRRLNGIYDRNLDKDGVEYLSGHGKLTGKNEVEVTMRGQDG
    SFNAGTYKITGDRIVIATGGRPVIPSDDKIPGASLGIDSDGFFELKEQPKRVAVVGAGYIAVELAGVFNTLGSQTHLLIR
    HDTFLRPFDPIISETLQDYMSRTGLNVHKQTNITKVEGSKGGPLTIHTDKGDSIEVDCLLWAIGRRPNTDNLGLETVGVQ
    LDKGGNIVVDKYQETNVRNVFAIGDIQGKALLTPVAIAAGRKLSNRLYSNHASLKDDHMDYDNIPTVIFSHPTSGTVGLS
    EAQAVQKFGRENVSIHTSKFTSMYYGMLDHKAPSAFKMVVAPGDKVVGLHIVGLGADEMLQGFAVAIKMGATVKDFQDTC
    AIHPTSAEEVVTMIPTTKHA

    >gi|71005702|ref|XP_757517.1| hypothetical protein UM01370.1 [Ustilago maydis 521]
    MFITTEEETLAAFQHHHTGACRTIATTMLLQTLRTTTKAAPLCGSPIAASAAVRTFASTSRAYKVYENVSAADFQSRVLS
    PSGADAETPVLVDFFATW
    CQPCKLLSPALKKVASNPDVVGGKHIDLVTIDVDQHQDIAQQFKVSAMPTVIAMKGGKVLDG
    FVGMLPENKVIEFVQNLK

    >gi|71006164|ref|XP_757748.1| hypothetical protein UM01601.1 [Ustilago maydis 521]
    MSTNETPSLSAQATLSSDDALPTTAQLSAANSAYVLDSHNHRIDFTTLLDRAKTNKLGLVLVFTRHFHCGMCKEFVKALA
    RSSVLTDTSRVSLVVVGPGQAAGLEHYKDQVDRPPFEFYADPELTLYHALGVTRRSLNQGDASKDHIGSHHQQSITQTFL
    SSVTEIIKSGSLALKGGDFKQLGGEFVWTAEGKPVLAHHSVTATTLPNPGIAGSNLLPGKVVAITGASRGIGRACALACA
    AHGARGVIVHYFGDATTTTEAQSLQIELAQLGANAVLVAGDIADAAVGQSIADAAETEFGRLDVFVSNAGICPFMGFLEM
    QASTWRKVQDVNLNGAFFATQAAARLMARQTPQGGSIIAIASISALVGGEFQSHYTPTKAGLKSMMDSAAIGLGPLGIRC
    NSVLPGTIETAINQDDLKDTRKRARMMDRHPLKRLGTPDDIAGPVVFLASDLAKFMTGSSVLVDGGCFVNLQ

    >gi|71006418|ref|XP_757875.1| hypothetical protein UM01728.1 [Ustilago maydis 521]
    MSSINWNAPISLDSQLMALTRSSHRSIPLINTLTLSRRTLLGTGAIVACIAAISSGHLHTISATRASSSAAAPFKSHLRL
    FSSSPATAFKMGSTASSRSAPESFPKGMSDSEWRTKLNPEQFRILREKGTEMAGTGKYNKHYPKDGVYTCAGCDSPLYKA
    TTKFDSGCGWPAFFDAIPGAIDRHSDRSWGMERIEITCKNCGGHLGHVFKGEGFNTPTNERH
    CVNSVSINFDKDEAKI

    >gi|71006530|ref|XP_757931.1| hypothetical protein UM01784.1 [Ustilago maydis 521]
    MVSFYDLKAKKPSQEDYTFDQLKGKVVLVVNTASKCGYTPQFAELEELNKKYADQGLQIIGFPCNQFAGQDPGSDESIGE
    FCQRNYGVTFPMMAKSDVNGSNTNEVFQFLKKEKAGILGTEMIKWNFTKFLIDKEGNVIERYGSNTKPSAIAPAIEKLLS
    Q

    >gi|71006566|ref|XP_757949.1| hypothetical protein UM01802.1 [Ustilago maydis 521]
    MRLLHISLTLLVLAATALAGNVLDLTATKDFDKHIGKSQSVLVKYYAPWCGHCKNLAPIYEKVADAFADQKDAVLIAKVD
    ADKNKELGQKAGIRGFPTLKWYPAGSTEPEEFNSGRDLDSIAKLVTEKSGKKSAIKPPPPPAAEQLTSRNFDKIVLDQDK
    DVLVEFYAPW
    CGHCKNLNPTYQQVAQDFAGDDDCVVAQMDADNEANKPIAQRYGVSSYPTLMFFPKGDKSNPKPYNGGRS
    EEEFIKFLNEKCQTWRIKGGLLSELAGRMPTLDGFAARWYTSSTDKRDTIYNEFIDYVNTMKTSPKSDKKKNDVGDVYLR
    VLEKASKSAGYIEKETKRLSTILKKHADGTSQLAAKKVDELTKKKNVLLAFVNERIAAQAEKQKKEAEKRKEEHKDEL

