Trypanosoma brucei

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|84043750|ref|XP_951665.1| hypothetical protein Tb927.2.4850 [Trypanosoma brucei TREU927]
    MLGSGKSSGVVNEASNLKANQNLTSAIEEMNTKEYIRNRDLNDVVPTHRRQVEAMMNKGNNNNGKVGLPAYDPAAEKEKE
    RKERGQTHIEDRNDSDDDGELEELRKRRMAQMQQHHAKVAEWRQKQHGQYREISQDEFFSIVVREKGGSDDVCVHFYHKD
    FET
    CRVMDSRLLELSRMMLSVKFVKIDAEKSPFLVERLHIKTLPCCVLFHNDVAVDRIYGFEGCIGEDGLLDKELLGERI
    LRAVNCKQEECE

    >gi|72387087|ref|XP_843968.1| tryparedoxin [Trypanosoma brucei]
    MSGLTKYLPGATNLLSKSGEVSLGSLVGKTVFLYFSASWCPPCRGFTPVLAEFYEKHHVAKNFEVVLISWDENESDFHDY
    YGKMPWLALPFDQRSTVSELGKTFGVESIPTLITINADTGAIIGTQARTRVIEDPDGANFPWPN

    >gi|72387091|ref|XP_843970.1| tryparedoxin [Trypanosoma brucei]
    MSGLAKYLPGATNLLSKSGEVSLGSLVGKTVFLYFSASWCPPCRGFTPVLAEFYEKHHVAKNFEVVLISWDENESDFHDY
    YGKMPWLALPFDQRSTVSELGKTFGVESIPTLITINADTGAIIGTQARTRVIEDPDGANFPWPN

    >gi|72387349|ref|XP_844099.1| tryparedoxin, putative [Trypanosoma brucei]
    MPSAETLLKDLFGSHTVELLRQDGKMVPATTALEGKKYLLVYFSASWCPPCRVFTPQLATFHELFSAKHNFDVIFVSRDK
    DESSMSAYFYNPKYSSLSVSGGECSHGDWLALPFTQAQTVGKEIMSRYGLNTIPNILLFDLSTEELVTSEARQLIGSNCR
    SAEGFPWRGASAPVISFQGLATVFVVFLMLYQFWQSWS

    >gi|72387942|ref|XP_844395.1| thioredoxin, putative [Trypanosoma brucei TREU927]
    MKRPSFLLVSLLFLAIGSTVIEAFPFTASSGVVELTPATFNSFLGSHKPVFILFYAPWCGHCKRLHPEWEKFAKSVEGIV
    RVGAVNADEHQQLGQQFNLRGFPTVKFWGLGEKRANAAMDYAGERSAGAIQSQAISLINAPGIKTVKKAEELREAAQAAP
    EKKAVVLFSAKSRVPPIYAVLSLSPRLKSMPFYFAGEQEKSGFASEFGVSKLPAIVVLNTTAGEVKPVIYPGKKVAYEPI
    AKFLLACANDAYDEANFSLEGGESEQATKKGAAKLALPVRPLPASAHGLENFCSPDARKKAERTPLCVISLTSEFSLNDV
    HKTFSNEPLVFFEAGDARDILLGALRGKLGLEKIADKLKDDKEHNALLLRASKQGTVHYRLVGGVNTAETLSSVLQMVVS
    GEISLTKEQPK

    >gi|72388948|ref|XP_844769.1| thioredoxin-like protein [Trypanosoma brucei TREU927]
    MKRVGTLEEYTKVKRDANGLGLVVHFSASWCEPCKGVTEALERFSELYKGSVEFVEVDSEALGSICEAEAVDCVPYIAFF
    RTSGDGKGQERVADVVGGKLDQIEQNMLSLYGDGTDGRGSFSDLQSYLKYLTSRKGVVAFITGTPSRPR
    CGFTVKLIQLL
    DDLHVKYVYYDVWASDEVCEGLKKYSEWPTFPQVYADGEFIGGYDICAELNASGELKSALKL

    >gi|72388962|ref|XP_844776.1| disulfide isomerase, putative [Trypanosoma brucei TREU927]
    MQRTKSLLHVLLVVALVLFLLITEVSVAGGVVDLGNEVREDTIPLLNDDTFDSYVFSKGSNDKEGRKRGPWLIFFFAPWC
    GHCKAALPKYADANLQLAKLGVQHARFATVNAVKSPELALRFRVKVYPTLIYTTGKAENWHVYRGALTPETLMKFATQLH
    LAGTVGSFADLTSSPDEFVRAHRQDMGRRVPMYVYLPPTGSRSANAPHQREELVPGQHGVGEGEGQQGVQANNSKSIHEE
    KHMQKQDRLSDAREARWNVAVDAAASMEKIRFGVIYGDDVPSAWAETGITPYIAVLEAAQRCKGSGPDGALVLVDSDAYK
    QPQCYEGPWFEESVNIPQKSGAESVTPLLHPSFIAFFMLNGLHAVERASSSLLSAVTTTNHHYLGLLITNGPITQTDTNM
    LPALREVVQERNEARRAVAVGLEPQRRVSLAYVDGRTHEAWRTQYKVKLEELPAFVVVDPRRNKVYRLRRHTPHFEVIKF
    FLPWPRGGEQQSVIVSFIADVERGVAVGEKMTFVGEVAEHLLRLPGVEFLYEVLEFEDSLLVVVVLALFVFAIVLLIVLV
    VEPVFERRADERMTGYGERDTSAVEKKRN

