Taeniopygia guttata

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|224170700|ref|XP_002197834.1| PREDICTED: similar to glutathione peroxidase 7, partial [Taeniopygia guttata]
    VSLVVNVASECGYTDSHYKALQQLQRDLGPYHFNVLAFPCNQFGQQEPDTNKEIESFARKTYGASFPMFSKITVSGAGAI
    PAFKYLIDSTGEEPTWNFWKYLVDPNGKVVKAWDSTVSVEEIRPHVTELVRKIILKKKDEL

    >gi|224054645|ref|XP_002189868.1| PREDICTED: similar to protein disulfide isomerase family A, member 5 [Taeniopygia guttata]
    MSASLDVAVSPAHLQIYKPRSPQYRGVPSSQPSEVKYTVHHRAHSGELSGKGKAFLPAFVYSLKVSPLIEKITDHKDFKK
    LLRTRNNVLVLYSKSATAAESSLRLLSSVAQEVKGRGTISWIDCGDTESRKLCKKMKVDPNSKEKGVDLLHYKDGAFHTA
    YNRAVTLKSMVAFLKDPEGAPLWEEDPEAKDIVHVDSEKELRRLLKKEDKPLLMMFYAPW
    CGVCKRMMPSYQQAATELKG
    KYVLAGMNVYSAEFERIKEEFNVRGYPTICYFEKGKFLFNFENFGATAADIAEWLKHPQAPQPQAPETPWADEENVVYHL
    TDEDFDKFIKDHSSVLVMFHAPW
    CGHCKKMKPEYEKAAEFLHVTSDSPGVLAAVDATVNKALAERYHISGFPTLKYFKDG
    EEKYTLPHLRTKKKIIDWLQNPEAPPPPEPAWEEKQTSVIHLAGEDFRESLKKKKHTLVMFYAPW
    CPHCKNAIPHFTTAA
    EVFKEDRKIAYAAVDCAKGQNHDLCKQEGVDGYPTFNYYNYGKFVEKYTGDRGESGFTTFMRTLRERDHERVGKKKDEL

    >gi|224048875|ref|XP_002189758.1| PREDICTED: similar to CLIC5 [Taeniopygia guttata]
    MEDPVFTHINQNAKDTTVSEVSDSEENKGGAFFHHVREDSASPFSIINTPENMDGSKENSEDSCNNSVASQHGSDGEDDS
    SSHHGAEEDYPQQQMHLMSPALEDKDIEGTMFESNLHFPPDFQFRQRQSTFTNSSTSLKFPLNNKGETNNFQEDLEISIF
    VKAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEEILAPP
    KYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQDNATLERGLVKALKKLDDYLRTPLPEEIDADSTEEEKVSKRKFLDGD
    ELTLADCNLLPKLHVVKIVAKKYRNFEFPAEMTGLWRYLKNAYTRDEFTNTCAADKEIEQAYADVAKRLSKS

    >gi|224048385|ref|XP_002194321.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
    MDLSGAGGGELDGSGQPGVAAFGGAAAPRAGPAAALTGGASLPGPICRSLCAAAAPDLSYQELKDLKKANVLHIDVRERW
    EIDRFGKIPESINIPLGELMEALQMDPTEFKEQYNQKMPSKSDPVVFS
    CLAGTRSKQALGFAMSLGFSRVQQYAGGFDDW
    VKHEPPEKK

    >gi|224058052|ref|XP_002194628.1| PREDICTED: putative peroxiredoxin 1 variant 3 isoform 1 [Taeniopygia guttata]
    MSSGKAFIGKPAPDFTATAVMPDGQFKDIKLSDYRGKYVVFFFYPLDFTFVCPTEIIAYSDRADEFKKINCEVIGASVDS
    HFCHLAWINTPKKQGGLGTMKIPLISDTKRAIAKDYGVLKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFAKQK

    >gi|224088699|ref|XP_002191279.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
    MAGPAPPVTQQVGRARGCGRRPELQRLREAARCPVLDADGRSVPFQALFAEQKAIVLFVRNFLCYTCKEYVEDLAKVPKA
    FLQESNVRLIVIGQSSYHHIKPFCSLTGYTHEMYVDPPREIYKILGMKRGEGNKASVRSPHVKSNTFLGSIRSIWRAMTG
    PAFDFQGDPAQQGGALIIGPGNEVHFLHLDKNRLDHVPINTVLQLAGVKTVNFSNKPQIIDI

    >gi|224058058|ref|XP_002194671.1| PREDICTED: putative peroxiredoxin 1 variant 3 isoform 2 [Taeniopygia guttata]
    MSSGKAFIGKPAPDFTATAVMPDGQFKDIKLSDYRGKYVVFFFYPLDFTFVCPTEIIAYSDRADEFKKINCEVIGASVDS
    HFCHLAWINTPKKQGGLGTMKIPLISDTKRAIAKDYGVLKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFAKQK

    >gi|224059036|ref|XP_002192126.1| PREDICTED: similar to putative peroxiredoxin 6, partial [Taeniopygia guttata]
    WGILFSHPRDFTPVCTTELGRAAQLAPEFSKRNVKMIALSIDSVQDHLSWCKDVNAYNGEQPARSCPSHHC

    >gi|224043348|ref|XP_002195146.1| PREDICTED: similar to ATP7B [Taeniopygia guttata]
    MERKLDNKMKRELSCLATLNDRNISLVSIRKQQAACDVPELLIIGEKSKTASPVKASSNLQKEEKVLRSYSTGMTEVNTD
    ERQALSNIDSPPGCELKPTMKHKFAFDNMGYEESSENMSSPPSQEHTVVVNIVGMTCQSCVQSIEGRICKVKGILRIKVS
    LEQNNAVIKYLQLEISPEQICQEILDMGFDANIAEEKLTTATVNLPSLKEAVAKLRVEGMT
    CQSCVTNIEGKIRKLHGVA
    KIKVSLDNQEAIIAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANPRETSASLESDGLDLLVPEMG
    STATVTAQIEGMHCKSCVRNIEGNISDLPGIKCIKVSLENKCAVVQYSPDLITLSALQQAIESLPPGNFKVSLLSGSEAN
    KAASCSGAFTYNVIRQPPQGTTHMAVIKIDGMTCNSCVKSIEGAISQRQGVQHVAVSLAGSTGTIHYDPAVTSGEELRAA
    IEDMGFDASVLTDTATGEKRCQPDASKAAVQPQAPEPPRQGNASEALPDSPHPEGSNQLSGAREEKCVLQITGMT
    CASCV
    STIERNLQKEDGIVSVLVALMAGKAEIKYKPKLIQPLEIAQLIQNLGFEATIMENNAETEGQVELLITGMT
    CASCVHNIE
    SKLMRTNGIFSASVALATSKAHIQFDPEIIGPRDIIKVIKEIGFHASVAKRAPNAHNLSHKKEIQQWRKSFLFSLVFGIP
    VVVLMIYMQIPNGEDHGSKVLEQNLIPGLSILNLLFFILCTFVQFLGGWYFYVQAYKSLRHKTANMDVLIVLATTIAYLY
    SCIILIVAIIEKAEKSPVTFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLMSLQATEATVVTLGPGHSIVREEQVPVE
    LVQRGDIIKVVPGGKFPVDGKVIEGNSMADESLITGEPMPVIKKPGSTVIAGSINAHGSLLVNATHVGNDTTLAQIVKLV
    EEAQMSKAPIQQLADKFSGYFVPFIIIISTVTLIVWITIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIAC
    PCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITYGVPKVMRVLLMGDTAVLPLKKVLAVVGTA
    EASSEHPLGMAVTKYCKEELGTERLGYCTDFQAVPGCGISCKVGGVEAILGIAEEGPNEPDANRSGVSSAPLEGPSASQK
    YSVLIGNREWMRRNGLNIANDVNDAMTNHEMKGQTAILVAIDGVLCGMIAIADTVKQEAALAVHTLQSMGIDVVLITGDN
    RKTAKAIATQVGIKKVFAEVLPSHKVAKVQELQNGKKKVAMVGDGVNDSPALARADVGIAIGTGTDVAIEAADVVLIRND
    LLDVVASIHLSKRTVRRIRINLILALIYNLLGIPIAAGVFMPVGLVLQPWMGSAAMAASSVSVLLSSLQLKCYKKPDTES
    YEAQAQGRMKPLTPSQISVHIGMDDRRRDSSKPSPWDQTSQVSLSSLASDRLPRRNGFIQEEGGKWSLLINGADEEQYI