    >gi|71006578|ref|XP_757955.1| hypothetical protein UM01808.1 [Ustilago maydis 521]
    MVSRFFQLVLLAGMILLIPSFLYLSHPSQPTLTDPATGLAYTTDSIVHGETTNDLAQISQGKGVEQSDWTAWNWHDASAN
    VNKGVHKVEDQVKGFIDHWRPNGVSPDNQVAPSESAAQLKTKPSSSHPSTTTSSTKDVERLPGIIMPKMGNTTAKEALGR
    STWHFLHTMTLRFPEKPTKQESETLRSFFYTFAQLYP
    CGECARHFQQLIRELPPQVGSRKGASNWLCVVHNEVNKSLGKP
    EFACDKLDESYDCGCRDDPTKLKSATVTQTSKLLAATPTTTSQVLTPIA

    >gi|71006654|ref|XP_757993.1| hypothetical protein UM01846.1 [Ustilago maydis 521]
    MPLSNLIGRAQASKQASKQASTYSALTSLCSVPPSKAHLQSLPKLCGISLGTVFGLLAIIYLPLMSRFFSLFTRSSQPLI
    QHLGPPTTPTAQAAQEALKGSNAAMSAQETATVANG
    CFWGTEDIYRKAYGNGKGLLDAKVGFIGGQESSKNPSYEEVCTG
    RTGHAEAAQIVYDPSKVSYAEIIEFFYRTHDPTQLNQQGNDRGTQYRSAIFAHDQTQLDIAKKVTEEVQKKHFDPKGKKI
    VTQLEIRKKEDFFPADDYHQKYLINHPDGYHCSTHRYWW

    >gi|71006702|ref|XP_758017.1| hypothetical protein UM01870.1 [Ustilago maydis 521]
    MSKPAPGHKDAVYHTQCTGQALETVKTHSSPAEQTLFGACFCPFVHRVWIALEYLGVPYQYREVDPYKKLADLLELNPKG
    LVPALKLSNGKGLAESSVILEYIDEKYGGGKEGKSLLPPLSNPYERAVYRLAVDKANRNLIPSFYRYLQAQEVEKQLEGA
    KEFTSHLSDFVRSMSSSGSVGFWDGKALSIVDCTVAPWLYRATNVLRHFRGFEPEQLLEPDVMERWTKWRDAVFDLDAFK
    ATTSTDDLYLDSYVRYAQNRPMTSQVAEAINKGRGLP

    >gi|71007418|ref|XP_758107.1| hypothetical protein UM01960.1 [Ustilago maydis 521]
    MSKQELLLQVTTDVICPWCFVGSRRLKAFLNSEDYKTQIAPHVRLVLKLEPYILDPRLPATSYDTPDKYYDAIETTPYDK
    NVPPTKKFYYGSKFGGGLDAFDAKISAAASELGMPKFDWTSEGKVGATWNAHRLVLKAGQLDEQNNSRADRDDLETALQS
    LQMRFMDRFYQDFHSNSKDMSDNTYLAGVAEELGLFDAQEAALTWLESDDLEYELGNKLQQAEMNGVQSIPFYIVNDGAD
    HMSETGSHGSFLKMMQMAVAPYLSELSAERDEPDKPTRLGFAVVSNDDFSTLTFCVTRTATCGRLSGVPIAARVSLCLLA
    YIAPQETFTNVRYKEFAIRRGNKYLIEPLLRVGLFLVTVISSWAHCHCDYAHRLAEMTRATSVPSVYDTHCDGPGLLPVT
    KPWSQYYCQLRKYTSDVYATLKFPDFKHADYDCTGKTVLISGSNSGIGKQAALYFARAGATVVMACRFTATHEQNPEEAR
    KEIVATAGVDDSKVELWEIDCSSLANIEKFGIKWRESGRTLDILVNNAGLSAGKRRITDEGFELTHVINLLSHCLLTFYL
    LPSLNKSAAPRIINTCSCFHAGGKLDFANMDNEKLTSLGPDCVQAYCDTKLWFLMWSVELQDRLSRSDDYRHVIVHGIHP
    GFVGSNIWHNPDTRIPYPLRIIFQSAISKLSINSEQGSYAIIHAALEPSLGLPKKLTSARNKLAVGESAKFGGKFINRNF
    VDIRRPEVDDVLARSRLWQRVLEDVAAAKRGVAADLPDHYESVKLLGQSTK

    >gi|71009457|ref|XP_758275.1| hypothetical protein UM02128.1 [Ustilago maydis 521]
    MTEASATTYEPTASNYTASTSTLIESSTTYHVDKSGRDLDDDDDDNDEDDDEKLFAELDKELDMMEDESNFGHHGGDTVA
    SFDMAEFRERRMEELRQEIAAQRSASDSESPLSSIQHTTTASMKGLLTEITNEKDLISFSSTERQVAIHFFHPKFQR
    CSL
    LDRHLTVLARLHPTTLFLKANVLNCPFLTQKLNVSVLPCLITFKDGISKDKIVGFEELGNSDKFSTGALEWRLGQSGIID
    PRENRKPIFGFSESNGGGDTVGKGVVGARKDIEDDFWDDE

