Tribolium castaneum

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|91078330|ref|XP_973321.1| PREDICTED: similar to 15 kDa selenoprotein [Tribolium castaneum]
    MMKGSIITLILTSLCATKCLSEFTTEDCWALGFNKANLLCSSCEQLSKFNLDVIKDHCKECCHQDESATVEKKYAKAVLE
    VCT
    CKFGAYPQIQAFIKSSRPLQFPNLQIKYVRGLDPIIKLYDKDGTLQETVAIEKWNTDSVEEFLKTHLQQDDDDYLRT
    NMI

    >gi|91085787|ref|XP_974503.1| PREDICTED: similar to thioredoxin-like protein [Tribolium castaneum]
    MGTIKVINDESHFQTELANASTRLVVADFTASWCGPCQRIAPIFQQLSTKYVKAVFLKIDVDKCQETAAMQGVSAMPTFI
    FYRNKTKVDTLRGADPTALENKIQQYYGSEEGEEADAVAGHMDLQPFIMKAQCECLNESDEHLLEHCLNSGGGYLQSDCD
    EQLIISIAFNQAVKIHSLKIKAPADKGPKNVRIFINQPRTLDFDLADGYTSVQELQLTPEDLEGNPVNLRYVKFQNVQNI
    QFFIKDNQSGGEVTQIDHLAIIGSPISTTNMGDFKRVAGKKGESH

    >gi|91079919|ref|XP_967329.1| PREDICTED: similar to AGAP007491-PA [Tribolium castaneum]
    MHPLTLLLLALALHLANNASLSIYEQQKYKQFLEGQGLYSPNDDVVILTVHNFKTQVMNSPHAWFVEFYNSWCGFCQRFA
    PSWKALSTDVKGWADLVQIAALDCSVDENTPICREYEIMAYPTLRYFHEGYQPGPQNLGVAVQKGDDVGAHRRYLIERLV
    TEQRERRGAHYPNLLPYEHATLDNLFSGRGELIQYGFLVVEKFGGFIGAGVTLDLHKTPVIVRYAYDNNTVLLNKLGIST
    LPVVVSVDRNLHYQVTSAGSRDAVKSVIGQFLQKQNIKLSDDTPKQEIFTGKWLDVQVPDMSSLIQERAKQALKERIKSM
    GDVVFQMDLETALRYSLKHEIATTKTIEGEKLQVLRAYLTILRKYFPFGHGGQLFLTELAMKASGESVQGSELAEVISRA
    EAENSYVFSSPQQWLACRGSSPAFRGYPCGLWKLFHFLTVNSAEHNVNNRRADPLEVLSVMHGYVKNFFG
    CQDCSRHFQE
    MALKREMRNVSSLDSSVMWLWMAHNEVNKRLAGDQTEDPEYPKVQFPSKERCPTCRVNDNWELLEVLKYIKHMYSGINVR
    YIGSDTTLLHVGLDGGKAATSGSSSVFRQLDMTRLSEKAVRVRPVG

    >gi|91078348|ref|XP_973652.1| PREDICTED: similar to prostaglandin E synthase 2 [Tribolium castaneum]
    MSLFSHGLRRHGRDLLRLGPSGVNLVGVWGGGVSFRNYTTHRSLKGVFKLGLAGVTVGALVGTGYSIHRLNQPRGHIINE
    ETAIPILEELPKIAPSREVRFPEDRSGLKLTLFQYQT
    CPFCCKVRAFLDYYGISYDVVEVDPVLRQSIKWSPYKKVPILV
    ADLPQGYQPLNDSSMIISALSTYIKDRKDLRETVKCYPHITYVDEDGSKKSEIMNKYFLVLGENKISREINEERQWRKWV
    DEVFVHVLSPNVYRTREEAFEAFNWFSEVGEWEKNFPSWERNLIIFVGASAMYLIGKKLQKKYSLKRDVRESFYDECNFW
    MKSIKAKGTKFMGGERPNLADLAVYGVLCSIEGCQAFKDIVKHTKIAEWYYPMKEAVNGHEGAQFV

    >gi|91079921|ref|XP_967414.1| PREDICTED: similar to quiescin Q6-like 1 [Tribolium castaneum]
    MKKITVFLLLINFLIPTTTQSETSEAELLYDPSENIEILDIHNFHTKIENSQTPWLVKFYLGWCGTCQKLSTEWKKFRNE
    ITPWTDLVKVGAISCSDPANTPVCLNSNISAYPTIKYFPENYKSGDDSTVILKGEHLDVKALKKRVIGQIRTEISEKRGQ
    MYPKLSTYEHPNLEKMFEGLGESVKYVVLVVEAPDQCFATEIALNLHKNRNVSVKFAPNTNTDLVNNLQVSTFPSVVVLD
    RNNNVSKRFTDPEGVAIESFLLSYGLEVNRIEPNTTKKIVPKKLLRLNQRVKKMGDVVFQVDLEAALRYSLKQEVSAVRV
    ITNERLDALRAYLTVVKKYFPFGENNELITQLVKLTSSSEQVQGVEIFQLVQKAETNRAFSSVQTYLGCLGSVSGKRRYP
    CSLWQLFHYLTVNSDDETNPREVLTAMHGYIRHFFG
    CGGCSRHFQQMAIERNLSGVSSLKEAVLWLWEAHNVVNQRLKGD
    VTEDPEFLKDKFPAKLRCVECYEEDGTWRRNEVFEYLKKMYGKFNVRYVGSDTRVLFPDLDNMF

    >gi|91089517|ref|XP_970614.1| PREDICTED: similar to thioredoxin domain-containing protein 9 [Tribolium castaneum]
    MNQLEDKILHVTKAIERQVDSAIEQIENLDVNDLESLRKQRLNELKKKEAQRNEWLSLGHGKYEELAEEKEFFDVTKRSK
    NCVVHFYTNTTPR
    CAIVDKHLKILAPKHLETRFVKLNAEKCPFLAQNLKIKTIPSIVLVKDSFMVDKIVGFTQLGNRDDF
    TTEMMEWRIAQNGVIDYEGDLLTPPHLQEKRSKSSGKKIRDGAYDRDDDDLDIEEYALNRDSLKSGDSLSKVQATELTPE
    EAAELGLDD

    >gi|91084821|ref|XP_973367.1| PREDICTED: similar to O-6-alkylguanine-DNA alkyltransferase CG1303-PA [Tribolium castaneum]
    MGEFVTSLVRKIGPAAHKRAPPLGLVYGTASTKFGNCLAAFQRNALCYLTFYDTEPPLEGLRQAWPNATLYNDILVSENI
    VKLFEGAASYDLFLKGTDFELEVWEALLKVKKGKTASYEDIARAVGRPRALRAVGRAVGKNPVAYVVP
    CHRIIRKDGAVY
    KYASGAERKRKLLEDEGAI

    >gi|189234841|ref|XP_971787.2| PREDICTED: similar to predicted protein [Tribolium castaneum]
    MKGKQYAIESPIMTKVISLMYKVVSNQRFVIKNTVFLLAFIACYFVNSSGGEDEDFYKLLGVPRDATVKEIRKAFKVLAV
    KLHPDKNQDDKEADQKFIKIARAYEILKDPDTRKHYDLHGDTESSQKKQQYHSYTYYRDQFGIYDDDPLIVTLSRADYGN
    CIISAQAWFINFYSPN
    CHHCHELAPTWRKLSSELEGVIRIGAVNCEDDWSLCYQLSIESYPTLLYYEKEAHLHEGQRYRG
    PRTLDALKEYVLSKITVSVKNVDKENWERDLRKQQWLLFLCAGDNPNCPEHETRLKLAAILDGLMSVGVVKDLELCDKIS
    NTHKSNPIVLWQVDKEKNSDSESFAILHNVQGSDSKEILENILGILPNPESLNEQQFKEIRAKLRNGDENPWLLCFYLGT
    ATDLNLQLKRLPSMIPSINIGLIHCGKNSALCSSLHISRYPNWGILKVGGAFELHHGRDVLHELSAFARDSSKAQNLHAL
    SPADFSNILNGHSAWFVDWYAPW
    CPPCRRLMPELRRASHHFAPEVVQFGTVDCTLHRNLCSQNGISSYPTTILYNGSRTQ
    VFHGTPSEDGIVEFISDMIAPTVITLDDSSFVRLMRKPEDELWVVDFFAPW
    CGPCQKLAPQWRKLAKQLAEFPQIRVAQV
    DCVANSDLCSAQNVRGYPTIRVYPLGSKGMNTVGMYNGNRDVVSLKRWVLNLLPSPVVAMDAEAFKEQILTRKFMTPWLV
    EFYAPW
    CGHCTHFEPEFRKVANKLEGVIRSAKVDCEAERMFCGNLRVNSYPSLFLYLSPTEKIEIDTLNVPEIISQVRNL
    VTNRHLQHDEL