    >gi|224052779|ref|XP_002197460.1| PREDICTED: glutathione S-transferase omega 1 [Taeniopygia guttata]
    MSGDHSRSLGKGSAAPGPVPAGLIRLYSMRFCPFAQRTRLVLRAKGISHEVININLKNKPDWYFEKNPSGLVPVLETSKG
    QLIWESPITCEYLDEAFPGKKLMPSDPYERACQKMLLEDFSKITPLLFKHVLAVKDEQDTTALKAEIAEKFGKLEEVLSK
    RNTVFYGGDSVSMVDYMIWPWFERLEPFQLKDSLNHTPKLQRWMEAMKEDPAIKATITDPQTYKNYLQLYLKNSPEACDY
    GL

    >gi|224111334|ref|XP_002198448.1| PREDICTED: similar to ATP7B, partial [Taeniopygia guttata]
    MERKLDNKMKRELSCLATLNDRNISLVSIRKQQAACDVPELLIIGEKSKTASPVKASSNLQKEEKVLRSYSTGMTEVNTD
    ERQALSNIDSPPGCELKPTMKHKFAFDNMGYEESSENMSSPPSQEHTVVVNIVGMTCQSCVQSIEGRICKVKGILRIKVS
    LEQNNAVIKYLQLEISPEQICQEILDMGFDANIAEEKLTTATVNLPSLKEAVAKLRVEGMT
    CQSCVTNIEGKIRKLHGVA
    KIKVSLDNQEAIIAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANPRETSASLESDGLDLLVPEMG
    STATVTAQIEGMHCKSCVRNIEGNISDLPGIKCIKVSLENKCAVVQYSPDLITLSALQQAIESLPPGNFKVSLLSGSEAN
    KAASRSGAFTYNVIRQPRQGTTHTTIIKIDGMTCNSCVKSIEGAISQRQGVQHVAVSLAGSTGTIHYDPAVTSGEELRAA
    IEDMGFYASVLTDTATGEKRCQPDTSKAAVQPQALEPPRQGNASDALPDSPHPDGSNQLSGAREEKCVLQITGMT
    CASCV
    STIERNLQKEDGIVSVLVALMAGKAEIKYKPELIQPLEIAQLIQNLGFEATIMENNAETEGQVELLITGMT
    CASCVHNIE
    SKLMRTNGIFSASVALATSKAHIQFDPEIIGPRDIIKVIKFLGGWYFYVQAYKSLRHKTANMDVLIVLATTIAYLYSCII
    LIVAIIEKAEKSPVTFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLMSLQATEATVVTLGPGHSIVREEQVPVELVQR
    GDIIKVVPGGKFPVDGKVIEGNSMADESLIT

    >gi|224098384|ref|XP_002196019.1| PREDICTED: magnesium transporter 1 [Taeniopygia guttata]
    MAALPVPLLLVLLLAGCGGPGAAGQRRKEMVLSEKVNQLMEWASKRSVIRMNGDKFRRLVKAPPRNYSVIVMFTALQPHR
    Q
    CVVCKQADEEYQILANSWRYSSAFTNKIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFAAEQ
    LARWVADRTDVHIRVIRPPNYAGPLMLGLLLAVIGGLVYLRGSNLDFLYNKTGWAFAALCFVLAMTSGQMWNHIRGPPYA
    HKNPHTGQVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLHEAATSDMDVGKRKIMCIAGIGLVVLFFSWLLSVFRSKY
    HGYPYSLLVGLEFQGWFLQRLRVILVIPMEKEARRELPEPVVDEAERRQPTSGRESALREAPCQAGNKELSLCAFGFVRV
    PGAMRPAVRHPQAAAGLRRRRSREGFA

    >gi|224098388|ref|XP_002196068.1| PREDICTED: ATPase, Cu++ transporting, alpha polypeptide [Taeniopygia guttata]
    MEAKSVAIGVEGMTCSSCVQSIEQHLGKMNGIHNIKVSLEDKNALIIYDSKLQTPATLQEAICDMGFDATLADSNPQPVL
    PDTIFLTLPAQSALTPRQICATLLSNKGILDVKVSSDQRTAVVTFIPSITNGRHITQMVPGADLSISVPEVTPGTWEDSS
    WSQVSSAVLRLKVDGMTCHSCTSTIEGKLGKLQGVQRIRVSLDNKEAVVVYQPPLITPEEIKQQIEAAGFTAAFKKQPRP
    LKLSGIDLERLRNAQPRSSEASQGENSSGTGTRTVVFRVEGMHCNSCVLNIQSTVSALPAVSSVVVSLENKSAAINYNPS
    LISLEKLRKAVENVSPERFRVSLPEEHESLALFPTLASPLKSHPPSKDPSQPLSQVVVINIEGMTCSSCVQSIEGVLSQK
    AGVKSVHVSLPNGTGTIEYDPLQTNPEDLRSSIEDMGFDASFPAKAELPMAKAQPCPEAQLDSHKPEQPSKVAPAHLGRQ
    ESKTISKCYVQVTGMT
    CASCVANIERNLRREDGIHSILVALMAGKAEVRYNPAVIHPAAIAELIRELGFGATVMENCGEG
    DGILELIVRGMT
    CASCVHKIESTLMKTSGVLYCSVALATNKAHIKYDPEAIGPRDVIQVIKDLGFTTSLVKKDRSASHLD
    HKQEIRQWKRSFVVSLVFCIPVMGLMIYMMVMDSQLSHAHAHHNMSSEEMEALHSSMVLEYQLLPGLSVMNFLSFLLCVP
    VQVFGGWHFYIQASRALRHNTANMDVLVVLATSIAFLYSFIILLVAMAERAKVNPVTFFDTPPMLFVFISLGRWLEHVAK
    GKTSEALARLISLQATEATIVTLGPDNVLLSEEQVDVELVQRGDIVKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVT
    KKPGSTVIAGSINQNGSLLISATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVAVSVVTLFAWIIIGFV
    DFEIVEKYFLGYNKSISAAEVIVRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHRVKVVV
    FDKTGTITHGTPEVMQVKFLVEGNLLPRHKMLAIVGTAESSSEHPLGAAITKYCKKELNSETLGTCTDFQVVPGCGISCK
    VTNIEALLYRKNRMVEENNVKNVTLVKIEENTDELVQPALIIDTELPTTVTSQKYSVLIGNREWMTRNGLLVRNEVDKAM
    MEHERRGRTAVLAAVDGVLCALIAIADTVKPEAELAVYTLKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKV
    AKVKQLQDEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRDDLMDVVASIDLSRKTVKRIRINFVFAL
    IYNLIGVPIAAGVFLPIGLVLQPWMGSAAMAASSVSVVLSSLLLKMYQKPSSEKLEFRARGQLRHKSPSEISVHVGIDES
    GAGSPKLSLMDRIITYSRASINSLFSDKRSVNSIVLTEPDKHSLLVGDFGEDDDTAL

    >gi|224075270|ref|XP_002191427.1| PREDICTED: spermatogenesis associated 20 [Taeniopygia guttata]
    MAAAAGARATINCTEQPSVRLRVPRATRGCAERAGRCRGGGPAGRGRPSGAPYASPAFPDILPIAIFIPLYTFLTGIAAI
    STVGTPGPPRHTNRLINEKSPYLLQHAHNPVDWYPWGQEAFDKAKTENKLIFLSVGYST
    CHWCHVMEEESFKSKEIGDIM
    NEHFVCIKVDREERPDVDKVYMTFVQATSGGGGWPMSVWLTPDLKPFAGGTYFPPEDGVNHVGFRTVLLRIAEQWKENKD
    ALLGSSQRILEALRHTSEIRVQGQASPPPAKEVMDTCFQQLSRSYDEEYGGFSKCPKFPSPVNLNFLFTYWALHQTTPEG
    ARALQMALHTLKMMALGGIHDHIGQGFHRYSIDQHWHVPHFEKMLYDQGQLAAIYSKAFQISGDEFFADVVRDILLYVSR
    DLSDQAGGFYSAQDADSYPTTTSREKREGAFCVWAAKELRALLPDPVEGATEGTTLADVFMHHYGVKEAGNVDPARDPYQ
    ELKGKNVLIVRCAPELTAAKFGLEPGRLSTLLQECQQRLSSARAQRPQPHLDTKMLAAWNGLMISGFAQAGAALSEQGYV
    SRAAQAAAFLRTHLFDPDSGKLLRSCYQGMHNSVEQGAVPIQGFLEDYVFVIQALFDLYEVSLEQGWLEWALHLQHMQDK
    LFWDPKGFAYFSTEASDPSLLLRLKDDQDGAEPAPNSVAMEEAGKINTTLSERVPMITVVVPEMLRTTAVFHHTLKQVVI
    CGDPQGEDTKEMLHCVRSVFSPNKVLMVADGDNAGFLYRQLPFLASLERKDGKATAYVCSNFTCSLPVTSVQELRGMLSP