    >gi|71013434|ref|XP_758590.1| hypothetical protein UM02443.1 [Ustilago maydis 521]
    MRPLFYAPALTLTPLFVAAVFYRPSVPAQQPLMLVEFYAPWCGHCKALAPEYEKASTELLADKIKLAKVDCTEENELCAE
    HGVEGFPTLKVFRTGSSSEYNGNRKADGIVSYMKKQALPALSELTADSYADFKSKDRVVAIAYLDSSDKAHLDAVNAVAN
    NLRDNYLFGVVHDAAVAEKAGVTAPAFVVYRQFDEPEVKFDGKSFNEEAITNFIKAESIPLIDELNAENFMSYAESGLPL
    AYLFADPESKDLKSTVESLKSLARANKGKLNFVWIDGVKYSAHAKSLNIQGEDWPAFAVQDIEQNLKFPLEDLSGDLVAK
    VTDFVSQYTSGSLKPSVKSEPIPKDQDGPVHVLVADEFDAVIGDDSKDKLVEFYAPW
    CGHCKKLAPTYDTLGEKYKAHKD
    KVLIAKMDATANDIPPSAGFQVQSFPTIKFQAAGSKDWIEFTGDRSLEGFVDFIALNGKHKVSVDLDPINVTEQAAPAKE
    APHHEEL

    >gi|71013524|ref|XP_758608.1| hypothetical protein UM02461.1 [Ustilago maydis 521]
    MISGLLSRSSVGPARAFQASTLPRVVSTLPRVHSRGLATGADPYDVVVIGGGPGGYVAAIKAAQLGLKTACVEKRGALGG
    T
    CLNVGCIPSKAMLNNSHLYHQAQHDFKSRGIDVGSISLNLETMLKAKSSAVTGLTKGIEGLFKKNKVDYLKGAGSFSSP
    TTIKVALNDGGETEIEAKNIIIATGSEVTPFPGIEIDEKQIVSSTGALELQKVPEKMIVIGAGVIGLEMGSVWSRLGAKV
    EVVEFLSTVGGAGIDGEIAKNFKKTLEKQGLKFRLGTKVIDAEKKDGKVYLNVEDAKSGDKTQLDADVVLVAIGRRPVTS
    GLNLEAVGIEKDERGRIIVDDQYNTTCKGVKCIGDATFGPMLAHKAEEEGIAAVEIIKSGHGHVNYAAIPAVVYTHPEVA
    WVGKNEEELKKEGVEYKVGKFPFLANSRAKTNADSDGTVKFLVEKETDKVLGVHIIGPNAGEMIASAVLAIEYQASAEDI
    ARTCHAHPTLSEAFKEAAMASYSKAIHF

    >gi|71016159|ref|XP_758872.1| hypothetical protein UM02725.1 [Ustilago maydis 521]
    MSDPLAATLSALPARQGRSASPMVSYDASLSLRWASLLQGTGTSPVETLRARGVEGKIALDNDASLRWLEWKIFLTEHIS
    TIPSSWSAVLKRDREAYNELRCRLLRAPDGNYPPEVGFDGTPTVFEPSFTSCSSTPSTSQSSRSIVKDLSVNNPLSLDDS
    NPWKTYYATLETRRVILQDVERTFPDIGLFRQTRVQQSLTNILFLWTLENQDVGYRQGMHELAAVLWKVRSDGAVDIPGR
    ASSSSSPTSAQNAADAAFVHALAHVFIEHDVYALFCVLMKSAKSWYVWRDSPVDAASTPSPPSTSAPRSAKLAPDSCNSE
    GNTRQPLPIVAKCEHVLKLLSHIDPALAQHLGSLGIEPQIFCLRWIRMIFTREFALDDAVAIWDGLFASGRSLDLIDYIC
    IAMLLRIRNQLLAGDHSSALLCLLRYPAEAQVQPNLLVKQAIFLRDSDHRPNTGVAVVMQNRDLLGIPVYSIDDQDNLSR
    PHRHESDSPSHRNSIRKYATVGRSPSGPANRASPWARLPNEPLTNTANTAQQRSRPDAGHWQTPASGGDPLGASYEPVRN
    ADANAPRAFGINPTSYLPEGIGDLAKGWYERAELPQSLNSALVNVSRTVAAAAVAGVAGAYGTNKAETSGFPSGFEQAFI
    EQTGGRGGGASSTVGHAASAKDRPRPSIFAPAEPLIPAAQASDAQLLDPLSKVTAANRAIGSALSACIEVLEQSWLDRSA
    FAHERPSSELEQKDVNTLMSFTALKHIRDVLDGTAAEFDPATLPAPIPKRVDLEVHRVKEAATQKDSTRDRAHPPVERKE
    IMSTTSTDISLDPHSSLPMSLAEYARYGRQMIIPDFGLPAQLRLRNAKVLVVGAGGLGCPAVQYLAAAGVGQISILDHDV
    VEPSNLARQILHRDATVGMHKAVSAAQAAKQINPHITAVPLSEAISAVNARQVMRGQDLVLDCTDNPLTRYLISDAAVLE
    AVQVVSGAAQGYDGQLVVLHKRIKAEFAGPRAAATPDGTYRGPCYRCLFPKAPRPDEVTN
    CEDGGVLGGVTGLVGTMQAL
    EAVKILAGVGEDTPPMLTLVSPLTSTPFRCVKIRSRRVATCRSCGDPAQVAERMIRNLETEDYASFCGLNVPVGEEAGIR
    RTAVKSMDSAALVVDVRPSVEFGIAKLDGSLNVPIQSLLKNPAGAWDQIHKAQRNTLSKDVLVVCKKGNDSQLAVRALLQ
    HQKHLCEQAESEAQQAPPAPSDPLQGSINTREPKTPNQAQAITPLQISDLIGGLRAYSKEKDPSFPVY