    >gi|91081359|ref|XP_971395.1| PREDICTED: similar to CG7830 CG7830-PA [Tribolium castaneum]
    MKALILGLFVIFCIFFYHVDGQARKQSLSLAERVQQLTEMSNKKAVLRLNGNKFREYVKAAPRSYSVIVMFTAMAPQRQC
    MVCRHASDEFTIVANSFRYSQGYSNKLFFAVVDFDEGSDVFQMLRLNTAPVFMHFPPKGKPKSADTMDISRIGFSAEAIA
    KWIAERTDIQIRVFRPPNYSGTLALIVLFALVAGFLYLRRNNLDFLYNKTMWGMGSLFFCFAMVSGQMWNHIRGPPFVHK
    GQNGQIMYVHGSSQGQFVVETYIVMVLNAAVVLGMILLTEAARGKGDPKKRKILAVVGLVLLSVFFSLLLSIFRTKTQGY
    PYSFLFK

    >gi|91077864|ref|XP_972466.1| PREDICTED: similar to glutaredoxin, grx [Tribolium castaneum]
    MPGLLPDPAAFASATSSGALSVVHFAADWAEQCAQVNDVLDTYSKRPEYASIKFYKCQAEDLSEVSLKFKIEAVPTVLLF
    RSGKIVDRIDGADPAKIADKIKAHCNSKTEGVPLEQRLKALINRAPVMLFMKGDRETPR
    CGFSRQMIQILNDVGADYETF
    DILTDEEVRQGLKTYSDWPTYPQLYVKGELVGGLDIVKEMQAGGELAAALKV

    >gi|91085349|ref|XP_970797.1| PREDICTED: similar to peroxiredoxins, prx-1, prx-2, prx-3 [Tribolium castaneum]
    MPVPSLQKPAPVFKGTAVVDGQFKEISLKDYSGQYVVLFFYPLDFTFVCPTEIIAFSDRINEFKKIKTAVIGCSTDSHFS
    HLAWINTPRKQGGLGQMNIPLLADKSMKIAKDYGVLDEEAGVTFRGLFIIDPKGVLRQVTINDLPVGRSVDETLRLVQAF
    QYTDEHGEVCPANWAPGKKTMVPDPQGSKAYFQESN

    >gi|91077388|ref|XP_975268.1| PREDICTED: similar to putative peroxiredoxin [Tribolium castaneum]
    MRDLWIFALVCVSLSSGATPDEESCHRFGAGTVYPLGVDPKKSEHKLQWTQAVISKPAPFWESTAVVDGEFVQLKSTDFL
    GKYLVFFFYPLDFTFV
    CPTEILAFSDRIQEFRDINTEVVACSVDSHFTHLAWINTPRKEGGLGKVKIPLLSDLNHSISKS
    YGVFLEDLGHTLRGLFIIDTKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAEWKPGQDTIIPNPIEKKKYF
    EKH

    >gi|91078400|ref|XP_974453.1| PREDICTED: similar to AGAP006470-PA [Tribolium castaneum]
    MSRRPSPLDTEKCRQCTSFSDYAKIARRQAYEESSGEVSSTTGSGTFRTDCPLDKDELGRSSWGLLHTIAAKYPENPTRT
    EQKDMTSFFTLFSKFYP
    CDFCAEDLRKELKADPPQIASQEDLSQWLCRLHNRVNNKLGKPEFDCSKVNERWRDGWADGSC
    D

    >gi|189241905|ref|XP_001811119.1| PREDICTED: similar to dihydrolipoamide dehydrogenase [Tribolium castaneum]
    MQSAIRNVVSSSLKIRCNRGALTVFHHGQYSTTHDADLVVIGSGPGGYVASIKAAQLGLKTVCIEKEPTLGGTCLNVGCI
    PSKALLNNSHYYHMAHSGDLGARGISVDNVRLDLDKLWGKRKMLSRL

    >gi|91080447|ref|XP_969254.1| PREDICTED: similar to peroxiredoxin-like protein [Tribolium castaneum]
    MPAKVGDSLPNVDLFEDLPTNKVNLAQLAAGKKIIIFAVPGAFTPGCSKTHLPGYVQKAEELKGQGISEIFCVSVNDPFV
    MAAWAKDQKTTGKVRLLADPSAAFTKALDLTVDIAPLGGTRSKRYSMVVDNGKITSLQVEPDGTGLTCSLANAIKL

    >gi|91080453|ref|XP_969619.1| PREDICTED: similar to thioredoxin reductase [Tribolium castaneum]
    MAFSDKVLDLFQNFYKAKLLQLTHFLKDIRHSFRFYASARPEFDLIVIGGGSGGLAAAKEAAELGAKVAVFDFIVPSARS
    LKWGLEGT
    CINIESIPKKLMHRVAILGEAVQDARSYGFQFPKMESLKHNWKGLRETVQNHIKSINWVTKIELRDKRVEYI
    NSMGVFHDPYTIEAKIKNEWKTFKAKYFLISVGGRPKYPDIPGAELGISSDEVFGLENAPGKTLIIGAGYVGVECAGFLK
    GLGYDITVMVRSVVLRAFDQQMAKLVTESMVAKGVRFLHKCVPTSIERSNGKMLLVKWIDETREEGCDEFQTVLFAIGRE
    ACIRALRLDKAGVSVVADGDKIETINEQTNVPHIYAVGDVLYKKPDLTQVAIHAGKLLARRLFAKSTVLMDYDNIATTIF
    TPLEYGSVGLCEETAIERYGEDNIEIYHAYYKPTEFFIPQKTNAHCYLKVVAKRGNQQKVLGMHFVGPQAGEVIQGFSAA
    IKCNLTVDNLRNTVGIHPAIAEEFSRINLTKRLAKDPFPVASNS

    >gi|189240124|ref|XP_001814796.1| PREDICTED: similar to GA20735-PA [Tribolium castaneum]
    MSSPKVEVVKDLIKSDTVVIFSKTYCPYCKLAKEVFNNLKKTFTTIELDKRDDGEEIQGILGELTGAKTVPRVFVKGQCL
    GGGSDVKALYDKGELQKYFD

    >gi|91092896|ref|XP_970884.1| PREDICTED: similar to thioredoxin, mitochondrial [Tribolium castaneum]
    MNSILKPNAIRSLAKAVNASRLGCVRHGSFKVQDDKDFLEKVENSKEPVIVDFFATWCGPCKALEPRLENIVAKRNGKIT
    LAKVDIDSMGELAAKYEVSTIPALVVFRNGKVQERLTGLQDEDKLSLWVDKVLEAK

    >gi|91076402|ref|XP_969236.1| PREDICTED: similar to CG12547 CG12547-PA [Tribolium castaneum]
    MDSDSEDDMLHYSHQKLSSLIRQKGNKNAAIKEYLENLNYHPIKDFASGLEWFNVSEPLSFSKHLKGKIVVLDFFTYCCI
    N
    CMHIIPDLREVEKEFSVEDGLVVIGVHSAKFENEKVSSNILAAVQRYNITHPVVNDFNSQMWKNCEVSCWPTLLILGPN
    ANPIVMLMGEGHKENLRTYIRAALEYYKEKNQISDHQIPFKSAYHLLPDLKGPLLFPGKITNFVTKNQEEILAISDTGNN
    RILILKSDGTILHQVGSGEIGFRDGSFTQCEFNAPQGLVFQNENTLFVADTENHAIRKIDLAKKTVESVVGSGVQGHDRV
    GGKQWTQQVISSPWDLCIFRTPDMDMSFYPEGNPPIREILIIAMAGTHQIWALFLENTVWWKCKKYTAGTCLSIAGSGRE
    ENKNNAYPHAAGFAQPSGLALCSKNKEVYIADSESSSVRRLSLVDGKVMPVVGGDRNPNNLFAFGDKDGTLFDAKLQHLL
    GLAMSKDEDLLFVADTYNHKLKKVKIVENSVSTVTLPASDTTDGAKNHPFSEPAGLCVSSDGRKIYLADTNNHCVKVLTL
    GSDYSVKSINKLNLNLGEKTANDEEIKHQILEYPSLTINNQGGKVIFSLNIEFANGLKLTEEAPQKWSVKLPDVTWSCVP
    SSGDNLKNIDVVVSVPNRGQIDFVFDLVTCTVETCLPKSFIVRVPIDLKSNVSTSVNANIKVVLDPNNIQVN