    >gi|224051968|ref|XP_002200453.1| PREDICTED: ERO1-like (S. cerevisiae) [Taeniopygia guttata]
    MPDASGVPARLPRGAERRCICQVTGYLDDCTCDVETIDAFNNYKLFPRLNELLQSDYFRYYKVNLQKPCPFWEDNSHCGM
    RD
    CAVQPCSSDEVPDGIRAGSYKYSEEANNLAEQCEEAKRLGAVDDSLSKETRQAVLQWAQHDDSSDSFCEADDIHSPDA
    EYVDLLLNPERYTGYKGPDAWKIWNSIYEENCFKPQNVKRPLASGRGDDGGHMFYKWLKGVCVEKRAFYRLISGLHGSIN
    IHLSARYLLQDSWSEKKWGPNVTEFQQRFDEVLTGGEGPRRLKNLYFLYLIELRALSKVLPFFERPSFQLYTGNQSQDAE
    MKHLLLEILHLAKSFPLHFDENSFFAGNKEEAAKLKEEFRLHFKNISKIMDCVGCFKCRLWGKLQTQGLGTALKILFSEN
    LIEKIPESGPSYGFQLTRQEIVALFNAFGRVSTSVKELENFRNILQNMR

    >gi|224047438|ref|XP_002196598.1| PREDICTED: similar to Txndc13-prov protein [Taeniopygia guttata]
    MAPGRWRHGRRFLRVVLLVALMGPAACFSSSFYSPGEPRSSVRVLCGSNWSLVLQGQWMLEFYAPWCPACQQIEATWESF
    AKESERLGITVGKVDVTQEPGLSGRFFVTTLPTIYHANDGVFRRYRGSRTLEDLQGYILERKWEAVEPVAGWKSPSSIMM
    HGMAGLFHFSGWIRQIHNYLTGTLGVHVWISYAIFILATLLIGLLLGLVLVLISDCLCPAKSKHRAETPEEAITKENAEN
    AALEEPEEVAELSADDAEEAADVKDLSDGEDAANSSADESEEDLALGKESGGEEMEDLSEQPLAESETESTVRQRKSQGS
    EKEL

    >gi|224051983|ref|XP_002200462.1| PREDICTED: similar to thioredoxin domain containing 1 [Taeniopygia guttata]
    MAALPSLRAPLRAPLCALLCLTLAAATHGKPSPVKVLSDGMWRELLQDEWMVEFYAPWCPACENLQPEWPAVVFWGVITF
    LSFFFPIKILKKPFLTGLSGRFIITALPTIYHCKDGEFRRYQGARTKAAFINFISDQEWKSIEPVSSWFGPSSFLMSSMS
    ALFKLSMWIRHGHGYLTENLGIPVWGSYAVFGLATLFLGMVLGLMMVFLADCICPSKRHRPPQLQPQSRKQGPEPAHLLK
    NTYEEQEADEGDISDDEAEGSRRDSSPGGMAPAEPEAAPARR

    >gi|224088740|ref|XP_002194930.1| PREDICTED: zinc finger, CCHC domain containing 6 [Taeniopygia guttata]
    MASSVVRATVRAVSKRRIQATRAALTLTPSAVQKIKELLKDKPDHVGVKVGVRTRGCNGLSYTLEYTKSKGDSDEEVVQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

    >gi|224051491|ref|XP_002200566.1| PREDICTED: putative HESB like domain containing 1 [Taeniopygia guttata]
    MAAGRGWAGMAAPAALRWSWRLAQGGRTSRCSASPCPGPALPRPPARPAGSLLRWASSFSEPGPTESGPSEGQIFLSESC
    VKRLLEIADGSEFLRLQVEGGG
    CSGFQYKFSLDTVINPDDRVFEQGGARVVVDVDSLAFVKGSMVDFSQELIRSSFQVVS
    NPQAEKGCSCGTSFSVKF

    >gi|224146749|ref|XP_002198727.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10, partial [Taeniopygia guttata]
    KKILYDIVAFAKESVNSHVITLGPQNFPDKDKEPWLVDFFAPWCPPCRALLPELRKASKHLYGQLKFGTLDCTVHEGLCN
    MHNIRAYPTTVVFNQSDVHEYEGHHSAEQILEFIEDLRNPSVVSLTPETFAELVQRRKREEIWMVDFYAPW
    CGPCQALMP
    EWKKMARVNDIQTLLCFCSSSGKLLRWDNHFLKRIVI

    >gi|224052833|ref|XP_002198291.1| PREDICTED: NHL repeat containing 2 [Taeniopygia guttata]
    MAAGGLAGLLPAQTQLEYALLDADTAQEKENLVYQYVKKMDSRERDLAVPELGGDLQWLNTEGPISLHKDLCGKVVVLDF
    FTYC
    CINCLHLLPDLHALEHQYSDKDGLVIVGVHSAKFPNEKVLDNIKSAVLRYNIVHPVVNDADATLWHELEVSCWPTL
    VILGPRGNMLFSLVGEGHREKLFLFTSITLKFYKERGQIKDNNIGIKLYKDSLPPSPLLFPGKVAVDDSGGRLVIADTGH
    HRILVTRKNGQILHTIGGPNSGRRDGRFSEAAFNSPQGIAIKNNVIYVADTENHLIRKIDLELQMVTTVAGIGVQGVDKE
    GGAKGEEQPISSPWDVVFGSSISGTQEDDVLWIAMAGIHQIWALMLEGGKLPKGSDLKKGVCLRFAGSGNEENRNNAYPH
    KAGFAQPSGLSLAPEEPWSCLFVADSESSTVRTISLKDGAVKHLVGGERDPLNLFAFGDVDGAGINAKLQHPLGVTWDKK
    RQLLYVADSYNHKIKVVDPKMKNCATLAGTGEAGNVVGSSFTQSAFNEPGGLCVEENGRLMYVADTNNHQIKVLDLETKI
    LSMLPILKPDACDVPDNLPVQKDKITNLPRLPKSAPNVKLPSLTVAPGQTIQFLLKLNLPLDSKLNEEAPSAWFITAEDN
    NTWLLQGQCLTGEIKDISSQTVIPFQLPGSCVSAEATLAIKACLYYCSKGSSACMMAGVSFSQPLQVTGTDQGSSAQVEL
    IHTFVTN

    >gi|224167854|ref|XP_002200264.1| PREDICTED: hypothetical protein, partial [Taeniopygia guttata]
    DVAVAEEKEPRPDCPLDSEQLGRSTWAFLHTMAAYYPDRPSRAQQKEMKDFIHLFSKFYPCEHCAEDLRERLQTNQPDTS
    SRSNFSQWLCQLHNEVNRKLGKLEFDCSRVDERWRDGWKDGSCD

    >gi|224048941|ref|XP_002188026.1| PREDICTED: similar to methionine sulfoxide reductase A isoform 1 [Taeniopygia guttata]
    MSPRHRLHLLLFLRTLHGSAFGMGDQASRLPQAGEALPGRTQRMAVPDKHHVNGNRMVEPFPEGTQMALFGMGCFWGAER
    KFWRQKGVYSTQVGYAGGHTPNPTYKEVCSGRTGHTEAVRVVFEPQNISFEQLLKVFWENHDPTQGMRQGNDVGTQYRSA
    IYTFSQEQMEAALRSKEEYQKVLTEEGFGPITTEIREAPEFYYAEEYHQQYLSKNPGGYCGLGGTGVSCPMGVRK

    >gi|224048943|ref|XP_002188066.1| PREDICTED: similar to methionine sulfoxide reductase A isoform 2 [Taeniopygia guttata]
    MGDQASRLPQAGEALPGRTQRMAVPDKHHVNGNRMVEPFPEGTQMALFGMGCFWGAERKFWRQKGVYSTQVGYAGGHTPN
    PTYKEVCSGRTGHTEAVRVVFEPQNISFEQLLKVFWENHDPTQGMRQGNDVGTQYRSAIYTFSQEQMEAALRSKEEYQKV
    LTEEGFGPITTEIREAPEFYYAEEYHQQYLSKNPGGYCGLGGTGVSCPMGVRK