    >gi|71017567|ref|XP_759014.1| hypothetical protein UM02867.1 [Ustilago maydis 521]
    MSAVFRQSLGLLRSAPARGSLLCNPTRACFTPTYTSLTRLLSTEARAKIDSAVKSNPLVIFMKGTPDMPMCGFSRAVIQV
    MQVQGVKPELLKTFNCLEDQELREGIKEYSDWPTIPQVYVDGEFVGGCDIVINMHQSGELEDLLEKNGLLLPLNEEAAKA
    QA

    >gi|71017727|ref|XP_759094.1| hypothetical protein UM02947.1 [Ustilago maydis 521]
    MVSKQLITSTLPALRVGLRPSPAATRRLTTCAASSVAPSLFVAFPCRTLVRPSSIAPLALHLAANTGSMAASMRSFATTS
    VQKAISKGEQIPNTTFTYVPWAPELADGTACGAPTKIQTHEAFKGKKVVIVAVPGAYTPT
    CHVNHIPPYIKQIDSFKSKG
    VDQVIVLAQNDPFVMSAWGVQNKAEDKVIFATDLNLEFSKAIGSIADLSAMGFGQRTGRYALIVDDLKVVDFSPEPNPGA
    VEVSGADHVLAKL

    >gi|71018187|ref|XP_759324.1| hypothetical protein UM03177.1 [Ustilago maydis 521]
    MSFTDKIKAAIKGDVKEGAKLETGIKLKENNPENADVSLDNLVGKSIIVGVPGAFTPPCSSQVPGYIQHASEFQSKGVEA
    IYIVAVNDQFTVKAWKEKLGADTAPTVHFLADDTGAFTQAVGQDFDASGLLGNHRSKRYAFVVEGGVVRKAFVEDNAPDV
    TVTSAENVLKAI

    >gi|71018255|ref|XP_759358.1| hypothetical protein UM03211.1 [Ustilago maydis 521]
    MPHLPRVSAFPIAGETSILTAAGAALKVAAREKSSALIGHVAPEFCAQDHLGRTVSLHATIQLGRPIVLYFFPLAGSPHC
    TKESCSFRDAVGTSPVFNQLDAVVIGISQDAPARSKRFVDEHQLGFRIVHDSNRHIMDAWGVGRGLLGLVDARCTFIIDH
    RGIVRAMLDGIWDYKGHRDFAERWLCRIEHDLAGRQRFYVPHDAHSVACDELSRNVKIIYGDALPARGIGTAPRHGAALA
    AIQANRSSIWRKSASSQLGSTSLSLSLAAEANRFGSLHPAKSRRNLKNWLRSSDINAAYDQRLHLDYQLSRSSDQVDQHA
    HATLTDRAWHRLARRRRSFRFHRDAATNVVARGTRAATRSVSLSRQASASRPGSLTPRTVSTASESTRETCDTGAARDSH
    ALSVTTTIKNGTITDAVELECKAMLRQRAAQVTRNASGISGVSGAVGKTIATKRRSNSLVVNRTTSVAHNGADAVPDAAK
    ANSSDGHVSAATVYANGNIARMPLRRSVNGDTHDGVSLTTRVDARTRSAHVCNDTSHDSAYSLNSSSLPVPPRPSTRNGG
    VTIAPRASSLASRSTSSCSITSDGDHVHTPSSGAHAVQHQAAIEASRDDTRNRPAARPSTLSSAQSCGACIACRMQPITR
    SSSLATTRSLELTNAVVVGISAVESDHTSTTHQTRSSSTPSLATSLVSTCSTDQDGYMLHHDRAYSPSLAGSEHTFGGWQ
    E