    >gi|72389436|ref|XP_845013.1| ubiquitin-activating enzyme E1, putative [Trypanosoma brucei TREU927]
    MHVNVGHIVFPVPILSQEAQTVSVKRVKREGAQGVAADDARFVRESVVAAVRVALREAVDGTSVDDVFIDVHVHEGGKGV
    SFSFVKGFLSLSLSTPAGTEVCIPAGLTFDEIQNATGFPSFTQVRLHFSDEVGGMELPVYWEKRVVCAATPTALVAVEGR
    IKTPGTNIQYAADKDIVLLDSRVLVVGAGGIGCELLKVLVLYGFSDIDVFDLDTVDATNLNRQFLFNRDDVGQSKSATAR
    QAIMNWFTPANPRRPPNIRAHHANIKDEAYGKAFFAQFAVVLNALDNVSARQCVNRMCKQAGVPLVESGTMGYNGQVQPI
    VYGRYECYDCHPKASGKQTLAV
    CTVHARPTTMVHCVHYAKELYERLFGDGQQDAGDELTFVDDLLNQEKERQGINTENGK
    LNLHNLAVSLGCCLFVSKIEELLSIKSAWPTQPPSPLEPTAIHGAAEQLKAACDNPQGVVPRVTRDCLMSLNETALLFVD
    AFVRCASRGQRVAFRKEDDDAVDFVAGVSNLRALIFHISPQQSVEEIRSIAGAIVPAIATTNAVIAAGVVQQAVRVLFVS
    RGGNQPPEPKMIYVRKVPQVRRRRLSANPSAVLGGNGKLGLVRWVSDMYLVHSAPPNPASDKCLVCRDRHPTVDVYLNAK
    QVTFELFVHRVLQQHLNMHEPTIFHGASILYEKGDYEALNSTPLLSQMKDDHRPLDLLVDDLDHDVEWRVVVHHCEELKE
    QVPQSGVVVEGLEEALKFESSLLAMPISTADPAAIDAGDAVGEANVPAGGCTLSKAAVPVLIDSGDEDSDEVVEID

    >gi|72390145|ref|XP_845367.1| ubiquitin fusion degradation protein 2, putative [Trypanosoma brucei TREU927]
    MIEVSSLEQLLSFIQREAILVVKFYADWCGPCKQIEGQYNVLSQVFTAVTFCTCNIDRNRACAERFQVQSIPTFIIWYRG
    RVETTIRGGDLPQVERVIVDLTRQQQHGEVAIASASREQSASRPIHEILLAKMNQLAQTIKTTPANKGAEQGACEAVYAL
    LEAGCEQQPFGALLLPYFACEGFSAVAVDALFAYISSKGEPYSKGIQIIVNRMMTQLIEFFLASTLDQTRELCMMQRAVY
    SMVTCRSVLPIFVHSHLFYSDSFTDGLQLEYGTILGAILGVGVFSRASRPLPPLLRMVEWRGYMDMFPTESEDHSQKISD
    LQSSMETACDANKRIVLVLLQNKLSRFHTLRFMGSALRLNAGYTRTMHHDLPLSSRFFMCQLNDVLMEAALPVFTKGCDA
    SSIPPAYLLEDPGEETVVDFGESVERITHYDENRPLPSFPSLQEPFKPTVHLFFLAARSMMLSVSVLIELHERVEHESSR
    PNTSTQQRALCIVEKSLVEGLIGSHSLGQKRVRLLNGIAGWLVKVMGTLEDGTLLPEPPETWKYLPQQLVEVVIRGMQLA
    PLDYPDVENVISLMLVLMGNTVYFPKPHTHALFPDFLLRLLRNEDTQQALMAHRWFSQNIVRSCVLCYIAVEKSTYEKVS
    VRYTLSRCTKSFLLHESLCQPVRAEFEAGGTLLERFSHMVTAEVNDAVDQLIGTLTQMNRLVREGADLSENPNPHRGDGG
    GNDGTAGRAATVNRGTHRNTENEEESEDETEGSPQSYHQLGLGLKQRILLFEGSVDLFIQLASSFPKGVAQNMVAQQISQ
    MLARSLTSFVGADSKKLKIEHPERYGFRPREILGRIVECLVQFVRLENFLRCLCNCGVPQKDILQAMKVISERGLVGEHL
    VWKLNEIASSLQAMSARVREEEALWDEAPEFALDALLSTPLLRPIALPSDVKDLDDLVYTNEDTLHHLLLSESKHPFTKE
    YLDEEMVKEFNAREDVMQARERLQNRIAEWLRNAKAHRE