    >gi|224055212|ref|XP_002197365.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 [Taeniopygia guttata]
    MEFLASKGDCTRYFKRSLLLVLVCLIVLVCTDQDYYSLLGVSKEASSREIRQAFKKLALKLHPDKNQNDPNAHENFLKIN
    RAYEVLKDEDLRKKYDKYGEKGLEDQQQGGRYESWHFYRYDFGIYDDDPEILTLDRGEFDAAVNSGELWFVNFYSPR
    CSH
    CHDLAPTWREFAKELDGVIRIGAVNCGDNRMLCRIKGINSYPSLYVFKTGMQPVKYYGDRSKESLKNFAMQYVTSRVTEL
    WAGNFVNAIETSFASGIGWLITFCAERGDCLSYHTRLKLAGMLEGLVNVGWMDCGTQGELCDNLDVSSSTTAYFPPGATI
    NNKEKGGVLFLNSLDAREIYQEVMQHLPDFEIISATSLEDRLAHHRWLLFFQFGEGDKSNVQEFKKLKFLLKDEHIQVGK
    FDCLSSPTICNKLYVYQPCLAVFKGKGTGDYEIHHGKKILYDIVAFAKESVNSHVITLGPQNFPDKDKEPWLVDFFAPW
    C
    PPCRALLPELRKASKHLYGQLKFGTLDCTVHEGLCNMHNIRAYPTTVVFNQSDVHEYEGHHSAEQILEFIEDLRNPSVVS
    LTPETFAELVQRRKREEIWMVDFYAPW
    CGPCQALMPEWKKMARMLNGLISVGSVDCQKYYSFCHQESVRGYPEIRLFPQK
    SNTAYQYYSYNGWHRDAYSLRGWALGYLPQVSVDLTPHSFTEKVLNGKDHWVIDFYAPW
    CGPCQNFAPEFEMLARAVKGK
    VKAGKVDCQAYGQTCQTADIRAYPTVKFYPYQGTKKSVLGEYIDSRDAKGIADLLNEKLEAMENKGKRKKSRSKDEL

    >gi|224086731|ref|XP_002195871.1| PREDICTED: methyltransferase like 2B [Taeniopygia guttata]
    MTPVYPSSLPPDARGHGYLQDQAHDHKEQLLDNVEWSEEQEASARSKVQENSSQLLPQDKQEEYEVNAKKYWDDFYKIHE
    NGFFKDRHWLFTEFPELAPNRNSSQNGDSVHGFSDTEKSKNEGLGSCKNGHCSLETRTESQLNLIKSPRGGHTEELAAQK
    DSELSQSDGHYPGSAASYRILEVGCGAGNTVFPILQTNNDPGLFVYCCDFSTTAVNLVQKNAEYDSSRCFVFVHDLCNEK
    SPFPMPEESLDIVILIFVLSAVLPEKMQCIVTRLSRLLKPGGMILLRDYGRYDLAQLRFKKGQ
    CLSDNFYVRGDGTRVYF
    FTQDELDHLFTTAGLEKIQNLVDRRLQVNRGKQMTMYRVWIQCKYCKPTTLQP

    >gi|224045955|ref|XP_002192792.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
    MRPAIFPLQPDPGCLLLLLVSWLFNPARSEITSLDSGNIDDILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEKYP
    DKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADYIRQQKSNPIREVQDLEEISSLDRSR
    RNIIGYFEQKDSDNYRTFERVANILHDDCVFLSAFGAISKAERFSGDNVIYKPPGENAPDMVYLGSLTNFDLIYAWTQDK
    CVPLVREITFENGEELTEEGLPFLILFHMKDDLESLEKFQQEVARQLIGEKGTINFLHADCDKFRHPLLHIQKTPADCPV
    IAIDSFRHMYVFPDFSDLSVPGKLKQFVLDLHSGKLHREFHHGPDPTDVAPGQPIQDLASSPPESSFQKLAPSEHRYTLL
    REKDEL

    >gi|224087533|ref|XP_002192272.1| PREDICTED: similar to interferon, gamma-inducible protein 30 [Taeniopygia guttata]
    MLHPNETRPPSTFYLMNFPVESRCPSLPHSAAAPVELSLYYESLCPACREFLVLKLFPTWLLLPEEMLNITLVPYGNAQE
    RNVSGKLDFQCQHGPEECLGNMMEACLMHEAKNFSTYFPVIFCLEAGSSVTKNLEACLQIYAPEVDSGRISACVQGDTGV
    ALMHHNAQVTEALHPPHQYVPWITVNGKHTDELQAQAEASLLGLVCQLYQGEKPEVCGGSKATKIPSGCRR

    >gi|224044985|ref|XP_002198243.1| PREDICTED: protein disulfide isomerase family A, member 4 [Taeniopygia guttata]
    MATENLLLWKLTMMMMNDDDSVVKEENGVLVLNDANFDTFTADKDTVLLEFYAPWCGHCKQFAPEYEKIAKTLKENDPPI
    PVAKIDATAATSLSSRFDVSGYPTIKILKKGQAVDYDGSRTEDAIVAKVREVSDPNWTPPPEATLVLTQDNFDEVVNDAD
    IILVEFYAPW
    CGHCKRLAPEYEKAAQELSKRTPPIPLAKVDATAETELAKKFDVTGYPTLKIFRKGKPYDYSGPREKYGI
    VDYMIEQAGPPSKQIQATKQVQEFLKDGDDVIIIGVFSGENDKTYQLYQEAANGLREDYKFHHTFSNEIGKLLKVSPGKL
    VVMQPEKFQSKHEPKMHVLNLKDSMDGSEIKEHVLKHALPLVGHRKPSNDAKRYSKRPLVVVYYSVDFGFDYRVATQYWR
    SKVLEVAKDFPEYVFAVSDEEDYSSEIKDLGLLESGEDVNAAILDEGGKKYAMEPEEFDSDVLRQFVVAFKKGKLKPIVK
    SQPVPKNNKGPVKVVVGKTFDSIVMDPKNDVLIEFYAPW
    CGHCKKLEPEYNELGKKYKNEKNLIIAKMDATANDVTNDHY
    KVEGFPTIYFAPKDKKNNPIKFEGGDRDLEHLSKFIEEHATTLSRTKEEL

    >gi|224045485|ref|XP_002198731.1| PREDICTED: ubiquitin-activating enzyme 5 [Taeniopygia guttata]
    MAEPARLERLERRVRELEEELARERRGRAAARARIDTMSAEVTDSNPYSRLMALKRMGIVKDYEKIRTFTVAVVGVGGVG
    SVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRDINPDVQFEIHNYNITTLDNFEHFMDRIS
    NGALEEGKPVDLVLSCVDNFEARMAINTACNELGQIWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAANIDEKTLK
    REGV
    CAASLPTTMGVVAGMLVQNVLNKYLLNFGTVSYYLGYNAMQDFFPTMSMKPNPQCSDHNCRKQQENYKKKEAARPK
    EEVIEKEEEIVHEDNDWGIELVSEISEDELKAASGPVPELPEGISVAYTIPDKEDNLITGERVAESEESLEELMAKMRNM


    >gi|224051548|ref|XP_002200574.1| PREDICTED: glutathione transferase zeta 1 (maleylacetoacetate isomerase) [Taeniopygia guttata]
    MSAAAAAKPILYSYFRSSCSWRVRIALALKGISYDLVPVNLIKDGGQQFSAEFKALNPMQQVPALKIDGITLSQSLAIIN
    YLEEVHPNPRLLPQDPKKRAQVRMIADHIASGIQPLQNLSVLKQMGEKKMEWAQNCITSGFQALEQILQHTAGRYCVGDE
    VSMADLCLVPQVANAERFKVDMGPYPTITRINKVLLELEAFKISHPSRQPDTPAELRA

    >gi|224042958|ref|XP_002193952.1| PREDICTED: phosducin-like 3 [Taeniopygia guttata]
    MGVNGISAAEDDHLNKRVLPEAQALAKYSDNKTVMNSSAFGSARQTPDDPNKDTEWNDILRKKGILPPKENLEEQERAKE
    EEQFAILQKSLVKTYEDMTLEELEENEDDFNEEDERAIEMYRCSSGYNASNFGTQPRPPVYADPNKDTEWNDILRKKGIL
    PPKENLEEQERAKEEEQFAILQKSLVKTYEDMTLEELEENEDEFNEEDERAIEMYRQQRLAEMKAAQIKNKFGEVLEISG
    KDYVQEVTKAGKDIWVVLHLYKQGIPL
    CALINQHMSGLAKKFRDVKFIKAISTTCIPNYPDKNLPTIFVYLEGDIKAQFI
    GPLVFGGMNLTRDELEWKISESGAIKTDLEENPRKQIQDQLMSSIRACVPARGESDSEDD

    >gi|224165443|ref|XP_002200368.1| PREDICTED: similar to quiescin Q6 sulfhydryl oxidase 1, partial [Taeniopygia guttata]
    YFPGRPCVQTYLQTLDAWLKNWTEPELPRTVLKEAMKNNRDASQPSVLPTNVTWVGCQGSERHFRGYPCGLWTIFHLLTV
    QAAQNGPDKELPLEVLSTMRCYVRHFFG
    CQECAEHFEAMAAKSMDGVASREEAVLWLWSHHNEVNARLAGKGGCHQG