    >gi|71019359|ref|XP_759910.1| hypothetical protein UM03763.1 [Ustilago maydis 521]
    MTEHTNGASSSSGPKVHKVVIIGSGPAGHTAAIYLARANLEPVLFEGMLANGLAPGGQLTTTTDVENFPGFPEGIRGPEI
    MDKFRAQSVRFGTEIHTETIAKLDLSSRPFKFWREWAEDKPPELTETLIIATGASAKRMHLTGEDTYWQSGISA
    CAVCDG
    AVPIFRNKPLVVVGGGDSAAEEAMYLTKYASHVHVLVRRDELRASKIMAKRLLAHPKVTVHFNTVPIEAKGDGELLQAVR
    VKDTKTNEERDMDANGLFYAIGHLPATSLVKGQVDLDSDGYIITTPGTAQTSVKGVFAAGDVADKKYRQAITSAGTGCIA
    ALEAERLLAEEEVLDPVDAAQANHYTGTDKA

    >gi|71020229|ref|XP_760345.1| hypothetical protein UM04198.1 [Ustilago maydis 521]
    MRASIASLVSYGLLALLSFLALSQVTGTFAQRQAKEQEALFKRIQSSSQGFIDVDTNEFSQIIQVPRDYAVTALLTTTTG
    GIK
    CPPCQVFQPEFEKLAQQWNKNKSVKSKNVFIKAEFSRAQGVFARYQLQHAPVLYTFPAPTASNGSPDHVSFDFNERS
    FSAPDVADHLNKLLNTKFTYKQPLNRKLIIVIATSTIMVAGAIFFIGPHLSGVFTSSKPIWMLLCIGSMIVFNSGYMWNS
    IRGAPYIAMKAGGKPEYFAGGFQNQYGVETQIVAAIYSLLAFSFIALTVLVPAQRDPTRQRAGVYVWSAIFLATFSLLFF
    IFRTKNPSYPFRLFF

    >gi|71020279|ref|XP_760370.1| hypothetical protein UM04223.1 [Ustilago maydis 521]
    MSAEAGPSNLVEVTSPEHFTEIMQKDLTRISLLNFHAPWAEPCKQMNEVVREIAIKYPQVLCLEIEAESLPDVSESFDIE
    AVPSFVLLRGHTLLSRISGANASALSAAVATHAASARSNGTGSVSKTSAAPRAASDVYDASSSKRNGASTYADEEDEENV
    VPETEEEIFARCKKLMEQSKVMLFMKGDPDTPR
    CGFSQKTVNLLRQEKVDFGHYDILKDENVRQGLKKLNEWPTFPQIIV
    NGELIGGLDILKESIESGEFQEMLHA

    >gi|71020915|ref|XP_760688.1| hypothetical protein UM04541.1 [Ustilago maydis 521]
    MSARSLVGGVRPLCASRICAALPALPALPVMRLAPRILVAPTTPLAFTPRIGRTFTSSARSLSKDTSWTSRGTVKYSELK
    PETAAPSGEITIIDVREPNEVAQGIIPSAVNVPLSQFQKAFSGDGGDFLREFAFQRPAYDDKVIFY
    CRSGKRSQQALEFA
    QKNGWWNVRNYQGSWLDWVQQEEARGQASKVKEEDD

    >gi|71020989|ref|XP_760725.1| hypothetical protein UM04578.1 [Ustilago maydis 521]
    MTATQAADDGEYPVKLFVYDLSRGMARSMSMPLTGRQIDGIWHTSIVAYDREYFFGQGISIVYPGTSHHGAPLETYDLGT
    TTIDRETFEGALLPDLRDRFRPQDYNLLSWNCNNFSQEVAKILTGADIPAHIRSLPQDFLSTPFGQMLRPQIDTMFSAPS
    ANIPAASDINTPDGIGGQLLNQVASRAYTGNTSMEQGSPSKASSSDPVHHITSSVQLDEVVSVFPCVAVLFTSES
    CPPCR
    IIKPVFTDLAHHYHVDESKPGNHKRVAFVQVDSNASTSSVFAQSNVTATPTVKLYTFGKESGQVKGADVGELRNAVDTML
    FEAYPAHPHARLSKPLKSLDSIPAQPHTYSSTPNLSSLLLKLDSTIAQHPAKSFAEKADLQVIRKVIASNWIPWLEATCV
    SKSEKPALGNLPAEASKVAKQISEILPLDSIFPVLDLFRLSVLNESFVTTAFRHPAVADRKDVNGITRLLSLVSDLAYRG
    EWSASQRPLLLTAARLLTNLAASAPFVQIIESHENVRSLAQELTTSLLLCPYAGVRSAAATCAFNLALHQHAERADWINQ
    DPQAPPMLGSRLGEMWESELASALLQAIINESESDETLYRLVAALTLHIHLSQYWKDSVGPMLQVLDAQNAMSNTLCSQL
    VIHSPKKQELSRLLDDLIVLLSSECAG