    >gi|72390884|ref|XP_845736.1| trypanothione/tryparedoxin dependent peroxidase 1, cytosolic [Trypanosoma brucei TREU927]
    MSTIFDFEVLDADHKPYNLVQHKGSPLLIYNVASKCGYTKGGYETATALYNKYKSQGFTVLVFPCNEFGGQEAGNEEEIK
    EFVCTKFKAEFPIMAKINVNGENAHPLYEYMKKTKPGILATKAIKWNFTSFLIDRDGVPVERFSPGASVKDIEEKLIPLL
    ESTQSA

    >gi|72390886|ref|XP_845737.1| trypanothione/tryparedoxin dependent peroxidase 2 [Trypanosoma brucei TREU927]
    MSAASSIFDFEVLDADHKPYNLVQHKGSPLLIYNVASKCGYTKGGYETATTLYNKYKSQGFTVLAFPCNQFGGQEPGTEE
    EIKEFVCTKFKAEFPIMAKINVNGENAHPLYEYMKKTKPGILKTKAIKWNFTSFLIDRDGVPVERFSPGASVKDIEKKLI
    PLLESTQSA

    >gi|72390888|ref|XP_845738.1| trypanothione/tryparedoxin dependent peroxidase 3 [Trypanosoma brucei TREU927]
    MLRSSRKKMSAASSIFDFEVLDADHKPYNLVQHKGSPLLIYNVASKCGYTKGGYETATALYNKYKSQGFTVLAFPCNQFG
    GQEPGTEEEIKEFVCTKFKAEFPIMAKINVNGENAHPLYEYMKKTKPGILATKAIKWNFTSFLIDRDGVPVERFSPGASV
    KDIEEKLIPLLGSARL

    >gi|72390920|ref|XP_845754.1| protein disulfide isomerase, putative [Trypanosoma brucei TREU927]
    MTPFSCRKTSLLKAICIFAYFASAAHANEPDAALEGVVDLTSNNFDSSVGKDVAALVEFYAPWCGHCKNLVPEFAKLGRA
    AAGAKDKVLIAKVDATAQKDLATRFEVNGYPTILFFPAGSQKPEKYSEGREAKAFVSYLNNQIKGLNLFLPREHKYVMAL
    DQSNFDKVALDEGKDAFVLFYAPW
    CGHCKRLHPSFESLAKVYQNEKDLIIANVDADDKSNSEVTKRYKVEGYPTLVFFPK
    GNKGNPVNYEEGRTLDDMIKFVNERTGKKRTSSGDFDKTVGVDETVTNLMKEMAQSSKNKEERERLLAQIQQAVSPKALG
    EGAMHYIRIATNVLENGHEYISKEHERVGRLLKGSLTGPKRDSLTIRFNILSAIKGE

    >gi|72391358|ref|XP_845973.1| glutathione-S-transferase/glutaredoxin, putative [Trypanosoma brucei TREU927]
    MFTKGSMSRKLLCATGALAGLGFAGGYVTYQRRLEENRSCTAEDFNAAQDQTELQFALSHITDPKKCPPILLYRYSTCPF
    CATTKSFLDYNKIRYECVEVEPMFKKEISMSAYKKVPQLKFCVRGDDGPFLVDSEVIVSTVAKHVGMGKQLEDPEVKKWR
    EWARGPMVRLLTLEFNSSLLNSWGSYSYIDNIETIPYKNKIFLKLVGAPVMYLVAQYVTKPRLLKSGDLLPTDDPKVKLH
    NEIDRFVKEGLLDGKKKFHGGSKPDLADLDTHGVLQSVRGHRLYNEIIEATTIKPWLERMDEAVGNEKYIPK

    >gi|72391814|ref|XP_846201.1| hypothetical protein, conserved [Trypanosoma brucei TREU927]
    MISLHLSSHSLMHVLLSFLLLCSGVVMGYYADVDYEVPSRVVQLTDATFDTIVMDPTKDVFVLYCVTWSRHCRSAVKLWA
    DLSISQFKRPTADTFVAALIDAEAFPETAKRMGVKSYPTMLFYTRLEKATPLEYNGQGLLPLLDSFVFQNS

    >gi|72391816|ref|XP_846202.1| protein disulfide isomerase, putative [Trypanosoma brucei TREU927]
    MRNSFALLLLSVAIAFVTVGSFADEAKDSVELTPDNFDKVALDTEKHVFVMFYAPWCGHCKRLKPKWEELAKEMKDETSV
    VIARLDADKHRNVAERFDVRGYPTLLLFARSKKEGLRYEGARDVAALKEFVKSNM