    >gi|91089107|ref|XP_972037.1| PREDICTED: similar to Ero1L CG1333-PB [Tribolium castaneum]
    MSPTFLVLLVLCTPSLCYFDPPKDSCFCQLSGNIDECSCNINTVDHFNNIKVYPRLRSLLRKDYFRFFKVNLKRECPFWH
    DDSK
    CAMKYCHVLPCGEGEVPQGIKGEGGRSDEAKCEDKQLDYLNTTISEKMREDLVMWTAYDDALDDFCVKDDKDEEAE
    YVDLLLNPERYTGYKGTSANRIWNSIYLENCFRPKTFYSLYIPSHMLSNMCLEERVYYRAISGLHSSINIHLCANYLLSN
    SGLSLANPKGEWGPNLKEFQRRFSPETTNGEGPHWLRNLYFVYLLELRALAKAAKYLEHEKYYTGDEMEDFDTQMAVKDL
    LNVAQQFSGHFDESSMFTGSAQAKRLKTEFKEHFRNVTRIMDCVGCDKCKLWGKLQTRGLGTALKILFSQNLNHKLFRLQ
    REEIVALFNAFGRLSTSIYKLDDFRQMLRGHDEL

    >gi|91092520|ref|XP_971182.1| PREDICTED: similar to CG9911 CG9911-PA [Tribolium castaneum]
    MIHNVWSVQSPRLTFFISFMVLHIWHNPTDSGAVQLTQDNLDMTLASNELVFINFYAEWCRFSNILMPVFDEASDKIAQE
    FPEPGKVVMGKVDCDKEGSVATRFHITKYPTLKVIRNGQPAKREYRGERSIEAFTNFIKKQLEDPVKEFKELRELNEIES
    NKRIVIGYFDRRDQPEYNIFRRVATNVKDDCQFYAGFGEASRTMHPENQPIIVFRPDRDRSNDLDETYTGSLSNFDELHI
    WVSEKCVPLVREITFENAEELTEEGLPFLILFHAPDDKESIKRFTEIVQTDLLSEKQSINFLTADGKKFAHPLHHLGKGE
    KDLPLIAIDSFRHMYLFPNYKDMEIPGKLKQFIQDLYSGKLHREFHYGPDSDELSSSQKAPTTPPESTFKKLAPSKNRYT
    LLKDEL

    >gi|91092904|ref|XP_971118.1| PREDICTED: similar to GA19760-PA [Tribolium castaneum]
    MSVTHLTTGSQQPLKVDGKLRLYSAEFCPYAQRVRLVLKAKNIPHDIVNISLSHKPEWYSKIHPEEKVPALDTGTKIIIE
    SLDIVEFLDEQYPKNPLYPLEPEAKKRDQELVKKLSPLSDALFKCVLSHKVKTLGQCMAELVPQFEIFETELAARGSPFF
    GGRTPGMVDYLLWPTCERLGVLAIAYGEQLPFDENQLKFLKKWNKAMFENPICQETYHEPEEHWIVVQQKLNFLKTK

    >gi|91092906|ref|XP_971184.1| PREDICTED: similar to CG6776 CG6776-PA [Tribolium castaneum]
    MPQPHLTTGSPQPPKIEGKLRLYSMEYCPYAHRVRLVLNAKNIPHDIVNINLINQPEWYFKIHPQGYVPALDTGSQIVIE
    SLHICDFLDEKYPSPPLFPQDPASKQRDKDLLKKIQPMHGVFLRCISLNENKSLEEWATEFVPHLETFETELSNRGTTFF
    GGEKPGMVDYMLWPWGERVGTIVIAHGQQLPFASDQFPLLRKWRKAMRGDPVCDGLYYGPEKYWKIIQIKFRKAPPEYDN
    V

    >gi|91092908|ref|XP_971247.1| PREDICTED: similar to CG6776 CG6776-PA [Tribolium castaneum]
    MASPHLTTGSQQPPKIEGKLRLYSMQFCPYAQRARLVLKAKNIPHDIVNINLINKPEWYTKVHPEGKVPALDTGSKIVVE
    SLDIADFLDAEYPNNNPLYSSDKNRDKELIKKIAPITDLFYKCVAKTENKSLEEWAKAFVPHLEVFERDLAARGTTFFGG
    DKPGMVDYMLWPWGERAGTIAIAHGAQLPFGSDQFPCLRKWRKAMREDKICSEIYNGPEKFWKCVEMKLKNLPPDYDSI

    >gi|91090021|ref|XP_967356.1| PREDICTED: similar to peroxiredoxins, prx-1, prx-2, prx-3 [Tribolium castaneum]
    MAGLFSTIVRRGPQLLKTAIPAGKNHAFRNFSVAPTLCAPRVQHPAPDFKGTAVINDGFKEIQLSDYKGKYVVLVFYPLD
    FTFV
    CPTELIALDERYDDFKNLNAEVIGCSIDSHFSHLGWMNTKRSEGGLGKLRYPLLSDINKTIARDYDVLLEKEGIAL
    RGLFIIDPNGILRQITVNDLPIGRSVDEALRLIEAIQFFEKNGEVCPANWKKGSKTIKPDPQGSKEYFQAANK

    >gi|189240570|ref|XP_973977.2| PREDICTED: similar to predicted protein [Tribolium castaneum]
    MSTSTKTNRLALEKSPYLLQHATNPVDWYPWGQEAFDRAKKENKLIFLSVGYSTCHWCHVMEKESFEDEEVAKIMNQHFI
    NVKVDREERPDVDKLYMAFIQASVGGGGWPMSVFLTPTLEPLAGGTYFPPEDKYGRPGFKTVLKSIAEQWRTKQSAIANS
    GKYSLEVLRKVSEREISAKQDINVPGEDVWKKCLLQLSHSYEDDFGGFSAQPKFPQPCNLNFLFHMYSRDKHSEQGFRCL
    HMCLNTLRKMAYGGIHDHVNCGFARYSVDDRWHVPHFEKMLYDQAQLAVSYADAFVVTKDDFFAEVLRDILLYVSRDLSH
    PLGGFYGAEDADSYPYEGASHKREGAFCVWEFEEISKLLGETKTDDISHRDLFIYHYNVKEDGNVNPAQDPHHELEKKNI
    LVCFGSFEDTSRKFKTSVETVKEILKSCHEILYKERQKRPKPHVDTKIVTSWNGLMISGFAKAGFVLKDQEYINRAILAA
    TFIKKFLYNEQDKTLLRCCYKGDNAKIVQTVANLLSKSQPTLNSINRRPTPVNGFLDDYAFLIRGLLDLYEASLDADWLS
    WAEVLQEQQDRLFWDTKGSGYFTSPANDSSILIRGKEDQDGAEPCGNSIAVHNLIRLAAYLDRADLRAKAGRTLTVFADR
    LKSIPVALPEMTSALLFYHNSPTQVFIAGPTEDNNTQALIDVVRSRFIPGRILAVTDGPGGLLYRRHESLARLRPIQGKP
    AAYVCRNFACSLPVTEPEELASNLDGNLAENPDE

    >gi|189238613|ref|XP_968455.2| PREDICTED: similar to copper-transporting ATPase 1 [Tribolium castaneum]
    MFKALRGAKPQYVRLEADATESLGFEPLINEKSTESESVSLLAPTGDYTSDQPTIITVSEDDTIKITVLGMTCQSCVKNI
    EETLSRKPGIYNIKVSLQEKAALVHYDTRQLTPQQICDFIDDMGFEATLPGAKMRQCLVHIDGMT
    CKSCVQSIEGMISAK
    PGIKTASVDLETKEGRFEYDPGLVKAEEIAEQIDDMGFEASLKSVDGKPVAKAAPDHRQTQPIPSDLNLEKCQLQVKGMT
    CGSCVAAIEKHVKKIAGCHKILVSLLAARAEIHYDPSLVSPFELATCITDLGFPASVVQESGAGASEVDLEITGMTCASC
    VHKIETNIARLQGVLSAKVALTTKRGKFKYDPEVTGARDIIEAIAKLGFEARLFDRDHGNDYLEQKEEIRRWKHAFLFSL
    AFGGPSMIAMMYFMTLMSSGHMSHEDMCCVIPGLSLENLIMWVLSTPVLLLGGRHFFVQAYKALKHRTTNMDVLIAMATS
    ISYTYSVIVVIAAMIMRQKTSPQTFFDTPPMLLVFISLGRWLEHVAKGKTSEALSKLLSLKATDAVLVKLGPKGEISNET
    LVHVDLVQRGDVLKVVPGAKVPVDGKVLQGQSMCDESLITGESMPVPKKITSSVIGGSINQHGLLIIEATHTGEATTLSQ
    IVKLVEEAQTSKAPIQQLADKIAGYFVPTVVFLSLLTLIVWSIIGSIDINALPVTESEKHDFTKTGIILQFVFRCALSVL
    AIACPCALGLATPTAVMVGTGIGAVNGILIKGAEPLENAHKVKAIMFDKTGTITKGVPEVTRVWLKGDSLSPALILAAVG
    CAETNSEHPIASAIIKYVREAIGAELTGTSSAFQAVPGCGLKCTVSSLGQVVKNAKNCQEMSNFMTLVGAGSSGVFTLNG
    VEVEVSNSQSMKLGQLIGMEAGSGEGEGRYEVVIGNREWMNRNGLVVTEEVDKKMIGEEEQGRSAVLCVIDGEIVAMVSV
    ADMVKPEAHLAVYSLKKMGLEVILLTGDNRQTAASIARQVGIKKVYAEVLPSHKVARVQRLQSRGIKVAMVGDGVNDSPA
    LAQADVGMAIAAGTDVAVEAAHVVLMRNDLLDVVACLELSRKTVNRIRLNFLFASVYNLLGIPLAAGAFSFIGFTLAPWM
    ASAAMALSSVSVVGSSLLLKLWKKPTVRDLQTEEYLAERNSGELDSISIHRGLDDIEQNGAPSISRFLGRNKNGRQLLLS
    SDLDDETSVTFDRRKGGVREPLMT