    >gi|71020991|ref|XP_760726.1| hypothetical protein UM04579.1 [Ustilago maydis 521]
    MVKEVSSAVEFDAELNAAGSKLVVVDFHATWCGPCKVIAPIFQRLASQYTSVVFLKVDVDRVQPVAQRYSVCAMPTFLFL
    KNKSVVDTLQGADPNRLTALVKQHSSGASLAFSGSGQTLSGGSSSSSSSFGARVAGITDGHSSLLNTVEPKRSSALNEKP
    NHRLQDILGGPTGGKWLESDADEQLLIHFTFKQQVKLSGILLRTLPSQLAHAPKEIKIFANRPGLSFDDATADKGDQEAE
    LSEDFVRGGENGGGGKALSLRFVKFQKVDSLTIAVLTNQSDAETTRIDAIDLYGVADQTTDMSELQKIAAEGGDRDFDFR
    TASKTGLKGGSSSRSARTGFHGPRSSSIPDMSTPAEPPLRPARSHSTSSLNSALPRYRRTTSSTSVPPMQHVDEEDGNDY
    ADDGNYSRHSQPQTAFVPQAPPSLSEEEQAEFEAAQKAASETLGGWHYAPLAVALAPPLGSLLGGHSDAWSDAILLILAS
    FWLYQFLRVPWEIYYASRTRSILTHDQDQDEIEHAEQVTLDGSPSSAPESSETGVQKEVRRAAAAELRRSELLSLVFCML
    SPIMGAYMLHWMRETMTDGNKYLNTFNIRLFTLAAGIKPWSHAMSLVRRRMLHLQEEVHYPSSKVEKMNQRLRRLEADLS
    SLRKLYATKTELRLLREHDAELGRALRRSERKEEHLRLSAEEKFSIVEGRLEDLLREVAINAELIEEERRERERAASLRI
    SLFEAIKYLLGSGLTIRRASPKHYLHDMPRSLPSTASLGIGAQSAEADLNMEAHTPGAPLPASVPIVSPTRPPRTIASAT
    PDRPSSSSRGLASIQSEQPAAANVVNRPDHPKVGAVVERSRSRNNAHHISDPWWERGAAFYLFLPLNVSSAAVRFAGEKV
    KHILEDSENEAARNQRKTLQYQKHLADQQLQQHQRKISQKQYQHQPMLSPTRNRADASTIKIASASANPRTR

    >gi|71021535|ref|XP_760998.1| hypothetical protein UM04851.1 [Ustilago maydis 521]
    MTTEATGPRRSARNAGKPAASASASARAPVAVKRKAASSNAGDKRAKLDSQPASIAKVLEIGDALPSLKLKLDDSSELDT
    ATLKNVVLFSYPRANTSG
    CTTQAKLYRDNHAAFTRANYTVYGLSNDAPSSLSSWKSKLSLPYNLISDPQRLLIKALTGSN
    DKTKRSHFVIDANAKLALAQLSVKPAESCESALAFVQPKSD

    >gi|71021729|ref|XP_761095.1| hypothetical protein UM04948.1 [Ustilago maydis 521]
    MAAKQAAEKLISEHLVAVFSKSYCPYCSQAKSVIEKLGLDKSKVGILELDQMGSEGSDIQAYLLDKTSQRTVPNIFINQK
    HLGGCSDLLDAQKSGKLQQLLQ

    >gi|71022273|ref|XP_761366.1| hypothetical protein UM05219.1 [Ustilago maydis 521]
    MVSHARSHSGSGELPRRRAWSARQLGVSLALAILTSLTLLLLSGSTTSVTAAVSGARPALFRSPASDNSRGADFLQHVLT
    KPRTQPRSAAAPSLDTEPICRPTGQIEDASCDYETVETINSQFFDRLDALRKTDFFKFYKVNLFKECPFWNENGF
    CMNRA
    CSVETEDESNVPEEFRVNRLSSVTTASPNDVVMTGSDASCSCSSTEFCHLDDESSDQGVYVDLLKNPERFTGYAGPSANR
    VWKSIYEENCFNGVKFVEPARPTWSGGTGFVDKSLLHSSSPALGGLPSGFSGLVSSLQAPLDSGDSEQCLEKRVFYRIIS
    GLHASISIHICHDFLDTKTGEWAPNLECFITRIAEHPERLQNVYFDYVLLLRALSRLDDSKQNFSLRAGDSIEDALAVAQ
    LDELIQDARACPTTFDEAQMFNGQNRDSLELKQEFRQHFRNISTIMDCVGCDKCRLWGKLQVNGIGTALKLLFNRNDERD
    GVGEVKLQKSELVALVNAAHRIAESLRAVERFRDMYQEQRLASDKAEQTKTLEHSSHTKRVAQANATSAKSFDQAQESAQ
    DETLFKHWLCWLEKQVAACQRSLVHCLQAVGIGVAGRSHNSGSGKHSEL