    >gi|72391842|ref|XP_846215.1| mercaptopyruvate sulfurtransferase, putative [Trypanosoma brucei TREU927]
    MHGDGLGRLHPGKVFLTIDEIKNGISSYQIFDVRYDLRNKEYGINQYNKGHVARATFVDLDRHLSGPVVECSKARHPMPD
    PHEFVEWCKSKGIGHFKPVLCYDDECGAMGACRMWWMLNALGVEAYVMTCGFKAYEAAGLPVESTPYDKNQSTSYWPYAT
    EFKRLLKIKDIPPCAHMVDTRPALRFNTTVRPYGPDDIPGHIEGAVNLPYDVNILLVNRHEKRLRPNDECRSNTLKLLQG
    MWGGGEPNISHCVFY
    CGSGVTAAFSIAVAYHVGLGEPYLYAGSWSEYADTFNFTLARRIIKEHGLLISMVSSSLPYNMKA
    TLNNVTLVVDGVVVNNPDEELKQALVHLHIGEKAHVTFKSQRQAVIEAHPRIDT

    >gi|72392183|ref|XP_846892.1| peptide methionine sulfoxide reductase, putative [Trypanosoma brucei TREU927]
    MNPNAVATFAAGCFWGTEHFFVRQFGAALISHKVGFMGGKELPEMNYQLVKKGDTGHAEVLQVTYNTNELTYDALLNFFF
    RMHNPTTLNRQEGDVGTQYRSTIFYHNEEQRNEAESFIEKLNGGDEKLRENIVKAFGSSAKVVTTLERASRFYPAEDYHQ
    NYLEENPNGYCAHRLYW

    >gi|72392463|ref|XP_847032.1| tryparedoxin peroxidase [Trypanosoma brucei TREU927]
    MLRRFSMLPLSGGIARRSFFRTAPLFNLDYQAYRTATVREAAPEFAGKAVVDGKIKDISMNDYKGKYIVLFFYPLDFTFV
    CPTEIVSFSDSHAEFEKLNTQVIAVSCDSHFSHLAWVETPRKKGGLGEMKIPLLSDFTKEISRDYGVLVEEQGLSLRALF
    VIDDKGILRHVTINDLPVGRNVDEVLRVVQAFQYADKTGDVIPCNWKPGKETMKVEAAKEYFEKNL

    >gi|72392593|ref|XP_847097.1| ubiquitin-activating enzyme E1, putative [Trypanosoma brucei TREU927]
    MTSEEQRRQLYNRQEYVVGTETQAKYGCTDVLVVGACGLGAEIIKNLTLTGVRSIKVLDNGLATLQDLGTNFFLTPADMG
    KPRAEVVAARAQELNRFVSVTAVDVPLHEVIPAVHVVVFVNQRTTLLLAENAMARKHNVKFVACESRGVAGCVFVDAGPS
    FTVLDPDGEETVVCVVTNISRDGVVSLHEDKKHECEVGGRVFLTGLVSPESLNSTVDPFALHNGRATTECAQGDNSPTGA
    SSSLRLFEVSEVVSPFHLRLKDFGAIVGDSPIETGYACYLHTTKRKVLVGFKDLQLSVMQPEFVTLFDSEKKMMAPMTLH
    ALFRAVHSHGKLPTTPIEVRDVLKAAEAYFSSGNDQVHNGFDVETAESILSVMHGRLNPMDCFIGGLASQEVLKVCSGKF
    TPLRQWLYYDARELLVARGEMSETGCVSTAPGGSRYDGQIAVLGSSFQSFLSRQRVFIVGAGALGCELIKNVACMGFGAV
    SITDMDTIEMSNLSRQFLFRNSHIGQQKSKVAGEAARAINGDLKVSAYLEKVAQETENVFDEKFWESHSLVLNALDNVES
    RKYVDARCLFFRKPLFESGTLGPKCNVQCVIPYCTESYSSSYDPPEKSIPL
    CTLKNFPNVIEHTIQWARDNFDAVFFSTP
    SDVNGYLEDPTTFASNLERDPGTKSIVLKAVRDALVQWPKDAADCVRMARSLFHEYFNSSFRQLLHNLPLDKRNDNGDLF
    WSGAKKPPKPQEFSVDSELNVSFVYHCAKLLAQVYNLSAFTLSVKEVAELAMQVAVPGFVPREARFETNEAENKEGAAAQ
    LVGDLTMQDLPPVSQFNSRRMNPLVFEKDDPNNSHMDYITACSNLRATAYSIPPADVHYTKRIAGRIIPAMVTTTALVTG
    LVGIEALKYLLLAHRENGAQGLAKANPITEKVQEEYLSLYRNAFVNVALPFMAFSDPIAAPAKTVPMPDGSSVRWGIWDR
    IDINEGRDITVKELVSILEKRHQLEIFIIALPCGKMVYSQFGNVKDRDKPVSVVVREKTKGEEKDELSCICFVATGSIGD
    NDVDIPLIYYRYKDF