    >gi|91093365|ref|XP_969666.1| PREDICTED: similar to AGAP005102-PA [Tribolium castaneum]
    MSETQEQKRWGHLRKVLERPGPFCHPEFEPSPEIMDFIVTSCKVLVVGAGGLGCELLKDLALMGFKQIHVIDMDTIDLSN
    LNRQFLFRQKDIGQSKAKVAAAFINKRVPGCQVTPHFCKIQDYDESFYRSFHIMVCGLDSIVARRWINGMILSLLSYEDG
    VLDNSTIIPLVDGGTEGFKGNARVIVPGNNACVECTLDLYPPQITYPL
    CTIANTPRLPEHCIEYVKVVLWPKENPFNAPL
    DGDDSQHIGWVYEKSLERASQFNIPGVTYRLVQGVVKHIIPAVASTNAVIAGVCATEVFKIATSCCLPLNNYMVFNDVDG
    IYTYTYAAERRDNCVVCSQVPQTLPIEDPSKVKLKDLIKILCEDEMFQMKNPGLTTVIDGKNKTLYISTIKSIEERTRDN
    LNKTLVELGLKDGMDIMVADATSPMTLVFTLKFATSDVEMK

    >gi|91092534|ref|XP_967693.1| PREDICTED: similar to methionine-R-sulfoxide reductase [Tribolium castaneum]
    MADKVDKAELRNRLTPIQYHVTQEKGTERPFTGCYNKVYDAGTYVCIVCEQPLFSSETKYDSGCGWPAFNDVLDQGKVKL
    TPDTSGGRIRTEVTCAQCGAHLGHVFNDGPMPTRKRF
    CINSASLNFIPDKKEGGDS

    >gi|91084939|ref|XP_971157.1| PREDICTED: similar to GA22042-PA [Tribolium castaneum]
    MMKQLFFAVMGLVALTSAQHNHEHHRVNVAVYYEALCPDSIKFFTQQLYPSLQGNLSQFVNLTLLPYGKSKTTEQIPGQY
    EFNCHHGPAECQGNRLQVCALRTIGEGHNSEGLGYNKVATAFINCLMDKVKPNGNQTQFPTQECATINHVPNYVNIENCA
    NHVEGSQYLAEIGKQTDALKPPLTSVPTVVFNNQYKQDDNEMAKTNFVKALCQYIHGEKPAECTKNSAIVAKMSYALFVF
    ASVWLYVI

    >gi|91076076|ref|XP_967561.1| PREDICTED: similar to Ero1L CG1333-PB [Tribolium castaneum]
    MGVSYDLFFLTFLFLLTCTFGYFGNVLDDDCFCQLHGKIDDCSCNVDTVDHFNNVKIYPRLRSLLHKGYFRFYKVNLRRP
    CPFWSDDSR
    CAMRYCHVEACEDKDIPVGLKGGLENHSSKNLYVTQSCEDDHNAELGYLNTTISAKVQEDIVLWSAYDDAQ
    DNFCVLEDNDSESEYVDLLLNPERYTGYRGKSAHRIWNSIYMENCFRSTKNDNPYIQSSKLNNMCLEERVFYRAISGLHA
    SINIHLCAQFLLSETSLSEPDGKWGPNLSEFLRRFSKETTRGEGPHWLRNLYFVYLLELRALNKAMRYLEKEEFYTGNES
    EDWDTQLAVKDLLSVVQKFPNHFNETTMFTGSEQAEKLKYEFKQHFRNVSKIMDCVGCDKCRLWGKLQVQGLGTALKILF
    SGKFDDQLDLSSDRKKFQLQRSEIVSLVNSIGRLSTSIYELDEFRQMLR

    >gi|91076078|ref|XP_967638.1| PREDICTED: similar to legumaturain [Tribolium castaneum]
    MNGKYRLLLLFVSIVFLWKCFQYFAIFSDPPENEISADLSTIPKVKVSVYYEALCPDSKFFIIHQLLPVYEELRDYLNID
    FVPYGKAKTVETEGKTIFYCQHDAVECFANKIHACVIDFVADPLVRAKYIACMITDNMIPDDAGEKCGQELGVKYAPIGD
    CANGDRGTALLKGYGERTHSLKPSVKFIPTIELDGSQTVVPQSAILKNLQKSVCQLFKRKPRQCG

    >gi|91077992|ref|XP_968954.1| PREDICTED: similar to selenoprotein W2 [Tribolium castaneum]
    MGVEVDVEFCGTCGYFKKFEELAQHIKAKHPDIELNGHEGRRATFEVKVNGTLVHSKLTTLAYPDYDDLSAIIDEVAQGK
    EPRSCKQQPITSCIIA

    >gi|91083003|ref|XP_974477.1| PREDICTED: similar to selenoprotein T [Tribolium castaneum]
    MAGLRQISCFWYLVVFAGLCFLESNGNVAAEDVLPSKLSQNVGAPTLKFLYCYSCGYRKTFEQYVKIVGDKYPFIAVDGQ
    NYDPPGLNMYLARLIGIVKMVIIVCILGAINIFEYINQPQPSWWIWCTENKLYACMMLFFVCNIIEGQLIQSGAFEISLN
    DVPVWSKLETGRIPQPAELFQIIDNHMQFTDSKIELSNGFPK

    >gi|91088733|ref|XP_975253.1| PREDICTED: similar to glutaredoxin (AGAP011107-PA) [Tribolium castaneum]
    MSSEKSKSKFVQNLIASDTVVIFSKTYCPYCQLTKEIFDDMDQKFTAIELDSRKDCEEIQEVLGQMTGARTVPRVFVNGS
    FLGGASDIKKLYENGQLQTYLD

    >gi|91092038|ref|XP_969802.1| PREDICTED: similar to glutathione peroxidase [Tribolium castaneum]
    MSNPANPQEAKSIYEFSAKDLKGETVSLEKYKGHVCIVVNVASQCGYTKNNYAELVDLFNEYGESKGLRILAFPCNQFAG
    EEPGSSEEICQFVSSKNVKFDVFEKVNVNGKDAHPLWVYLKHKQGGTLGNFIKWNFTKFIVDKEGQPVERHGPSTNPKDL
    VKSLEKYW

    >gi|91092040|ref|XP_969867.1| PREDICTED: similar to glutathione peroxidase [Tribolium castaneum]
    MPRVKTKARKRTQPTGDAADTKHTTAESSEPEPSSEASSATTIYEFTAKTIEGEEISLEKYKGHVCIIVNVASKCGHTKS
    NYEQFVELYDKYSEEKGLRILAFPCNQFGGQEPGDSEKICEFVKARNVKFDMFEKIKVNGKDAHPLWKFLKEKLPSPKGK
    DIKWNFTKFIVNDEGVPVERHASSVKPLTLLESLQKLW

    >gi|189235790|ref|XP_969937.2| PREDICTED: similar to glutathione peroxidase [Tribolium castaneum]
    MGGTVPKTPLDSGFGETVLSPNGQYQNSASIYEFTANDIKGEPVSLEKYKGHVCIIVNVASQCGYTKNNYAELVDLFNEY
    GESKGLRILAFPCNQFAGQEPGTNEEICQFVSSKNVKFDVFEKINVNGNDAHPLWKYLKHKQGGTLGDFIKWNFTKFIID
    KNGQPVERHGPSTNPKDLVKSLEKYW

    >gi|91092602|ref|XP_970692.1| PREDICTED: similar to ERp60 CG8983-PA [Tribolium castaneum]
    MFTKYFLCVCIVCYFSLAQETKPLQYNDRNFDTKMNEHEVALVLFYAPWCNHCIQFLPKFADAAKQSEESSRPIAFVMVD
    CENDGKQTCEKFGVSSFPTLKIFRNGKFLKAYEGPREAPAIAKYMKAQVDGDSRELGSVAELEDFLSTDEVSVVGFFESD
    SYLKVVFFKVVDKMKHKIRFGHSTSEAVMLQQEVADGIVLFRPPHLHNKFEKSSVLYEGDAETDEIIQFIMDNYHGLVGH
    RRKDLEEFEKEPLVAVFYAVDYKKNTKRTNYWRNRVLPVAKKYENQFYFVISDKDEFKSELKGHKLYEKNLTKPVVLAQN
    FRKRLFKMKEPFSTEALDNFVQDILDGKLEPEMKSEPIPEVNNGSVTIAVAKNFDKLVYDNGVDTVVLLTGPD
    CDECIIV
    EKPYEELGEKMKNEDIAVIKMDISKNSSPQELELDGIPSIFFLPKDSKDYPILHKGDFYIDDFIQFVAQHATNELKGYYR
    NGKPRPERTEL