    >gi|224042971|ref|XP_002196616.1| PREDICTED: thioredoxin domain containing 9 [Taeniopygia guttata]
    MAADTSVDILQKVLENEILQSTKVVEEHLDAEIQKLDQMDEDELERLKQRRLEALKKSQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKNVVCHFYRDTTFR
    CQIMDKHLTVLAKKHIETKFLKLNAEKSPFLCERLRIKVIPTLALIRDGKTQDYVVG
    FTDLGNTDDFTTETLEWRLGCADVINYSGNLMEPPFQSQKKYGTSFTKLDKKTIRGKIYDSDSDDD

    >gi|224058188|ref|XP_002193305.1| PREDICTED: similar to Thioredoxin domain containing 12 (endoplasmic reticulum) [Taeniopygia guttata]
    MSWNTGDFSVLSSLRPRARSLRSTNCCGGVFKRDASQGGVAVPGPCWGAAGAARGGRAGPGELRMGGDTCKSPTCGRVAG
    GAGRPGSGRCTSWPRRRAARAALRAEVERRLSRRDVVIVDAGNELRSIRYELYCAARQAGTARCLLHCAGGAGGPDEPPF
    EEPDPSCRWDRPLFTVSGEEPLPLGAIRAALFESAPPPPHRSTRTQPLQSCGFLHQLDRVTQDVLAAVLAAQRSGAQPGE
    TIRVPGVAEGLVLSRPVSVAELSRLRRQFISYTKMQPSDENLPQLASMFVQYLNRSIHGLPLMVIIHKSW
    CGACKALKPK
    FAESKEISELAHNFVMVNLEDDEEPKDEAFSPDGGYIPRILFMDPSGKVHPEIINERGNPSYKYFYTNADQVVQGMKEAQ
    EKLTGDAFKQKHLGDEL

    >gi|224167989|ref|XP_002191661.1| PREDICTED: similar to Nxn protein, partial [Taeniopygia guttata]
    LKLWNKYRVSNIPSLIFIDASSGKVVCRNGLLVIRDDPEGLEFPWGPKPFSEVVAGPLLRSNGQTLDSSALEGSHVGVYF
    SAHW
    CPPCRSLTRVLVESYRKIKEAGQKFEILFVSADRSEDSFKQYFSEMPWVAVPYADEARRSRLNRLYGIQGIPTLIV
    LDAKGEVITRQGRVEVLNDVECREFPWHPKPVLELTDSNAVQLNEGPCLVLFVDSEDDGESEAAKQLVQPIAEKIIAKYK
    AKEEE

    >gi|224046024|ref|XP_002186706.1| PREDICTED: similar to thioredoxin domain containing 10 [Taeniopygia guttata]
    MGGGTLIPAGGRVSLALPKEQSIDSTEREPPCRGDDRAYTPRSPPSRPSGRPSAPGAAGPAPPRLRACALRRARRFPFRP
    CRGCVNMAAAPGRRPRCLLWAAGDGQAGPASLGRAGLQGRAGESVVAHVVASGAGFVEDLDESFKENRKDDIWLVDFYAP
    W
    CGHCKKLEPVWNEVGIEMRNMGSPVKVGKMDATSFSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFANRVAG
    PLIRPLPSQHMFEHVQKRHLVLFVYVGGESPLKEKYIEVASELIVYTYFFSASEDVLPEYVTLPELPAVMVFKDGTYFVY
    DEYEDGDLSSWVNRERFQGYLHVDGFTLYELGDTGKLVAIAVIDDKNSSVKHTRLKSIIQEVARDYRDHFHRDFQFGHMD
    GNDYINSLLMDDLTIPTIVVLNTSNQQYFLPDRHIESTEDMVQFINNILDGTAEAQGGDGLLQRIKRIIYDAKSTIVSVF
    KSSPLLGCFLFGLPLGVISIMCYGICTADTEGEVFEHEGAKKESGDRELTDEGSEEEQEEEKNGKYTELSDGELKQKDIM
    EKKKD

    >gi|224076556|ref|XP_002196199.1| PREDICTED: similar to nucleoredoxin [Taeniopygia guttata]
    MAGALTDVLGEVLVAADGEEVAVSALAARGVSLVGLYFGCSLGGPCAQLGASLAAFYGRFRGEAAAAGGQRLEIVFVSAE
    QEQQQWQEAVRAMPWLALPFADQHRKLKLWNKYRVSNIPSLIFIDASSGKVVCRNGLLVIRDDPEGLEFPWGPKPFSEVV
    AGPLLRSNGQTLDSSALEGSHIGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAGQKFEILFVSADRSEDSFKQYFSEMPWVA
    VPYADEARRSRLNRLYGIQVD

    >gi|224058210|ref|XP_002197518.1| PREDICTED: similar to glutathione peroxidase 7 [Taeniopygia guttata]
    MLLAIAALLLLAFSATRQKEPDFYTFKVVNIRGKLVSLEKYRGSVSLVVNVASECGYTDSHYKALQQLQRDLGPYHFNVL
    AFPCNQFGQQEPDTNKEIESFARKTYGASFPMFSKITVSGAGAIPAFKYLIDSTGEEPTWNFWKYLVDPNGKVVKAWDST
    VSVEEIRPHVTELVRKIILKKKDEL

    >gi|224049860|ref|XP_002194450.1| PREDICTED: putative tumor suppressor candidate 3 [Taeniopygia guttata]
    MALGAGAAWRLPHLPVGGCLPLLLLLLLLLCGQLGGGQKKKENLLAEKVEQLMEWSSRRSVIRMNGDKFRRFVKAPPRNY
    SVIVMFTALQPQRQ
    CSVCRQANEEYQVLANSWRYSSAFSNKLFFTIVDYDEGADVFQQLNMNSAPTFMHFPPKGKPKRAD
    TFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMAALCVVFAMTS
    GQMWNHIRGPPYAHKNPQNGQVSYIHGSSQAQFVAESHIILLLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVF
    FFSFLLSIFRSKYHGYPYSFLIK

    >gi|224166020|ref|XP_002197788.1| PREDICTED: ATPase, Cu++ transporting, alpha polypeptide, partial [Taeniopygia guttata]
    KAELPMAKAQPCPEAQLDSHKPEQPSKVPPAHLGRQESKTISKCYVQVTGMTCASCVANIERNLRREDGIHSILVALMAG
    KAEVRYNPAVIHPAAIAELIRELGFGATVMENCGEGDGILELIVRGMT
    CASCVHKIESTLMKTSGVLYCSVALATNKAHI
    KYDPEAIGPRDVIQVIKDLGFTTSLVKKDRSASHLDHKQEIRQWKRSFVVSLVFCIPVMGLMIYMMVMDSQLSHAHAHHN
    MSSEEMEALHSSMVLEYQLLPGLSVMNFLSFLLCVPVQVFGGWHFYIQASRALRHNTANMDVLVVLATSIAFLYSFIILL
    VAMAERAKVNPVTFFDTPPMLFVFISLGRWLEHVAKGKTSEALARLISLQATEATIVTLGPDNVLLSEEQVDVELVQRGD
    LVKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVTKKPGSTVIAGSINQNGSLLISATHVGADTTLSQIVKLVEEAQTS
    KAPIQQFADKLSGYFVPFIVAVSVVTLFAWIIIGFVDFEIVEKYFLGYNKSISAAE

    >gi|224090549|ref|XP_002186590.1| PREDICTED: similar to probable glutathione peroxidase 8-B [Taeniopygia guttata]
    MEPLTTSYPLKYSVHKARIFVVFLSMLLCTTILCLLQLRFFKPKIKDFYSFEVKDSRGRIISLEKYRGKATLVVNVASYC
    QYTEKNYIALQELHREFGPSHFTVLAFPCNQFGESEPSSSQEIESFAKGNYGVTFPVFHKIKILGSEADPAFKFLIDSSK
    KEPRWNFWKYLVSPEGKVVKFWRPEESIESIKPEVTSLIRQIIMKKKEDL

    >gi|224052946|ref|XP_002188003.1| PREDICTED: similar to prdx3 protein [Taeniopygia guttata]
    MAAALGRLLRAAVPVAAAAGRRGTARPPACARRPFSLGSWRLAAAVTQHAPAFKGTAVVNGEFKELSLDDFKGKYLVLFF
    YPLDFTFV
    CPTEIVAFSNKAKEFRDVNCEVVAVSVDSHFTHLAWINTPRKSGGLGKMNIPVLSDLTKQISRDYGVLLDGP
    GIALRGLFIIDPNGVIKHLSVNDLPVGRSVDETLRLVKAFQFVETHGEVCPANWTPNSPTIKPSPEGSKEYFEKVNK