    >gi|72393037|ref|XP_847319.1| endoplasmic reticulum oxidoreductin, putative [Trypanosoma brucei TREU927]
    MLKMRLLIVVPVLLGLVWQILLRAELDGVSFFGMYISANNSGAGSYVRTKKGNALKEGFCSLTMDEVSQNTEGITGLLNN
    ITSHPYFRYFKVNLDRECRYWVAEAS
    CTCDSNGCQICTCDDSGIPETLKYPYDMSDVSTVERRAAPDKHAAKGFEDEIKP
    IDPDRDATYVDLLQNPEANTGYSGPKAARVWQAVYNNCNIDGLPSNDTAGVENREKALLRQLLSGLHTSITMHVAAFFYN
    DTKGDSPLRSLGVLNNPNISFYPNCGMFRRIVKNDEFIRNLFVVYQFVLRALAKTKRAFLANSSLYNSGFNGAATDGDVR
    LYSNIGELFSSKLFRVATFDEQKFFESPGAHLLVRQMKRVVHNVTTLMDCVTCEKCRAWGKLETAALATALKIVFGSAEN
    VVELNRGERVALINFARQLAISVKNVRSLAAVCEKFNYTAMS

    >gi|72393167|ref|XP_847384.1| hypothetical protein, conserved [Trypanosoma brucei TREU927]
    MMRFFVWIRCLGLPSRQSIYRSGCAHASTSAIAEMTANGVANSPVMPYKSTHKGKGVGDPNRKGSSVVGAPSGGTDQCQQ
    NLAGSRSSCAEDGKAAPSRPLSPLQRRQLMMRHKAAFTLTPQAIRRVRYLLSQYQQNNEGEGPIPDGIRVSVRRRG
    CSGY
    SYTVNYNYPSKGDETGAPVNCNSQNKNKDEGGSSEVSFMSAVGGMAPGGDVVVVQNGIKVVVDSNALFYVIGTEMDYVVR
    NVEEKFTFRNPNQKYSCGCEESFMPFDADEQL

    >gi|71744258|ref|XP_803641.1| thioredoxin [Trypanosoma brucei TREU927]
    MSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIAR
    SGKMLGHVIGANPGMLRQKLRDIIKDN

    >gi|71744296|ref|XP_803662.1| glutaredoxin-like protein [Trypanosoma brucei TREU927]
    MRHCHMSFAYCFCPFSAHRSASSQGYTRLMRRLSGSTCLLTGVTRAGRWLPTTAPCLSLCSFFLTASRRKQSTSGIGGDV
    RDIEETHPDFQPRLVSADLAEDEIAMVKKDIDDTIKSEDVVTFIKGLPEAPM
    CAYSKRMIDVLEALGLEYTSFDVLAHPV
    VRSYVKEVSEWPTIPQLFIKAEFVGGLDIVTKMLESGDLKKMLRDKGITCRDL

    >gi|71744678|ref|XP_826969.1| tryparedoxin peroxidase [Trypanosoma brucei TREU927]
    MSCGDAKLNHPAPHFNEVALMPNGTFKKVDLASYRGKWVVLFFYPLDFTFVCPTEICQFSDRVKEFNDVDCEVIACSMDS
    EFSHLAWTNVERKKGGLGTMNIPILADKTKSIMKAYGVLKEEDGVAYRGLFIIDPQQNLRQITINDLPVGRNVDETLRLV
    KAFQFVEKHGEVCPANWKPGSKTMKADPNGSQDYFSSMN

    >gi|71744684|ref|XP_826972.1| tryparedoxin peroxidase [Trypanosoma brucei TREU927]
    MSCGDAKLNHPAPHFNEVALMPNGTFKKVDLASYRGKWVVLFFYPLDFTFVCPTEICQFSDRVKEFNDVDCEVIACSMDS
    EFSHLAWTNVERKKGGLGTMNIPILADKTKSIMKAYGVLKEEDGVAYRGLFIIDPQQNLRQITINDLPVGRNVDETLRLV
    KAFQFVEKHGEVCPANWKPGSKTMKADPNGSQDYFSSMN

    >gi|71744716|ref|XP_826988.1| hypothetical protein Tb09.160.4440 [Trypanosoma brucei TREU927]
    MSKQEPLQKIPGECPTPRELGKAGWIILHSAAAVFPYNPTPTQQEAFRNFLHGWSHAYACSHCAYHMRRYFHQNPPVVTD
    KLALNRYLCEFHNAVNERVGNKIYDCDPMNVLRRWHPTFPDMEDQPTIEEQVKSLELKEKNETPQGVSDRWRQQNSSASP
    DGNVGRWSVGDARWTDTTSESRRTNVGEISAGWGTAGEKMKQRNSAGDGVSDAGASEKKWWRWGNSTSSSTTATIATPSA
    AEPAEDVEASVTSILSKLRACMVYCPDDKKSSA