    >gi|189235323|ref|XP_975184.2| PREDICTED: similar to AGAP012407-PA [Tribolium castaneum]
    MNLLSAFCLIATAASLGWASEEIKSDEGVLVLTKSNFKQAITDNEFILVEFYAPWCGHCKALAPEYVKAAKALADQDSKI
    KLGKVDATEETELAEEHQVRGYPTLKFFRNGSPIDYNGGRQADDIVAWLLKKTGPPAKEIKTVEEAKEFIDASNVAVIGF
    FKDQTTDKAKAFLAAAATIDDYPFGITSEDSVYKEYEAECGSIVLFKKFDEGKVLFEGEATEKNIKKFVAGNSLPLIVEF
    NHETAQKIFGGDIKSHLLLFLNKGEDHFEKVSEAARAVAKPFKEQVLFVTIDAGEEDHQRILEFFGMKKEEVPAARLIKL
    EEDMAKYKPETDELSSESIKKFVEDFLAGKLKQHLLSQDLPEDWDKEAVKVLVATNFDSVVFDADKDVLVEFYAPW
    CGHC
    KQLAPIYDKVGEHFKDDKSVVVAKIDATANELEHTKITSFPTLKFYPKGGNNVIEYNGPRTFEGLVKFIESGGVDGAGVD
    EPVEEETEDDDSPRKDELLCSHNQKLFFNLVVLLWCRYLIPFPDIVLILFPCKMALRNGVRRGGALISNYFRSYSSAGPL
    VNVAVNEKTGVATATLNRPPVNSMNLELLTEISNTLTQLEQNKCRGLILTSSSKSVFSAGLDILEMYKPDPSRLKEWWTA
    LQQTWIKLYGSSYPTVAVINGHAPAGGCLLSLSCEYRIMLNNFTIGLNETQLGIVAPQWFIASMRNVIGTRQTELALTSG
    NLFSTDEALKIGMIDEVAASKEDGIARAEKFCGRFARIPPIARARSKLGVRGADIQDLTNNLQKDYENVANYVAQDSVQK
    GLEMYLQSLKQKQK

    >gi|91085541|ref|XP_972533.1| PREDICTED: similar to predicted protein [Tribolium castaneum]
    MDHKSQWHERLFGQQLLKCDTNSPKSGDFLCVATPEVLQNVQITGVYFSFANISQQSDEFTKKLKVLYERLNQENCEVKK
    FEVVQVVLWANNDVFSDFENSHRDSLVGLPWFAVPFSEIDLKTRLSRRYRIKSGVPTLVLLDRDGGTISVSAQDRLLEDP
    LGSSFPWRPRPVDQVLKDVVLQKGGTFSKEHPCTKPEFRYSDLPDAVRGFYFSANW
    CPPCRAFTPQLAEVYRLIRKKEPG
    FEIVFVSSDRSAESFEAYVEGMPWLVVPWQQAGVRAELAQLYGIRGIPTLLLLDRNGHIITMDARTELAEDPMAQNFPWK
    PRAVNILTERFANKLHDYPAIVLFVDGEETELQFAESVLSPAADSYYKKHNINFNSAPEDFFSNCEDDHYLQFLIGLDSE
    TSDILRDLIGLDDVVPLLVGIDIPNRRFAVMEYGVEITVDSVSDFVERFQKGEVKFIELNERVGEEQS

    >gi|91082695|ref|XP_971685.1| PREDICTED: similar to AGAP007393-PB [Tribolium castaneum]
    MFLQKIFVLCLFYCACFAKEEDVLEFSDSDFESRVAEHETALVMFYAPWCGHCKKLKPEYAKAAEDLIRNDPPIALVKVD
    CTEAGKETCNKHGVSGYPTLKIFRNGEFSQEYGGPREAGGIVKYMKAQVGPSSKELTSVQDLEKFLKAENDVSVVGFFEK
    ESDLKTAFLKLADKLREKVRFAHSTYKPVLEKQGVSDGIVLFRPQHLHNKFEDDSVVYSGGAVTGEIQDFINKNYHGLVG
    HRKSDNRNDFQNPLVVSYYGVDYVKNPKGTNYWRNRVLKVAKQHKDKINFAVSAKDDFQYELNEYGIDYVKEDKPVVLAR
    DAKNQKFIMKDPFSIEALDSFVQDLLAGKLEPYLKSEPIPENNDGPVTVAVAKNFDEVVLNNGKDTLIEFYAPW
    CTHCKK
    LAPVFDELGEKMKNEDVAIVKMDATANDVPQPFDVRGFPTLYWAAKDSKDSPVRYEGGREVDDFVKYIAKHATSELKGYD
    RKGNPKAEKTEL

    >gi|189236262|ref|XP_974436.2| PREDICTED: similar to thioredoxin (AGAP003338-PA) [Tribolium castaneum]
    MIFAKLVTKNLIRNCSRCFSSSTKLNRLITIKSNDEFLNKVMNSDNPVIVNFHAEWCEPCHILTPKMKELVEHDANIDLA
    IVDVEDHAELVHTFEVKAVPAVIAIRNGLVVDKFIGLVDAHMIENLISKLGKKGMLDFILQTL

    >gi|189234460|ref|XP_968338.2| PREDICTED: similar to transmembrane protein, putative [Tribolium castaneum]
    MSRFLYILSCLSVIFNSFCNCGAIKSIQDDDLMNLIRSETYVVALFSAKNCELCDNFENILTNLEEEFSKSFEGETVKVV
    NSQLTRLYSPTKEPVLVFFRHGIPLLYNDIPSEELILHTFVNNKEPVVKELNDETFEHLTQAASGATTGDWFVMFYTPD
    C
    VDCHRLQARWETVGAQLKTRMNVARVNKATDGAATATRFGVSQAPTFILFRQGKMYKYQIQKYDVASFTSFAQEWYKNVT
    PIKVPSPKTPFDNIVENIVLNLKESAMAWKIGLAATVVGFLLIILMKCRKTEKPQKPTSKKDK

    >gi|91088775|ref|XP_967272.1| PREDICTED: similar to AGAP012394-PA [Tribolium castaneum]
    MPSLLHEITTPFKKATFGMGCFWACDALFGAQPGVLRTRVGYSGGTTLDPQYRKIGDHTEVIEIDYDPKVVSYEDLLKLF
    WSNHEYGLTNVIKRQYMSLILYHDDDQKRIAEISLKKEAHKHNTKLTTEIRPAGAFYPAENYHQKYRLQEHAWLCEELGL
    TPELLQTSHVAARLNGYLVGVGKLEDFEKDIAKLALTDKIASFVRAQLIENEGGSLYC

    >gi|189236765|ref|XP_975383.2| PREDICTED: similar to CG14407 CG14407-PA [Tribolium castaneum]
    MVNNNKVVVFMKGVPEQPRCGFSNAVVQILRMHGVQYEAHDVLSDESLRQGIKDFSNWPTIPQVFINGEFVGGCDIMLQM
    HQSGDLIEELEKVGIKSALLLAKEKEDAEKKS

    >gi|91081129|ref|XP_975539.1| PREDICTED: similar to CG9427 CG9427-PA [Tribolium castaneum]
    MYKFSLSFILAIATIQQIRSQSKLHVEVLYESLCPDSLNFITQQLHPVFKELAPYVDLKLTPFGKSASLDNGLQFVCQHG
    PKECKGNRIQSCVLNALPDQTAQVEYVNCFMTTFKKGQKNDEEFGQACAEAVGLEFNQISQCYATETGTKLQLLAEQSTV
    KVTPKFVPTILYNGVFDQQLQDNSLVDFRGVVCNILAQTYPEACQSPAVIRL

    >gi|91079422|ref|XP_975772.1| PREDICTED: similar to thioredoxin reductase isoform 2 [Tribolium castaneum]
    MAPIGDGPEYDLVVIGGGSGGLAAAKEAAGLGAKVAVLDYVTPSPKGTKWGLGGTCVNVGCIPKKLMHQAALLGEAIEDA
    KSYGWQFPQPENIKHDWASLRQAVQNHIKSVNWVTRVELRDKKVEYINGLGVFKDPHTVHTVTKQGERTLTSKYFLIAVG
    GRPRYPNIPGAVEYGITSDDIFSLEEAPGKTLVVGAGYIGLECAGFLRGLGYDATVMVRSVVLRGFDQQMAKLIASAMEE
    KGVKFLHKCLPKSVEKRSDNKLLVKWSNETGQEFEDVFDTVLFAIGRRALTRELHLDKAGVKVAGDGEKIDAMNEQSNVP
    HIFAVGDVLYKKPELTPVAIHAGRLLARRLFGNSTVQMDYDNVATTVFSPLEYGSVGISEETAIQRFGENNIEIYHAYYK
    PTEFFIPQRSIAHCYLKVVAKREGPQQVLGMHFIGPQAGEVIQGFAAAMKCNLTVNALMSTVGIHPTIAEEFTRINITKR
    SGKDPNPASC
    CS