    >gi|71022539|ref|XP_761499.1| hypothetical protein UM05352.1 [Ustilago maydis 521]
    MATSPLSWTFSLALIALCLFSTTNAALFAKNSKVTILDSSNFKREVLDIEKPTMVAFTAPWCGHCQKLVPDYSKVAAQLD
    GVVKMASIDCDDDKNKPTCGKYGIQGFPTLKLFPPTKKRLPKDYQGPRSAKDIAAYMVDALPMGAKKLKAEELQEYADKD
    AETPKVILFSKKPTSSPLYKSLALDFRKSLSFAFLRGDQRPVQAAARIHLGVDVRDDQLPYLIVVPSRASGEKVDKSKIK
    AYTGALKYYDLNEWIKQTIPEAKSGKVKKVGTKANVKKKPIKLDQDIQDVPEGANREWRMEEEMTEEEKRKKMEELAEML
    NTAIKQSNDLRDGKAPSSADTGNSETPPVVKSDTNSSAHSSSEGSHSSSWSSSYSSSTDSDGKKNIHRSASHSSSGDSPD
    SASTYKVSSHTESDDISLKENLQRWLEGEKVDWSADYATQFKDAQRAAEDLIANDPEKADQMALESEKWLAHYLVSDLDM
    MKIAKDKGNQDPALSDDKIERVERMYNEILKRIEERESKFKEKESQAETPSKGHDEL

    >gi|71022705|ref|XP_761582.1| hypothetical protein UM05435.1 [Ustilago maydis 521]
    MGAEAKEHSVLDLESGVTLASASHTSCACLPPLALLRRKKLLVLVLLLPAIYFMLIYNGQVSSPLDSHPAQHVLDALHQA
    SPAINQLAGKLPGIAHHYDDAHMDEDRHLHNALLDKMHVQGTVELSELKDKLDHGSIPAASSSNNSDASLLQLSEMSKFT
    PQDESVMLLLLALKTKDYAVQDDWKAVFLERTPLQDGLFSTLNSGPTNKFTQLLATVGLPKPEETHSLPKFSILNDALQL
    YSLSRKGWVDRVRPSLGLTVFSKSY
    CPYSKKTKALLDSLNATYTVYEVDTRPDAKYLQPLLAKLTHHHTFPTILVRDRLL
    GGNDDLHDLHTIQALKSILASVGAL

    >gi|71022777|ref|XP_761618.1| hypothetical protein UM05471.1 [Ustilago maydis 521]
    MLRSAFPSGSARSALRHTQTYASTSATTLASSRFASTRRGLTSLSSFSLRCSAPVASSSRRIPEAFPSARIPSLTRSQRR
    LATTLIRKPDEPEEPEVYRDGEPTIIATDRAIAQLQKVAERENNSSLALRVAVEPGG
    CHGYQYKIEITEEIEEDDFQFEV
    HPGVSILVDSISLALVRGSTIDYVTELIGSQFAIKNNPQAKGAGCGCGVSWEPVI

    >gi|71023575|ref|XP_762017.1| hypothetical protein UM05870.1 [Ustilago maydis 521]
    MPTFESKPLRKSNSWLARLAPQVRRRPLLFFGLPFLATIVGASFGLANLTQTRYDYNATKVQTISKEEELRMKKDRKRID
    IREEYFKLQSKQDELDDWEPKRIERPDGVAEWGVAPTMYKSIQTENLSDRDAASEKSNGFSADNVRTSSKQPQVVLGPDG
    KPCRACNSKLAFAAAMKGAKASPQSSESRDSIRAKAAVSAAAIAATSSSTNACPPDGGELGRSAWTLLHSAAAYFPEDPS
    AQQKNSMLALFRALPHIYP
    CHSCAEALGEEYQREDKEGGWEDSNLKLASAVRSGPSLRKWLCGIHNEVNQRLGKPTFACT
    EAKLSERWLQGPADGSCD

    >gi|71024037|ref|XP_762248.1| hypothetical protein UM06101.1 [Ustilago maydis 521]
    MLQWPGSILVIGAGGLGCEILSNLALTGFYNIHIIDMDTIDVSNLNRQFLFREKDVGRSKAHVAAEFVQQRVPGVQITPY
    HGKIQDKDEQYYKQFNIIVCGLDSVEARRWINATLVNMVDDQDPDSLKPLIDGGTEGFKGQARVILPTVTSCYECSLDML
    NKQTTYPI
    CTIANTPRLPEHCIEWASVLEWPRVFPDKKLDNDNPDHISWLLEHASTRAASFGITGVTWNLTQGVVKNIIP
    AIASTNAIIAAACVLEAFKFATTAAPFLNNYMMFTGNDSVYTYTFEHEKRPDCPVCGGEARPMTFSAQDTLERLIEQLGE
    LTDLQIKKPSLSLAGKPLYYQAPPQLEHATRPNLQMKLVELCEQGDEITVTDARLPFTLGIIVNFS