    >gi|71745744|ref|XP_827502.1| ubiquitin-activating enzyme E1 [Trypanosoma brucei TREU927]
    MPKHQRDRFSNCPAFCSHTSNKLFRTELTHYSSDTTRNVNINGFTKMSKMAGATADSSDASSAIDSKFLDQQSRTIGTYG
    LETMAKLISFKVLVVGCGGVGIETAKNLALAGVHTITLCDPKKAELKDMGVNFAVTETTIKAGLTRAEASKRLVAELNPN
    VRVRTVDAIDEAVVSEVNCVVYTSAAADWSSKTLLKWDQFCRTRTPAISFIFAFQGGSLASVFADHAPNFTVKDADGRPM
    LQKLIVEVLTKRDKSGVEYTRVRYETPEGQTPGAFRDYTEVKFSEVKGLCKANGESINGNVFKGVVCTGDPPNTVRIYPS
    LESQGYSAYETAGFLHEMKESQQLKFRALSEALSCPGQFVPVSSMMDGSEESQSHLTFTALLRFFDKHGRLPELHNLSEA
    NEVVSLAKAVNEENKAADAKLEKVDHPMFLQHENKEFPSRLAPPPPPTPLCVETLDEGFVCSQALVSAAELQPLCAVWGA
    VLAQEIVKITGKYTPICQWLHVGYSSILASNASYTKSPQEYKVVDHRYKHLISLFGKTFVEKLNNLKLFMVGCGALGCEN
    IKNFALCGMSCGPRGSFVVTDNDRIEVSNLSRQFLFREENVGQPKSAVAVSRMKSINKDVKADARQDYVGSNTEHIYHDV
    FWNGLDAVVNALDNMETRLYVDQKCVNFHKILVEAGTMGTGGNVDIVVPGKTTSYSDGGAADTTGGIPM
    CTLRNFPYTSD
    HCTEWARAQFDDLFVSPMQTVRQLLENPAAFTERIKNEVNNAQSAGERLSLVEKNLGILQGIQKTVTTLSAGVSMEKCVQ
    CAWETMFHLFRDRILDLQRSFPKDAKKKNGEKFWSGHRKYPTPLEVNIKALSSDPDVVEFLISAANLFACMYGIHPQKHE
    PRLNDPKKRWMQQYRTLDWLNGVMKNCTVPEYKPGSVEGLDDDLLQSMEKQEVSKDETTKEQTLNNLLSSVVALAQKCHN
    MNTVPLDFEKDDDDNFHIDFVAATSNLRARNYDIPTQDRFKVKLVAGKIIPAIATTTAAVTGLALIEYFKALLSNDVSCL
    RNGMLDIGTNNYVLFERDAPLKHRTRVDKTYLPEQDYTYKKKVICLPEGYTKYDMIEVPITKATTVQQFATELEKKLNTL
    LPTGMNAGCEVSAIGVGKGSLWNGLPKHANTNCSLMDIIEKQKLSEAGGKLPRPFWENRTHFHDLSVTVSIDDDDANVDE
    VDVETATILLRIQQ

    >gi|71748004|ref|XP_823057.1| protein disulfide isomerase [Trypanosoma brucei TREU927]
    MRAIFLVALALATMRESTAESLKLTKENFNETIAKSEIFLVKFYVDTCGYCQMLAPEWEKAANETIDNALMGEVDCHSQP
    ELAANFSIRGYPTIILFRNGKEAEHYGGARTKDDIIKYIKANVGPAVTPASNAEEVTRAKEEHDVVCVGLTASNSTSLST
    TLAEAAQSFRVSLKFFEAEPKLFPDEKPETIVVYRKGGEKEVYDGPMEVEKLTEFLQISRVAFGGEITPENYQYYSVIKR
    PVGWAMVKPNETASIELKESLTEVGKKMRSHMVVLWVNISKHPVWRDFGVPEDAKYPAFLAIHWGANYLHSTAEVVTRES
    LEKFILEFAAGRVEPTIKSLPVPEVETVDGKTTIVAKTMQKHLTSGKDMLILFFAPW
    CGHCKNFAPTFDKIAKEFDATDL
    IVAELDATANYVNSSTFTVTAFPTVFFVPNGGKPVVFEGERSFENVYEFVRKHVTTFKVSEKPANVTEEKKSEEENKSSR
    SNESNDSNESNVDKQDL

    >gi|71748218|ref|XP_823164.1| selenophosphate synthetase [Trypanosoma brucei TREU927]
    MSEKEGKVIPETNGMKRPRFDPVKLGLPEEFTLTDYTRLKGCSCKVPQPELLALLQSVSTTPGRRDVGMDCSIVKLQHKD
    ETGKPLYMVSTTDFFFPSVEDPYLQGQIGAANVLSDLYSTGIDRCDTVLMLLAASTDMDKTEREVCTQEMMKGFVDHVRL
    AGSDVTGGQTVMNPWPLIGGIATSVVAESQMIRPTGLQPGDILVLTKPLGCQIAVNLKQWLRRPSPIFEEQIQGKMDSEE
    IEELYNAAADGMKRLNRMAAALMHSHGAHGATDVTGFGILGHAKNLGSAQKADVCLVLDSLPMYRGAVKASKLMGDKYRL
    FEGYAAETSGGLLVAFGTREEAEGYIRELYETDGEPAWVVGRVVRREGSAPYALLQKDYKIIEVGAKVNDKII