    >gi|189240633|ref|XP_969135.2| PREDICTED: similar to CG40178 CG40178-PB [Tribolium castaneum]
    MKWQSNSWIRCGYILVCLLGTALAELGNPYEILGVHRKASQSEIKKAYRQLAKEWHPDKTKDPEAEEKFVKIKQAYELLS
    DAERRNKFDNKGITEDDFYNNPEHPPFHTSNPFDDIFTAHGAHFNFQENDITFFHKLSISTRQYDKLIVPKSERTPHLIF
    FYTDW
    CFACLQTAPYCRKLVDKLEPLGVNFVTVHSGREPALARRLNIHALPCIVLLLDGNVFVYKETITSIQRIIEFLKN
    KLPYKLVPKLKHEDVEGFLNGWEDNRVRGLIFEPRQNIRLRYLITAYHFRHRVAFGQVLNKSICFYLPFSFVDSLEIRRK
    YQVPQDMDTVLLFNENTSSPMASLSMKDIPTSTLHHVVSLNQYLALPRLSSQEVLEALCPCEWNKPRKRLCVVLVTKAST
    SHDPHRQSFRIYAQNSPYNVEKVRFAYIYHDKQTEFVNSLIPEGEDVEPLLRIVILWRRDTSHVKYEWVNDKWEWENNLN
    QTTQKLESTISRLLRSSEALTYEALVNDLFDEHAKGIFGRIASKVGTFVESVYDGLSKDQILPALSIVGTIIFILAVGYF
    MAYLVRLEEESIQQQKAKAKSGNNNNDSNSSYQPELRLHELRAEKYNGLVRLLKPGCRTILLVVDMHSCRQLIPPFHKAV
    WPYRKNKTLMFSYMYIERGLSWYKELLQLSLPEERELNINPRNCVGTVLSLNGHRKYFCMFHAKHTERNARKQRSKMPTK
    FDEKDCESGTFIGFDSDSSESEEELLLQENLLDGLPNWLDRLFEGTTQRYHINYWPDFPNK

    >gi|91092966|ref|XP_966837.1| PREDICTED: similar to AGAP004468-PA [Tribolium castaneum]
    MATLEDKILGEKLHNYCSSSEESEGDSDSEEQNKKTEPVDATPPEVNKWEGTSSNTGPKGVIKDWQRYKQLENEKRAEDE
    SEKIALMKKLTLTVQSALDEEREKAALEDPDLAELLNDDFLLNYQKQRMQEMLLQTNHNIKFGEVIVLKSSGELLDAIDK
    EHKSVTIVVHIYEDNVEA
    CRTMNVCLKQLCKTYENVKFCSIVGSRAGMSMRFKTDGVPALLIYKGGQLVGNFIRLSDDLG
    TDFEPEDIQSFLVEHGMLEDKSCTPLLIQGGTDHSDSD

    >gi|91087861|ref|XP_968908.1| PREDICTED: similar to disulfide oxidoreductase [Tribolium castaneum]
    MGCSTSKVEVSRSTAKDEEYVEGVVCQDSDVGENEMKSFELGEGRVLLVRQKGKLSALGAKCTHYGAPLAAGALGDGRVR
    CQWHGACFNILTGDIEDFPGMDSLPCYQVTVENNSVKVRAKRSELETNKRVKSMTKRNPAESQHIVVIGGGPSGAICVET
    LRQEGFAGQITLV
    CKENCLPYDRVLVSKAMDFDLSKAQFRTEQFYKDHGIDVLKGVKATGVNTTQKSVNLSNGAVLTYDK
    LYIATGMKANKVAIPGADLQNVVVLRNYEHSKATNALIRPDLKVVVLGSSFVALEAAAYCVEKGVKDVTIVARGSVPFKP
    FLGEVVGGAFKAFFQEKGVKFISNSGLSKCLDDGTGKVGKVELKDGSTLEADLVIMGVGSSCLTDFLKGSGVELRPDGTV
    EVNEFLQSNSPNVYVGGDIAYAPVWSHHGHKAAIGHYPLAHYHGKIAALNILGKGRRLQAVPYFWTKLFGKSLRYAGHGK
    FSDVVYIGDVDKFKFVAFYLDGDEVVAAASVGWDPVVSQFAEVLALGKTLTRKDVENEDKFTWTKLLQST

    >gi|91091584|ref|XP_968263.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum]
    MASRVVATATVRAVRKKLAPTRAALVLTPAAVNRVKEILKGQDNYVGLKIGVKQRGCNGLSYTLDYVDKKDKMDEEVVQD
    GVRIFIDKKAQLTLLGTEMDYVQNKLSSEFVFNNPNIKGTCGCGESFNI

    >gi|189235835|ref|XP_967696.2| PREDICTED: similar to AGAP005431-PA [Tribolium castaneum]
    MYGYLAVFCALLAHCSASRVLELSDKFSEIYKEGGFWLVKFYAPWCGHCKRLEPVWAQVAQALYKTNIRVGRVDCTRFPT
    LATEFSVNGFPTIKFIKPGEDFTFHGDRSKDDIVNFAIRMAGPPVQDVTRSESLTNLKQMNQLFFMYVGDQEGLLWEAYY
    DVASKLQPHGFFYAASKEIAKQHVDVDELPAVFVYKESLHYFYPSELEAQHLNSSMYKWINEERFETFPKITRGNINEIL
    QTKKYIVLVVVEENKLQQISQEMLEFRDMVESIIRKKRDKYHKHFQFGWVGNPELANSIAMQVLPLPHLLVLNSTTNHHH
    IPEDDPSQLTADAIDIFLERIYNQSVPAYGGNSITVRLYRTYFEARTSLADMWRGNPVLTTVLFGLPLGFLSLILYSICC
    SDILDADEDEEEELLHEKKE

    >gi|91076594|ref|XP_968419.1| PREDICTED: similar to peroxiredoxin [Tribolium castaneum]
    MRLRLGDTVPNFKAETTQGPIQFYDWQGDKWVVLFSHPADFTPVCTTELGRIAVHQPHFAKRNVKLLAHSCDKLKDHVDW
    VNDIKSYCRDIPGEFPYPIISDEKRELAVMLDMIDQQHKDDEKRALTVRALYIIDPKHVLRLSMHYPQSTGRNVDEILRV
    IDSLQLVDRVPQVATPANWVPGEKVMILPSVKEEEAQKIFGGKVDKVTMPSGIVYVRTTTNYQ

    >gi|91094485|ref|XP_970942.1| PREDICTED: similar to AGAP010217-PA [Tribolium castaneum]
    MKHFNTIFFLLLAFEINIYLTKDTKNAVVDNIYDIKEFKKLIRTKTNVLVCYTNSIKQASQVIKVFREAADVIKGQGTMV
    VMDCSGEAKKVCKKLKVTPDPFIFKHYKNGEFNRDYDRKFTVSSMVNFMRDPTGDLPWEEDASASDIVHVPDAETLAKFI
    RQESRPLMVMFYAPW
    CGFCKTLKPEYVAAAKELKGHSVLAAIDVNKPENAVIRTLYNITGFPTLLYYKNGAMKFQYEGDN
    KRQAIVNFMKNPSKPVKVKEQEWSEVDSEVVHLTTTNFDPVVKEEASLLVMFYAPW
    CGHCKKIKPEYEKAAAKLKSDGIP
    GMMAAVDATKEVSIADRFSVKGYPTMKYFTYGEHKFDINLREATKIVEFMKNPKEPPPPPPPEKPWSEEESSVVHLNEEN
    FKSFLKKKRHALVIFYAPW
    CGHCKKAKPEFTKAAEFFKDDPKVEFAAVDCTTYQGVCSAHEVSGYPTIKYFSYLNKVVKA
    YNSGRTADDFIAFMSDPEGNGSSQKTIVPQLTDANFEEEISSKSAVLVMFYAPW
    CKQCKEIKPEYQKATNELKQDGFIAQ
    LASVDCSSNPVVTDKYDIGTFPTFKLFLNGKFAADFTGKSTKDDIKSFVVDVKNRKNKEL