    >gi|71024211|ref|XP_762335.1| hypothetical protein UM06188.1 [Ustilago maydis 521]
    MAAAEDMKVDQPEQGIDEGLYSRQLYVLGHDAMKRMAASNVLVVGLRGLGAEIAKNVALAGVKSITIFDPTPVSISDLGT
    QFFLRPEDASSRVRRDHATQPRLAELNTYVPIRVLEDNELNQQILSRFQVVVMSDALYAEQLRINDMTHASSTHFISAEV
    RGLFGSVFTDFGPKFLCNDPTGEQPLSGMIVSIASEDEEGLVTTLDETRHGLEDGDYVSFTEVQGMDALNDSQPRKVTVK
    GPYTFTIGSTKGLGQYKQGGIFKQVKMPKEIAFKSLRESGKQPELLIADFAKFDRPAALHAGFQALSHFEHQNGRLPAPR
    NAQDADLLLQLTKQIVQTCGQDPADLPEKVIRELAFQAQGDLSPMVAYIGGFVAQEVLKACSGKFHPLVQHLYVDSLESL
    PDSVESLPESEFAPTNSRYDGQIAVFGQAFQHKIANARQFLVGSGAIGCEMLKNWSMMGLGSGPEGIIHVTDMDTIEKSN
    LNRQFLFRSKDVGHFKADTAAAAVAEMNPDLKGKIHSHQNRVGPETEDVYGDEFFASLTGVTNALDNVQARQYMDRRCVY
    YEKPLLESGTLGTKANTQVVVPHLTESYSSSQDPPEKSIPV
    CTLKNFPNAIEHTIQWAREQFDEYFLKPAENVNQYLSQP
    DYIETTLKSGSGAKEQLDQIKQYLVDERPKSFEQCIYWARLRFEENYSNNIRQLLHSLPADAVTSSGQPFWSGPKRAPKP
    LTFDANDPTHLEYVMSAALLHAENYGLKGEADAALFRKVLSSMQVPEFVPKDNVKIQVNENEAATTNNNSNADGDDLTEI
    TSSLPEASSLAGVRLQPIEMEKDDDTNHHMDFITAASNLRASNYGISPADKHQTKGIAGKIIPAIATTTALATGLVNLEL
    YKLLDEKKSLEAYSNAFVNLALPFIAFSDPIAAQKLKYNDTEWTLWSRFKVEQDVTLQEFLDLFKDKHGLEVSMLSSGVS
    MLFSAFLPARKREERLKMKMSTLIETVSKKPIPKHAQWVIVEIMADDLEGEDVEVPFVVVKVK

    >gi|71024267|ref|XP_762363.1| hypothetical protein UM06216.1 [Ustilago maydis 521]
    MPMRFAPTFNRLVASSCSPWLAVAAAFVLSGLVQSAASSSSDEATHDGLRKLTAANFTLVNDGAWLIEFFSPVCVHCKKF
    GATWSELSQNKDSLRTQYPQAPFTLAQVDCLAQWDLCTEQGVQFLPRLTIYQDGKQNAEEYKGDRNYPEISAYIDKFARE
    YRQKKGVADVPLVASTNSDATSTAIESSNPASDNAASISAALPSPSPSSSSEPAAVTPSPASSLSSLEPIQEILPAGPNS
    KGQLLSYGTAPVQNQQELAAWLAKSSGQGPSFVKFFAPW
    CPHCKAMAAAFKQLSQSLKGRVNVLEVDCEANHALCASYNI
    RSYPVLRLYNQGNLKEYTGGRNHDAMLKWVLKAVSSSGLKPVSSSTELVSLSKENEVIFLYLHSPGTPIDEVHAVETASQ
    ALFGARAPIFVSSEPSLLDRYSSSLAQDRSTSVPAESGLLVFKDHSIAQPVSVLNPSSLRASDSASVEGVYSELATSKIA
    AFLSREQYSLVTELTAANFEEIVRNRDDALVVLAALSDTYHGSHQADVSAQGIALKEVEFCCTTTCPSVLALGRRP

    >gi|71024643|ref|XP_762551.1| hypothetical protein UM06404.1 [Ustilago maydis 521]
    MPGLRLGSIAPNFTAETTHGVLNFHEYLGDSWGILFSHPDDFTPVCTTELGEVARKAPEFEKRGVKIIGLSANDIASHDR
    WIKDINEVGNTSVNFPIIGDKDRKVSTEYDMLDALDPTNVDAKGIPFTVRDVFVIDPKKVIRLKISYPASTGRHFDEILR
    VIDSLQIGDKYRVTTPVNWQKGDKVIVHPSVQGEEAEKLFPGYETVKPYLRFTKDPSTSSA

    >gi|71024859|ref|XP_762659.1| hypothetical protein UM06512.1 [Ustilago maydis 521]
    MVVKTIESYEEFQTLINGDKPVVIDFWATWCGPCKVIGPIFEKISDTPAGEKLGFYKVDVDAQDKIAAEVGIKAMPTFVF
    FKGGQVVKQVVGANPQALQERQSCSDQGRVPGLDAFFSSFALEYCHQSRKLENVLKIWSTPVKEVVCQSGHRRYATVRMP