    >gi|71748410|ref|XP_823260.1| trypanothione reductase [Trypanosoma brucei TREU927]
    MSKAFDLVVIGAGSGGLEAGWNAATLYGKRVAVVDVQTSHGPPFYAALGGTCVNVGCVPKKLMVTGAQYMDHLRESAGFG
    WEFDGSSVKANWKKLIAAKNEAVLDINKSYEGMFNDTEGLDFFLGWGSLESKNVVVVRETADPKSAVKERLQADHILLAT
    GSWPQMPAIPGIEH
    CISSNEAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPPGGKVTLCYRNNLILRGFDETIREEVTK
    QLTANGIEIMTNENPAKVSLNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTNDLQLGNVGVKLTPKGGVQVDEFSRTNVP
    NIYAIGDITDRLMLTPVAINEGAALVDTVFGNKPRKTDHTRVASAVFSIPPIGTCGLIEEVAAKEFEKVAVYMSSFTPLM
    HNISGSKYKKFVAKIVTNHSDGTVLGVHLLGDGAPEIIQAVGVCLRLNAKISDFYNTIGVHPTSAEELCSMRTPSYYYVK
    GEKMEKLPDSNL

    >gi|71748416|ref|XP_823263.1| monothiol glutaredoxin [Trypanosoma brucei TREU927]
    MLRRIFASSPAFLRCTLPNRAPDQVKPELAAAIRRIIAEDRIVIFLTGTPQEPRCGFTVKMVDMMHQLGVKYSFYNILED
    DEVCEGLKIYSDWPTYPQLYIDGDLVGGYDVCKGMLLSGQLTKLLKEKDLL

    >gi|72386039|ref|XP_846686.1| glutaredoxin [Trypanosoma brucei TREU927]
    MNNALDPAKAPQFLDMMLRRNKMVMVSATYCQFCTKLKMLLIELKHRFVSLEIDIIPNGREVFAEVVGRTGVHTVPQVFL
    NGKYFGGYDELVAMYRAGHLSAEIERG

    >gi|115504173|ref|XP_001218879.1| glutaredoxin, putative [Trypanosoma brucei]
    MNNALDPAKAPQFLDMMLRRNKMVMVSATYCQFCTKLKMLLIELKHRFVSLEIDIIPNGREVFAEVVGRTGVHTVPQVFL
    NGKYFGGYDELVAMYRAGHLSAEIERG

    >gi|71754605|ref|XP_828217.1| copper-transporting ATPase-like protein [Trypanosoma brucei TREU927]
    MEENNATTGQKRRRRKNKRGREAQRPTDSDELQPLVSYGSLAQTPLLAEEQSVGAVSLSAQTAAAPSPVVVPEFTEAAKS
    SPSSVQLLGGSTVALVDKTVESHFSLHGLP
    CASCASHIESHIGEMGGVAQVTVNFASSHAVVVHNPHVVGASRITEEMEA
    MGYTAVLISAHSDDAEQLDNLGVREFELLIGGMT
    CGSCVSRVQSALLEIDVVKSCTINFSTGTCKLTMTGGRDSLNCVQE
    EVKKLGYTATPLEERGSGNAVDVMKEALERTKEIQAHKRAFVLSAVLATPLAVFMILMTVTKYFEDITTMVIVNTIQLYL
    ATPIVFYCGSGFFSRAWVNLKHRTFTMDTLVALGAGCSYLYSVAGLITMFLMKRHVTTYFDTAGMLVAFMLLGRYLEAYA
    KRHTNDALIKLMNLVPPTSLVVTPAGDVSMPSSTVKKGMRVRVLAGDRVPVDGVLVEGNSDVDEQMVTGESVPKPVSAGG
    TVVGGTTNLTAMIVIEATKVGEEAVLSQILRVVREAQNSKPAIQRIADKVAARFVPAVIIFSLVVLAVWLLLGAFNLYPS
    EWRGNNESTTVFAFDFFIATIVAACPCALGLATPTAIMVGTGVGAKHGILVKCGMTLEAMRRTRCVVFDKTGTITNGTLC
    VVFQRRWGNGADAAVDAVGAVEQRSNHPISRAIAVCVASDPKSQVAAYEVVTSTVHSGLGVKATVQRKDSGHQLNVFIGN
    MDMMLSSGIDVSGEVAKVVRWQMGLGRTVTLAAVDGSVRFLAALADEPKAEAAGVIRFLKRQNIRVFMVTGDNPGVAAAV
    AQAVGISQEDVYAGALPVTKAAVVKAFQEEYRDVVFVGDGINDGPALAQASVGVALGAGTEIAIEAADAVLVRNSLVDLL
    NLRALSITTVRHVYGNFMWAFGYNVLILPLASGMLYPFLHVRVPPVVAGVAMILSSLSVLMSSLSIRCFSPYKREQFIDI
    I

    >gi|71754627|ref|XP_828228.1| glutaredoxin [Trypanosoma brucei TREU927]
    MPSIASMIKGNKVVVFSWVTCPYCVRAEKLLHARTKDITVHYVDKMSEGEQLRGEIYQAYKHETVPAIFINGNFIGGCSD
    LEALDKEGKLDGLLS