    >gi|189240022|ref|XP_971926.2| PREDICTED: similar to quiescin Q6-like 1 [Tribolium castaneum]
    MLKPLALLLVLAGSQCAPLGDLYLPDDDVEILTIENFKRYVENSTSAWLVEFYASWCGYCQRFAPPWKQFATEAAPWRDL
    VRVAVLECSDEINTPICRDFGIVKYPTVRYFHENSHFDGGDKGVIVPREFPVTVDAIKKNVIERFMTEMGEGRGVVYPNL
    LPYLHSDLEPFFDEEDDDIFYGFLVVEDSDSYLGGEVALDLHKTPNVTIRHALNNNTKLVKNLQIGKFPTLVIIDRNNNT
    QIVTENIEHKKELKATIADYLAKKGLKVCETTPEKKGHLSLDPHPDPKQRSRTLLRQKIKKMGDAVFQMDLETSLRYALL
    REVSTTKVIKGEQLAALRAFLNVIKKYFPFGYNSTSFINNLTNLTSSDEVQGVQVQVLVQQADDSGVFSTPQRFLGCQGS
    ANRFRGYPCSLWRLFHYLTVNSVLLNVSNRKANPVEVLGAMHGYVKHFFSCSHCSEHFQKMAAERNLTSVSSLEESVLWL
    WEAHNVVNKRLKGDTTEDPEYPKEQFPTRLRCPECYGEDGTWRKKEVLKYLKRMYGRYSVRYVGSDTKVLFPGLDR

    >gi|189234978|ref|XP_001807535.1| PREDICTED: similar to lysosomal thiol reductase IP30 precursor [Tribolium castaneum]
    MRCFKSLITILILCEFSPVWGSEQVKVSLYYESLCPYCRQFVTQQLYPGFKTLPNSLIIDLIPYGKANQTKINGNWAFTC
    QHGPSECQGNKIQACVLTKPFEMDAKINFVFCMMNSSDPGAISNARTCAFTCKISWNDMKDCVEGSQGDDFLAHFGDVTH
    NLDPKLTYVPHILFNGMFNETLENDARENFLKTASKSSGHWKFRCQHGPRECYNNKIHTCVIAHNPPKPTLNFINCAMKS
    PDSPKMCAIESGISWNVISNCLNSGQADVLLAQNGDKTNAVTPPIDYVPTIIFNGVYSKAMQNFAEKHFAKSVCSQLKNK
    PNAVPLNVSVYYESL
    CPDSIKFITTQLYPTYQLIPSELNIQLVPFGNAKIANLSDGTLNLTCQHGPDECYGNEIQACAIF
    FDLKDSIDFVNCAMASDDPSGDTFLSQCANSSDMSWIRIKQCVDSGLGDDLFVQNGNLTPDFINYVPTIIFNGVYNDTLQ
    EQGEKEFLKTYSLKVSLYYESL
    CYDSSRFITRQLTPNYSQLKNYIQLEFIPYGKATHNYVNRRWIFDCQHGPNECQGNKY
    QACALAQNSGQDKDLAFVDCVMRERNPADVEKIKKCAQRVGINWGKITKCATTNQGDDLLAKHGSRTYDLEPNISFVPTV
    VYDDQFDDNLQEMSLVDFAAVVCSKIRSDKPRICDNKTLPQRRFFSM

    >gi|91079774|ref|XP_967412.1| PREDICTED: similar to GA19859-PA [Tribolium castaneum]
    MNSKHLTKGSRKPSPVRRGKLRLYSNRFCPYCQRVILVLDAKRIPYEVVNINLVNKPDWMFDKSPMGKVPALELDNGEVL
    YESLIIADYLDDKYNAHRLHAKDPLQKAKDQLLLKQFTKIINALLKTVSLGRIEHDEAQVISEGLAIFERELTDRPGPFF
    GGSRPGMLDYMIWPWCERSDVLKIYGKDYILKKEKYKQLMEWRKVMVEDEAVKKSWCSANTHIKYLQSSRAGVPNYDLLI


    >gi|189237510|ref|XP_972627.2| PREDICTED: similar to CG14221 CG14221-PA [Tribolium castaneum]
    MAKKGQAIQLQTEVNNDEDWEKLLQRDGLIVVDVYSEWCGPCSGMTATLKKLKLEIGGDVLQLAIAKADKITALERFRNK
    SEPTWMFIINGKMVNFMFGANAPKLTRLITEELRKENEARQGRRDRVQNEISDITEEERERLDVVERQRRAAKEKEEAKA
    AKELFERRTAECHKILETLQHMGIILIFPHAKTSYQEAFGDLLGEAGLTISQTEKVDLTEQILDELFYFGEMPFPEEALE
    ELLNNTCMILQVKPIPARDVEEPTDELILQILYGPSKKPPGSSDCPARVLAKLPEPSEEEVHEKTARESVGVWAPENELI
    KATALRLFFHKLTEHYLIPEPEPTPPHYAVVFEAMRRHEIASFMEKYSDQVIRYGFFTSERPEEAKLVAKSIYKYERSPD
    RTPNEKMVIQLAKKKSECVLAFAQLKPLYISPNIKEGERECRLFFGDDYDEPPEEEEIEEQKEVPATPKSKSEQASVLDQ
    DIEGSQVVALEEGEIVEGVPEEGAEAVAVAEEGAPLVGEVPPAEGEAPPAEGVPPETEPSVVVEPEASPPDQPENVPETE
    APPPAETTELVHVSEIALEEMLFFAEEEVEQFQNEELFKKPSMALLMKRSSENLPNTIDDVVAQMVYGNHRKPPGDENCP
    YRKLITTKDNVELPGIWAPTNSLCKAMGLKWLFPNISGPYKLPEVEPTPPHVIIAYDAFKYKEVMELGNQFPSAIMKYGF
    FSNHTPGSAQLITKTVDKFEKQTTPPTYEEKIVVQLAKSDDCFESFYDLGPSYISLDTVQGAEEAQLFFPPTYDIPEDII
    MEIKKKPKKKTKSKFVAVVEAHEEKLLQGDIKEENDLEEQASEDNADGRQLTEEKATEMEEEEEEEGDEGGEDIVDKATS
    PMDDAKEEDVNE

    >gi|91090266|ref|XP_970337.1| PREDICTED: similar to selenoprotein M [Tribolium castaneum]
    MKICASLLVSCVAFLALASAEAANDSKIARARVESCPSCKLNRLPEVKAFIYEDLPKYDNTEFKKIQGAPPVLLFLNDAD
    EIVEQHSLEKFSRQECNNLLKSKGFNIKNKEL

    >gi|189233829|ref|XP_972053.2| PREDICTED: similar to protein disulfide-isomerase A6 [Tribolium castaneum]
    MNRLLVFPVLTLVLASALALYPSSSNVIDLTTSNFDKVLKGDEVWIVEFFAPWCGHCQALVPEYTKAAAALKGVVKVGAV
    NADEYKELGGRYGVRGFPTIKIFGANKDKPEDYNGARTAQGLVDAALQAVKSKVKASLGGGSSGSGQVRVSHDTKDVIEL
    TDSNFDKQVLHSEDMWLVEFFAPW
    CGHCKNLAPHWAKAATELKGKVKLGALDATVHQAQASKYGVQGYPTIKFFAPGKKT
    SDSVSDYDGGRTASDIVTWALEKLAENVPAPEVAQIIDQNMFKEACDQKSLCVVALLPHILDCQSDCRNNYINILKELGE
    KYKKKMWGWVWSEAGAQLELENALDIGGFGYPAMAVINPRKMKYSILRGSFSRDGINEFLRDLSYGRGNTSPVKGDKLPK
    IVSIEPWDGKDGELPPEEDIDLSDVDLDSKDEL

    >gi|189237056|ref|XP_966808.2| PREDICTED: similar to heat shock protein 67B2 [Tribolium castaneum]
    MSLSRGPQILSLVNKTPVFLRLFATQIASFDEVKSVKTTPKTLLIDVREPHELQETGVIPDSINIPLGEVEKVLKDMPSE
    QFQKTYKKAKPDSSTPLIFS
    CRSGKRSALASEIATKLGFKDIKNYSGGWLEWEEKSKNI

    >gi|189234306|ref|XP_971669.2| PREDICTED: similar to protein disulfide isomerase [Tribolium castaneum]
    MSSKLSVLVLFAVFVNVFSHDDDVHTVKYTTENFAQELPKKNHFVMFYAPWCGHCQRLGPTWEQLAEMLNEDDSNIRIAK
    VDCTTDSSLCSEHDVTGYPTLKFFKVGASEGIKFRGTRDLPTLTTFINEQLREVHNREEDAEKKPPQPVSGLVELTEDTF
    EKFVATGKHFIKFYAPW
    CGHCQKLAPVWEQLAKSLEFDSSISIAKVDCTQWRLVCNQFEVKGYPTLLWIEDGKKVDKYQG
    DRTHEDLKNYVSKMMGSSEIPTETEKPQSEEGAVGILTGDTFKHGIETGITFVKFFAPW
    CGHCKRLAPTWDELGKKFVAD
    SNVNIAKVDCTLDLNKDLCNEQEVEGFPTIFLYKNGDKISEYSGSRTLEDLYEFVKQHVGHDEL