    >gi|224052079|ref|XP_002188587.1| PREDICTED: iron-sulfur cluster assembly 2 homolog (S. cerevisiae) [Taeniopygia guttata]
    MSEHIREARSRCSASPCPGPALPRPPARPAGSLLRWASSFSEPGPTESGPSEGQIFLSESCVKRLLEIADGSEFLRLQVE
    GGG
    CSGFQYKFSLDTVINPDDRVFEQGGARVVVDVDSLAFVKGSMVDFSQELIRSSFQVVSNPQAEKGCSCGTSFSVKF

    >gi|224045605|ref|XP_002197339.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
    MASAHERKVTGLFLEVGIMLVEKSDTNYSNHLFIIPNYYILVIDVYQAWCGPCKAVQNLLKKLRIDFSEDNVLHFAVAEA
    DSIEILKPFRKSCEPVFLFSVHGKILAMVKGVNAPLITKIVTDLVQEEREIAAGEKERAEVEEIIFPEEGSSEESDEEEE
    VLTYSVGIIKPDDVLAGRVEEIKKKIKDAGFDIKADEERMLTEEQIRVFYARKKEEPDFDAFVQFMKSGPCHVLIITKKE
    STDAIPQWIDLHKTSESAEPEEPIKLPGLKETESLVNLCDVQDSIEDASRQLAFFFPNFNISTAKHPIERTLAIIRPTLL
    KERRKSIIQRIQDDGFQIAMQKEIILSEDQVRTFYKEHVDQDYFPVLLEQMTSGPTLILALTGENAVSHWRSLLGPKILE
    EAKENPESLRAQYAIENVPINQLHGSSTPSDAQKELEFFFPEEQTFALIKPDAAKTHKDEIMKKVKEAGFSISKVKEQAL
    TREMAAQFYKDHEGKPFYEELVNFMTQGPSVIMVLSKENAVEEWRKLMGPTNPEEAKKTSPKSIRAQFAHDILSNAVHGS
    SNVEHAERSIQFAFGELDAD

    >gi|224163868|ref|XP_002199940.1| PREDICTED: hypothetical protein, partial [Taeniopygia guttata]
    ALDFLLSTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRAKDVGRPKAEVAAEFLNSRIPDCAV
    VPYFKKIQDMDESFYRQFHIIVCGLDSIIARRWINGMLMSFLHYEDGVLDPSSIIPLIDGGTEGFKGNVRVIIPGMTACV
    ECTLALYPPQVNFPM
    CTIASMPRLPEHCIEYVRILQWPKEQPFGEGIALDGDDPEHIQWIYQKSLERASQFNIKGVTYRL
    TQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYVPLNNYLVFNDVDGLYTYSFEAERKENCPACSQLPQNIEISPSAK
    LQEILDYLTNNASLQMKSPAITATMYGGNKTLYLQTVASIEERTRPNLSKTLKGMELSGVDFQVRERTNSLISGGWDTSS
    WGLNSNTEPQNQPVSPTAITKPVRRTVVDESENFFSAFLSPTDVQSIQKNPVVSKPPAKSQRPKEEVKSTLKESQHSTQL
    EGPGTAEAEVKDSVAVLDLKSLDIPEEKLEENAVLKSDAQHEASTNEITDKKVSALNIEEPEDSPTEKASVGGDGAAGAP
    EGTSQPLGAGTKDLGLEGKERKTEDRQSNTPSPPISTFSSGTSTTSDIEVLDHEV

    >gi|224073829|ref|XP_002187535.1| PREDICTED: quiescin Q6 sulfhydryl oxidase 2 [Taeniopygia guttata]
    MTLSRHRRAPQPRARSGTERAPGEGDFGSRELEDKHRSHLNILRQTSLLLAHKLKLQQQQRQHRLLVLREKAKQEVEESH
    RFLRDLLQLCSEHSAAVPRFGGSSTFHGCSLAVVEQCLRAEELRARHQAALLQLRRKALQERARAELAWLGHRRRLAVVE
    QGLRAEELRARCQAALLQLRRKALRERARAELAWLGHRRRVLENLQDSTGASAMAAKQHKFLMELKWEQAEIQHLKNIYR
    AAHQERKILLKQQREILMMQHSTAQLQEKLPSLAGKQEVMKSGSKHNCVQLNHKKSKKYEGQLLNTEEESDDPLSLFEIG
    DRVLVKQSQPGTLMFKGQTHFGSGHWAGVALDEAEGDNAGTYEEVKYFECAQHCGVFVRPDEISHLFGVNKNSSSYMGNE
    DSDSFHDDDDSLKGDCNYSEDVTDRIVTKFIDDAVKEYKKIKRKQRSKADKILHLSPETSPTTLPTFVQGEIIKIMNLEK
    NDLEMKRKFLNMTKYGNCKRDRVDLILIQELCKEESQWTSYGDDELTVKMRMTEAIFDSLILDTIRVLNKIYLKKACLKD
    WESAIRVGVLDCGEEGNYETCKEYGIHYYPTLRYFKAFTKQFTTGENYQGADRELQTLRQMMIDFLQNHSQELRPPALPP
    LDPVLSSDLPSLFDKNSHHYTAIVFESNSSYVGREVILDLVQYENIVVRRALNFDKPFLEKLGVTSVPSCYLIQPNGSHG
    LINNLKPLRSFFSSYLKSLPGVRKKLLLPLQLPAPENKEESTEIKVWKEFDKSRLYMADLESGLHFLLRVELATHKALEG
    AELKTFKDFVTISAKLFPGRQPVVKLLETLQEWLVSLPLDKIPYDAILDLVNNKMRISGIFLPRKVQWVGCQGSRPELRG
    YSCSLWKLFHTLTVQAALRPKALLNTGLEDNPQIVLQVMRRYIQHFFG
    CKACAQHFEEMAKESMDSVKSLDQAVLWLWAK
    HNVVNNRLAGDLTEDPKFPKVQWPTPDVCPACHEEIKGLHSWNEAQVLQFLKSHYSSDNILYKYTESQADPADNEQGDTR
    EGKDKNLLKNSGGNGEKKLQDKEKPGDPGSRVFQKPMGNPGAVQGSGKSAAASVSLKGTRQAVSFLGIGFSNLDMSLCVI
    LYVASSLFLMIMYFFFRVRSKRWKVKAHRSSV

    >gi|224091503|ref|XP_002188041.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
    MFLRGGRGLPGLVAVSPLASPGTAPLTPLALDRTEPAGPDRHRDTPRRRHGGPPLPRLWHSLAPQPVASRDSVCSQPTEP
    VLPWQSDSTQGMIQGMETLVATPVIEKEKAMLHPGKPDECRQLFRTPSVPGSVPGPVPKRRLPSDRDGPTEAKRQRSVAG
    SPQQKASLEPPCGSAQLQEIENLLANDNQELTGDFSKPYLLPTVEGQDPSLKYISPDTLEKVLTGRYSSFIERSVVVDCR
    YPYEYQCGHIKGAVNLPLQRDVEESLLELPIVAQDAGKRVIVIFHCEFSVERGPKM
    CKFLRERDRSCHSYPQLHYPELYV
    LKGGYREFFSQFPGHCEPRDYRPMEDPAFREELRRFREQSRRGRRALFVRGRDL

    >gi|224045171|ref|XP_002198103.1| PREDICTED: thioredoxin domain containing 5 [Taeniopygia guttata]
    MAAEPKPEMHHELPEPRWGSAGLPTLLQWHPSLVPGVWSRIGALHQVKVCTAVPAQEGRNEQGGVVGPGAAYFVMTVYLH
    QPVSCSFCHR
    CGHCQRLQPTWNDLGDKYNNMENPQVYVVKVDCTVDVPLCSEFGVRGYPTLKLLKPGQEPLKYQGPRDFQ
    ALENWMLEKLNEEPSDPESDVEPPKAPEPKQGMYELSADNFKMHIAEGNHFIKFFAPW
    CGHCKALAPTWEQLAQVFEHSE
    AVKIGKVDCTQHYEVCSETQVRGYPTLFWFKNGEKGDQYKGKRDFDSLKEYVDSQLQSSGKEPPADKPVEAPQPPAEPTH
    VEVQAAVLSLSEKDFDATIARGITFIKFYAPW
    CGHCKNLAPTWENLAKEQFPGLTDVKIAEVDCTVERNVCNRFSVRGYP
    TLLLFRGGKKVSEHNGTRDLESLHNFVLRQARDEL

    >gi|224058825|ref|XP_002193944.1| PREDICTED: peroxiredoxin 6 [Taeniopygia guttata]
    MPGLLLGDEAPDFEADTTQGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAQLAPEFSKRNVKMIALSIDSVQDHLS
    WCKSKSTFPGHQLFSRSPPCPSPVPTPVVKQLPGKEGASGLSRSSRAGRQMCLTLTLSPCAQVFIFGPDKKLKLSILYPA
    TTGRNFDEILRVLDSLQLTAYKKVATPVDWKPGDSVMMVPTLPDEEAKKLFPKGVFTKELPSGKKYLRYTPQPE