    >gi|71754805|ref|XP_828317.1| molybdopterin synthase sulphurylase protein [Trypanosoma brucei]
    MNVLEDLEAQVATARLRLHELEERLHEERNRVNSCGADVLTSSGPSSIDNSGGSTAGETPSFVSSSGSLTKSDVERFSRQ
    IVLEDIGAKGMDRIRRGRVLLVGAGGLGSTAALYLVAAGVGELCIVDFDTVEHSNLHRQIIHNTMRVGMSKAESAVQSCL
    ALNPRAKIRAITAPFTPANAEELVRGCDVVVDGSDNVATRYLINDAAARYRRPLVSGSALRWEGQLSVYCGGLSCPCYRC
    LFPTPPPASAVGS
    CNDTGVVGPVPGCIGCLQATEALKLLAGAGDVLEGRLLLLDALRMQLRVVRLRGRQKDCPACGEAAK
    LNVGKSLQQLAAERPEYVMPSCASGALRSANMLPAEANVAPSVYFSVLQKLLRGERMSWMTLDVRPKEQYDMAHLPHSVS
    LPLKQLEMWKRDGVLQNEWEKFVNSVPCASRGPMDVYVICRRGISSVKAMQVLLPLQEWCPKSCGTDVDGKAAIHQNPGK
    RFRFINVDGGLNRYHREVDRNFPFY

    >gi|74025378|ref|XP_829255.1| hypothetical protein Tb11.01.3760 [Trypanosoma brucei TREU927]
    MRSRNLSPFSTSTSWRRALCISTAAETPSYFSCLLFYTVRQSSMTHCASKKQADGSKDIGDAAWREKLTTQEYRVLRQKA
    TDPPFGAYNTHFETGTYHCAGCGTLLYKSSMKFPCECGWPAFFDCVPLAVREEPDSDGVRTEILCNACGGHLGHVFRGEG
    FNNPPPNERH
    CVNGTAIRFQSEK

    >gi|74025704|ref|XP_829418.1| hypothetical protein Tb11.01.5200 [Trypanosoma brucei TREU927]
    MFFVTPRALATITAPQVLAVVRSKLGGSRAAANKIIVDVRSTGEVAATGLIPTAVNIPLNALPAALSDEVDEEEFVKTFG
    HPKPRKDEAELIFY
    CERGVRSATATEIAEGLGYRYVKNFVGSFAEWRECYGGAPFDDADGCKG

    >gi|74026166|ref|XP_829649.1| glutathione peroxidase [Trypanosoma brucei TREU927]
    MNGGAIFSHSVLMDGNAVMLSKYAGCVTVLVNTASLCSFTSSNIQHLIHVQQKWASRSFTVLAFPCSQFGNQEPKKRDEI
    CCWVARNGINFPVFDKVNLKGPNTHPLFQMIQSSLGPIRWNYTKVVCNRAGLPCVKLQPGSSLEELERYVSQLCDE

    >gi|74026214|ref|XP_829673.1| hypothetical protein Tb11.01.7830 [Trypanosoma brucei TREU927]
    MTNPAEQALLRIAETIERAVDDEMERVDNMDDEELLDIRRKRLKALKEMEARREAWIRKGHGRLHEVSDPKEFFQFVQES
    ERVVVHFMRRSTSR
    CSILERHLQIIAPQHFETRFCYVDVERIPSLAERFNVLMLPTLMLVENKNTFHSIIGFDEFGGTDD
    FASETVIKVLASYGMLNEQGMFAADQGND

    >gi|74026328|ref|XP_829730.1| dihydrolipoyl dehydrogenase [Trypanosoma brucei TREU927]
    MFRRCFPIFNPYDVVVVGGGPGGYVAAIKAAQLGLKTACVEKRGALGGTCLNVGCIPSKALLHATHMYHDAHANFERYGL
    MGGAGVTMDVAKMQQQKEKSVNGLTSGVEYLLKKNKVTYYKGEAGFVTPNTLNVKGIDGKDEAIEAKNTIIATGSEPTAL
    PFLPFDEKVVLSSTGALALQQVPKKMVVIGGGVIGLELGSVWARLGSDVTVVEFAPRCAPTLDSDVTDALVGALKRNEKM
    KFMTGTKVVNGTNNGDSVTLEVEQAGGKRETLHCDALLVSVGRRPYTAGLGLEKINVSLNERGFVKIGNHFETNVKGVYA
    IGDVVDKGPMLAHKAEDEGVACAEILAGRPGHVNYDVIPGVIYTMPEVASVGKTEEELKKAGVAYKVGKFPFNANSRAKA
    VATEDGFVKVLTDKATDRILGVHIVCSAAGELIAEACLAMEYGASSEDVGRTCHAHPTMSEAVKEACMACFAKTINF

    >gi|71748682|ref|XP_823396.1| hypothetical protein Tb10.389.1880 [Trypanosoma brucei TREU927]
    MTQNIIRRIFGNRELPENLSGSEYERYMQENFPKWIDEFEKGGFLEATKLPAIKSERDFLSKLIEHKDEIMVVKYWKHGC
    IPCLSLAEMYKQVSEQCKKENRRIAWYSVNTKDVSARSLVDYQLVNGTPTVQTFSRMKQVGKEIRAISAEELMRELSLRE
    AALNTES