    >gi|91092234|ref|XP_970881.1| PREDICTED: similar to thiol peroxiredoxin [Tribolium castaneum]
    MPTLSLQKPAPFFKGTAVVDGLFKEISLNDYKGQYLVLFFYPLDFTFVCPTEIIAFSDRAPDFKKIKTAVVGVSTDSHFC
    HLAWINTPRKQGGLGPMNIPLLSDKSGKIARDYMVLDEETGVPFRGLFIIDGNGVLRQMTINDLPVGRSVEETLRLVQAF
    KFTDEHGEVCPAGWTPGKKTMKPEVNASKDFFEEVN

    >gi|91077728|ref|XP_975084.1| PREDICTED: similar to molybdopterin biosynthesis moeb protein [Tribolium castaneum]
    MSNLEIKTLEAEIAALERTLDEKKFRLQQLKSEHVSCPYSDVLSSEEIVRYSRQIIMPQICKSGQIKLKESKILIVGAGG
    LGCPASLYLAAAGVGEIHIVDYDEVELSNLHRQILHYEHDIGLPKVQSASEKLKRLNSNIKIVPLHIHAFSSITDFVQKN
    KYDAVLDCTDNAPTRYLLNDICVIHNIPLVSGSALQMEGQLTVYHYNNGPCYRCLFPKPPPAHTVTN
    CGDGGVLGSVCGV
    IGVLQALETVKILTQMEGVLSGRLLIFDGSETTFRNVKLRQRVTTCEVCGDNPKIKEPVDYEQFCGARAHDKVVNINILE
    SEENVTVEQLRGVLDGNNIVIDVRSELEFDMCRLPNTVNLPYAKIRDNKSLGELEGLVKRAREGNKNVYLLCRRGNDSQR
    ATSYLRQNFSNTSVRFWNVKGGLHAYSKSIDPTFPVY

    >gi|91084205|ref|XP_967987.1| PREDICTED: similar to thioredoxin-like protein [Tribolium castaneum]
    MVTHINDKADLVSKLTDAGDQLVVIDFFATWCGPCKMISPKLEELAQEFQNVHIFKVDVDECEDIAMEYNISSMPTFVFV
    KNSQTITQFSGANYEKLRQLVVENK

    >gi|91092308|ref|XP_969731.1| PREDICTED: similar to ubiquitin-activating enzyme E1 [Tribolium castaneum]
    MSTQSANPREPTSHVNSISKSKILVVGAGGIGCEILKNLCVSGFQDIEVIDLDTIDVSNLNRQFLFRKEHVGKSKAVVAR
    ESIISFNSNVNIKAYHDSIFNQEYGVNFFKRFDLVLNALDNRAARNHVNRMCLAADIPLIESGTAGYSGQVELIKKGMTQ
    CYECQPKPQQKSYPG
    CTIRNTPSEPVHCIVWAKHLFNQLFGEEDPDQDVSPDTEDPEVKKDGAFSVTESGDVKRKSTRQW
    AQEVDYNPEQLFNKFFKDDINYLLSMENLWKTRKPPVPISWEKALTCESRISNDEESSKSLDMQVLSISKYTQIFASTVN
    ILKKELAGKKFLMWDKDDTPAMDFVTACANIRAFIFSISQKSKFEIKSIAGNIIPAIATANALIAGAAVLYALRVLQNDY
    EKCPTIYLRQKSIYSKVLLATDKSLQKPNPNCYVCSAKPVVNVFVNVNKMLVKEFETEVLKNTLNMVAPDAILDGKGVVV
    ISSEEGETEINNKKTLCEVGIVDGSILKVDDFLQNYELIINVNQYEAKEKDDPPFKFIANPAELKAKQIDGVKNGVTAAK
    NDLPNQEMHTDNDDVVICTTDNDDFGASSSKKRKLNPVEDDDDDLIILDEQLE

    >gi|91091706|ref|XP_972863.1| PREDICTED: similar to protein disulfide isomerase [Tribolium castaneum]
    MTITSKSVRNVKIPVMWPLLLLLLLQHIRPAHPSDAHVLSLSDTNFHRQLRLNPTLLVQFFIPWSGMCQKTRPHFARAAH
    ILSTNQIPVTLAKIDCSGRGRTTCTQKNITYPFPVFHFYRNGSFVKEYTGSRDARSIVKFMRVQVVPNPVELVDFEHFRQ
    FIEGQDDVIVVGFFEEETKLRRIFFRVAEEMKESMIFAYSSCEKVILKQGVSNGIVVFRPKSLHNQYEPERVLFTGRSII
    GEIKNFITRNYHGLIGHRTPNNRHDFPNPLVIVYHTIDYHSGGTELNYWRYRLIKIAHKYQNFVKIATSATDDFEDEISD
    LRTDNLTPTNPLVVAFDLENQKYVMVEPFTTSTFDNFVQNFINRKLTPYYRSKPIPKENDGPVIIAVTQNFNHTVTNNGK
    DTLLDLYTPWSLK
    CQKFVPVLREVAELLEHEDVAFVRMDAVENQVPEVFNEKGIPNIFWLAKNRKRGPVVYEGERSAEEV
    VKFVAKKATKELKNYDRKGNPKDDRDEL

    >gi|189237096|ref|XP_970660.2| PREDICTED: similar to 1-Cys peroxiredoxin [Tribolium castaneum]
    MVNLGDVFPNFSADTTVGPIKFHDWLGDSWGILFSHPADFTPVCTTELARVVQLYPEFAKRGVKVIALSCDSVETHKKWL
    NDIKMYAGYSMEGFPYPLIADEDRKLATTLQMIDQDEKDSQGIPLTARAVFIIDAKKRMRLSILYPATTGRNFDEILRVI
    DSLQLTDKHRVATPVDWKPQEHVMVQPTVSDEEVKTLFPQLTIVALPSGKNYIRRTPQP

    >gi|91094331|ref|XP_966352.1| PREDICTED: similar to ubiquitin-activating enzyme E1 [Tribolium castaneum]
    MSSAEIAEGSVDPPTKKRKLDSCPISTDMANNGASGSSQQDIDEGLYSRQLYVLGHDAMRRMASSDVLVSGLGGLGVEVA
    KNVILGGVKSVTLHDEAVCSVADLSSQFYFTEADVGKNRAEVCCKQLAELNTYVPTKAYTGPLTPDFIRKFRVVVLTNSC
    LAEQMQISEITHASNIALIVADTRGLFAQVFCDFGDAFTVVDTNGESPVSAMIADISTDKEGIVTCIDDTRHGMEDGDHV
    TFSEVQGMTELNNCKPIKIKVLGPYTFSIGDTTNFSKYERGGIATQVKMPKTLSFKSLKDSLKSPEFLMTDFAKFDHPQQ
    LHVAFQALHKYVEKHGRVPKPWNNEDASEFLSIAKSLAVDGGNDTEVNTNLLETFAKVCAGDLNPINATIGGIVAQEVMK
    ACSGKFHPIYQWLYFDAIECLPTEAGEITEESAAPKGTRYDGQIAVFGSEFQKKLGGLKYFVVGAGAIGCELLKNFAMMG
    IGGEGGQITVTDMDLIEKSNLNRQFLFRPHDVQRPKSGTAAKVIKKMNPSINIVAHENRVGPESENMYDDTFFESLDGVA
    NALDNVDARIYMDRRCVYYRKPLLESGTLGTKGNTQVVVPFLTESYSSSQDPPEKSIPI
    CTLKNFPNAIEHTLQWARDNF
    EGLFRQSAENASQYLTDPEFLERTIKLPGVQPIEVLESVKAALVDDRPKSFEDCVVWARHHWEEQYSNQIKQLLFNFPPD
    QKTSTGQLFWSGPKRCPEPLTFDVNNTLHLDYVFAAANLKAEVYGIPQNRDRAYIAEVVQKIHVPEFVPKSGVKIAVTDS
    QMAMTNGSSVDLDRVGQIREELPSVAELGNLCLTPLDFEKDDDTNLHMDFIVAASNLRAANYKIPPADRHKSKLIAGKII
    PAIATTTSVVAGLVCLELYKLTRSLKSLTPFKNGFVNLALPFFGFSEPIAAPKNEYCGKEWTLWDRFEVDGEMTLSEFLE
    YFKEKHGLEITMLSQGVCMLYSFFMAKAKAQERLGLPMSEIVKRVSKKKLEPHVKALVFELCCNDADGNDVEVPYVKYNL
    P

    >gi|91087259|ref|XP_975531.1| PREDICTED: similar to 16 kDa thioredoxion [Tribolium castaneum]
    MSSNCQIMDLLQGKQLVNKIKKLIPAEEAMKNKTIIIFFFGAMWCKSADCKVILQRLKELHKENLRRNMGIEVIYVSSDT
    TLDDFDAFYKTQGGWFAVPYQDDLAEQLRRIFGITTIPNLIVVKKNGEIITKAGRQEIVEKGLNVLVTWTD