    >gi|224098194|ref|XP_002198603.1| PREDICTED: chloride intracellular channel 2 [Taeniopygia guttata]
    MDSQQHSTTKEPEIELFVKAGLDGENIGNCPFCQRLFMVLWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLLFNKELK
    TDFIKIEEFLEQTLCPPTYPHLSPKYKESFDVGSDIFAKFSAYIKNPRKEANINFEKALLREFQRLDVYLNTPLPEEIDQ
    DSVEDITISKRKFLDGDHLTLADCNLLPKLHIIKIAAKKYRDFEIPEDMTGVWRYLNNAYACDEFNHTCPADEEIEHTYA
    SVARKMT

    >gi|224070225|ref|XP_002187437.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
    MAPPRPGLHRGAGMAAPSEGRAGRAAASFPGTGSGSFPFSVPHDAAGEPAKKPCRACTDFRSWLREQRKQAAPGSADVAV
    AEEKEPRPDCPLDSEQLGRSTWAFLHTMAAYYPDRPSRAQQKEMRDFIHLFSKFYP
    CEHCAEDLRERLQTNQPDTSSRSN
    FSQWLCQLHNEVNRKLGKLEFDCSRVDERWRDGWKDGSCD

    >gi|224045211|ref|XP_002188860.1| PREDICTED: anterior gradient homolog 2 (Xenopus laevis) [Taeniopygia guttata]
    MEKSYVSVFLLLIVISCALAKDAGKKDSKDTPAKPKLPQTLSRGWGDQLIWTQTYEEALFRAKHSQKPLMIIHHLEDCPH
    SQALKKVFAEHKDIQKLAEKFILLNLVYETTDKNLAPDGQYVPRVLFIDPSLTVRADITGRYSNRLYAYEPSDISLLYSN
    MQKALKLLKTEL

    >gi|224045213|ref|XP_002188934.1| PREDICTED: similar to anterior gradient homolog 3 [Taeniopygia guttata]
    MLHSTLALSLLLIAVNSNLAMAIKKEKRAPQTLSRGWGDEITWVQTYEEGLYQAKKSNKPLMIIHHLEECQYCQALKKAF
    AENEEIQEMAQNNFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDMMFLIENMKKALRL
    IQTEL

    >gi|224095288|ref|XP_002199162.1| PREDICTED: mercaptopyruvate sulfurtransferase [Taeniopygia guttata]
    MSQQLLYRALVSAKWLSEAIKSQQAGLALRIVDASWYLPKMKRDPKREFEERHIPGAVFFDIDQCSDRTSPYDHMLPKAN
    DFAEYVGKLGVGNDSHVVVYDGSDQGLFSAPRVWWMFRVFGHEAVSLLDGGLKNWQREGNALSSGKTQVAPSEFHASLDK
    SLVKTYEDVLDNLDSRHFQLVDARAAGRFRGVEPEPRDGIEPGHVPGSTSIPFTDFLTESGLEKTPEQIRTLFQEKKVDL
    LKPVVAT
    CGSGVTACHVALGAYLCGKPDVAVYDGAWVEWYMRAQPENIISEGKGKTV

    >gi|224066473|ref|XP_002192807.1| PREDICTED: ubiquitin-like modifier activating enzyme 3 isoform 1 [Taeniopygia guttata]
    MADGEEPEKKRRRLEELLADGMAVDGGCGDSGDWEGRWNHVKKFLERSGPFTHPDFEPGTQALDFLLSTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRAKDVGRPKAEVAAEFLNSRIPDCAVVPYFKKIQDMDESFYRQFH
    IIVCGLDSIIARRWINGMLMSFLHYEDGVLDPSSIIPLIDGGTEGFKGNVRVIIPGMTACVECTLALYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRILQWPKEQPFGEGIALDGDDPEHIQWIYQKSLERASQFNIKGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKIATSAYVPLNNYLVFNDVDGLYTYSFEAERKENCPACSQLPQNIEISPSAKLQEILDYLTNNASLQMKSP
    AITATMYGGNKTLYLQTVASIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTMLFKLHFTT

    >gi|224066475|ref|XP_002192869.1| PREDICTED: ubiquitin-like modifier activating enzyme 3 isoform 2 [Taeniopygia guttata]
    MADGEEPMAVDGGCGDSGDWEGRWNHVKKFLERSGPFTHPDFEPGTQALDFLLSTCKVLVIGAGGLGCELLKNLALSGFR
    QIHVIDMDTIDVSNLNRQFLFRAKDVGRPKAEVAAEFLNSRIPDCAVVPYFKKIQDMDESFYRQFHIIVCGLDSIIARRW
    INGMLMSFLHYEDGVLDPSSIIPLIDGGTEGFKGNVRVIIPGMTACVECTLALYPPQVNFPM
    CTIASMPRLPEHCIEYVR
    ILQWPKEQPFGEGIALDGDDPEHIQWIYQKSLERASQFNIKGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATS
    AYVPLNNYLVFNDVDGLYTYSFEAERKENCPACSQLPQNIEISPSAKLQEILDYLTNNASLQMKSPAITATMYGGNKTLY
    LQTVASIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTMLFKLHFTT

    >gi|224042685|ref|XP_002196161.1| PREDICTED: similar to MGC82793 protein [Taeniopygia guttata]
    MPRISKPAPYWEGTAVINGEFKELKLTDYEGKYLVFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVACSVDSKFTHL
    AWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDNKRILRQITMNDLPVGRSVDETLRLVQAFQY
    TDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|224095308|ref|XP_002199255.1| PREDICTED: thioredoxin 2 [Taeniopygia guttata]
    MAQRLALQRLLSLPTRGPLASHGRALGTSAGRRSTFNVQDGSDFQDRVVNSPKPVVVDFHAQWCGPCKILGPRLEKLVAK
    QEGKVLMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGVKDEDQLEAFLKKLIGA

    >gi|224048738|ref|XP_002196421.1| PREDICTED: protein disulfide isomerase family A, member 6 [Taeniopygia guttata]
    MRGGHGGARGGAARGGARHVGRGGGGGRGAGSHGGCAARAGCGGGTVSCTLFLAVNGLYSASDDVIELTPTNFNKEVIQS
    DSLWLVEFYAPW
    CGHCQRLTPEWKKAATALKGVVKVGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDA
    IVDAALSALRTLVKERLSGRSGGYSSGKQGRESGGGDKKDVIELTDDSFDKNVLNSDDVWMVEFYAPW
    CGHCKNLEPEWA
    AAATEVKEQTKGKVKLAAVDATVNQRLASQYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIIARALDLFSDNAPPPELLEI
    ISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAA
    VNARKMKFALLKGSFSEQGINEFLRELSVGRGSTAPVGGGAFPKIHSVEPWDGKDGELPVEDDIDLSDVDLDDLGKDEL

    >gi|224093983|ref|XP_002188634.1| PREDICTED: methionine sulfoxide reductase B3 [Taeniopygia guttata]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKDCKVVFSQEELRKRLTPLQYHVTQEKGTESAFEGEYTHHKAQGIYKCV
    VCGTPLFRSETKFDSNSGWPSFYDVISPDAIAFNDDFSYGMHRIEISCSQCGAHLGHIFDDGPRPTGKRY
    CTNSASLSFK
    PADKNSAGEGSVNASPAQTGKAEL

    >gi|224089436|ref|XP_002189076.1| PREDICTED: putative thioredoxin [Taeniopygia guttata]
    MVKIVGNLVEFEAELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLSEKYSEVIFIEIDVDDAQDVASHCDVKCMPTFQFY
    KNGNKVQEFSGANKEKLEETIKSLV

    >gi|224072335|ref|XP_002188332.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 isoform 1 [Taeniopygia guttata]
    MGGCFSKPKPVEVKIEVVIPEKERSKEEMSPNGKASPLIYKVNGTARHYHLEEHPIASNPYHNPKDVVEASVCHVKDLEN
    GQMREVDLGCGKALLIKESGEFHAVGHKCPHYGAPLVKGVLSKGRVRCPWHGACFNISTGDIEDFPGLDSLPRFQVKIEK
    EKVYIRASKQTLQTQRRTKMMAKCISLSNYNLSSTNVLIIGAGAAGLVCAETLRQEGFSDRIVM
    CTMDRHLPYDRPKLSK
    SMDSHPEQIALRPKEFFCTYDIEVLTEMQVAAVDVKSKIAVFKDGFKMEYNKLLIATGSTPKTLSCKGKEMENVFNIRTP
    EDANRVVKLATSKNVVIVGASFLGMEVAAYLAERAHSVSLVELEHVPFKKFFGERVGRAVMKMFENNRVKFYMQTEVSEL
    REQEGKLKEVVLKSGKVLRADVCVVGIGAVPATGFLKQSGINIDSKGFIVVNKMMQTNIPGVFAAGDAVTFPLALRNNKK
    VNVPHWQMAHMHGRIAALNMLAHGTEISTVPYLWTAMFGKSIRYAGHGEGFDDVVIQGDLDELKFVAFYTKSDEVVAVAS
    MNYDPIVSKVAEVLAAGRTIRKRDVETGDMSWLTGKGT

    >gi|224072339|ref|XP_002188361.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 isoform 2 [Taeniopygia guttata]
    MGGCFSKPKPVEVKIEVVIPEKERSKEEMSPNGKASPLIYKVNGTARHYHLEEHPIASNPYHNPKDVVEASVCHVKDLEN
    GQMREVDLGCGKALLIKESGEFHAVGHKCPHYGAPLVKGVLSKGRVRCPWHGACFNISTGDIEDFPGLDSLPRFQVKIEK
    EKVYIRASKQTLQTQRRTKMMAKCISLSNYNLSSTNVLIIGAGAAGLVCAETLRQEGFSDRIVM
    CTMDRHLPYDRPKLSK
    SMDSHPEQIALRPKEFFCTYDIEVLTEMQVAAVDVKSKIAVFKDGFKMEYNKLLIATGSTPKTLSCKGKEMENVFNIRTP
    EDANRVVKLATSKNVVIVGASFLGMEVAAYLAERAHSVSLVELEHVPFKKFFGERVGRAVMKMFENNRVKFYMQTEVSEL
    REQEGKLKEVVLKSGKVLRADVCVVGIGAVPATGFLKQSGINIDSKGFIVVNKMMQTNIPGVFAAGDAVTFPLALRNNKK
    VNVPHWQMAHMHGRIAALNMLAHGTEISTVPYLWTAMFGKSIRYAGHGEGFDDVVIQGDLDELKFVAFYTKSDEVVAVAS
    MNYDPIVSKVAEVLAAGRTIRKRDVELFVRHGKTGDMSWLTGKGT

    >gi|224049131|ref|XP_002193355.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
    MPISPKPQHVVSCRAGRDRGGTGGGPGAGRRAQTEPAAMAAAAYELLVLGGGSGGLAGARRAAELGARVALVEPQRLGGT
    CVNVGCVPKKVMWNTAVHAEFIHDHADYGFETAGVKFNWRTIKEKRDAYVRRLNDIYENNVKKARIDIIRGYGKFTADPE
    PAIEVDGKKYTAPHILIATGGRPAVPSDSEIPGASLGMTSDGFFDLEELPRRSVVVGAGYIAVEMVGILSTLGSKSSLLI
    RHDKVLRTFDSLISSNCTQELENTGVDVWKHTQVKKVTKSPCGLLDVTVASVVPGRKPTEEVIRDVDCLLWAVGREPNSE
    GLCLDRVGVRVDPKGHVVVDEYQNTTRRGIYAIGDVCGRALLTPVAIAAGRKLAHRLFEGKQDSRLDYENIPTVVFSHPP
    IGTVGLTEEEAVAIHGKDNVKIYNTSFTPLYHAVTQRKVKCVMKLVCAGKEEKVVGLHMQGLGCDEILQGFAVAIKMGAT
    KADLDNTVAIHPTSAEELVTLR

    >gi|224056969|ref|XP_002190813.1| PREDICTED: similar to Phosducin [Taeniopygia guttata]
    MEENANTSLDEDFEGQATHTGPKGVINDWRKFKLQSEDSDSLPLSKKEMLRQMSSPHRSFSRDDKDTRERFCRKMSMQEY
    ELIHAAQEDESCLQQYRKRCMQDMHQRLSFGPKFGFLCELQNGEQFLEAVEKEHKTTTVIVHIYEDGVKG
    CEALNSSLTC
    LAAEYPTVKFCKIKASSTGAGDRFSSEVLPSLLVYKAGELLSNFISVSEQFSEEFFAVDVEAFLNEYGLLPERELPALGN
    GTDEPDVE

    >gi|224059890|ref|XP_002196638.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
    MAAKKKEVVLQINITSQELWEEVLCLKGLIVVDVFQAWCGPCKPVVNLFQKIKNEVGSNLLHFAVAEVDSIDALEKYRGQ
    CEPVFLFYTGGELVAVVRGADAPLLQKTILKQLAGERKRGGELMVVPDRAFSRDQGSTAPLQEEQQQGLTG

    >gi|224053210|ref|XP_002190812.1| PREDICTED: similar to putative thioredoxin-like 2 [Taeniopygia guttata]
    MAEAALPVRSAGLGFAVPLAQAEGAFVSPQNSQKVDRLDGAHAPELTQKVQRHAAGAAPAAPAQEQLHARLSRLVNAAPC
    MLFMKGSPKEPR
    CGFSRQMVQLLQQHGVAFSTFDVFSDEEVRQGLKAFSNWPTYPQLYVRGELVGGLDVVKELAASGELD
    TICPKGQKLEDRLKSLINKAPVMLFMKGNKQMAK
    CGFSKQIIEIMNNTGVDYETFDILEDEEVRQGLKSFSNWPTYPQLY
    VKGELVGGLDIVKELKESGELLPVLKGEN

    >gi|224053212|ref|XP_002194967.1| PREDICTED: putative thioredoxin-like 2 variant 2 [Taeniopygia guttata]
    MLFMKGSPKEPRCGFSRQMVQLLQQHGVAFSTFDVFSDEEVRQGLKAFSNWPTYPQLYVRGELVGGLDVVKELAASGELD
    TICPKGQKLEDRLKSLINKAPVMLFMKGNKQMAK
    CGFSKQIIEIMNNTGVDYETFDILEDEEVRQGLKSFSNWPTYPQLY
    VKGELVGGLDIVKELKESGELLPVLKGEN

    >gi|224092794|ref|XP_002192622.1| PREDICTED: similar to selenophosphate synthetase 1 [Taeniopygia guttata]
    MSVRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|224052743|ref|XP_002193496.1| PREDICTED: similar to AS3MT protein [Taeniopygia guttata]
    MPGQHRILGRSVAQAGQSPAEALQLEANYYGKELQKSEDLKTNACITSARPVSKLVRDALERIHEEVVARYYGCGLVIPE
    FLSSCRILDLGSGSGRDCFLLSQLVGEQGHITGIDMTKGQVELAKKHVAYHMDKFGYRKPNVEFFHGYMENLGDAGLADD
    SYDIVISNCVINLAPDKRAVLREAFRVLKPGGEMYFSDVYASQRLSESTRKHRVLWGE
    CLAGALYWRDLYSIAEEVGFSP
    PRLVTASPITIGDKELEGIVGDCRFVSATYRLFKVPAGSRTGPGQATYSGGIVGHERELVFDANFTFKEGEVVNVDAEMA
    AILQSSRFAEKFLIRAGGANAAGLQCCCSKGVKEKICDPFQLLEQLRAPGPASCSGGTCGPPGCC

    >gi|224047868|ref|XP_002192469.1| PREDICTED: similar to endoplasmic reticulum oxidoreductin 1-Lbeta [Taeniopygia guttata]
    MKSSARSPVLADIYEPKSLPPDKERRSPLGLKVHLQVARRVWTEFTSANFLSGTRRAKLLYAGPDWAEAGKNGKNGKRCA
    NRSHGRAPPPPLARPSSRGPPGAARTRPAGPSRAAATCFGGARGPLRLGAAAPPRPGSGTASGTTSPGVPRGGGPGAAGA
    GAERGGGGAAASPEDPGCARRCRGQVAVSAAPRPTGPAAAGAARREETLRRCPRRVLSLRGGGARLPKSAAPPARRVLAA
    RRSVVAAAAAAAACAAGAARNAAARARLAARLLAVLGCVLTAEAQLTGVLDDCLCDIESIDDFNTFKIFPKIQKLQERDY
    FRYYKVNLKRPCPFWADDGH
    CSIKDCHVEPCPESKIPVGIKAGSSNKYSKAANNSKELEDCEQANKLGAVNSTLSNQSKE
    AFIDWARYDDSQDHFCELDDERSPDAQYVDLLLNPERYTGYKGPSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGGDDG
    ESFYTWLEGLCLEKRVFYKLISGLHASINLHLCANYLLEETWGKPRWGPNVKEFTRRFDPAETKGEGPRRLKNLYFLYLI
    ELRALSKVAPYFERAVVDLYTGNGHEDAESKALLLDIFRDTKSFHMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMD
    CVGCDKCRLWGKLQTQGLGTALKILFSEKEIQSLPENSPSKGFQLTRQEIVALVNAFGRLSTSIKELQNFKVLLQQTR

    >gi|224088677|ref|XP_002190446.1| PREDICTED: nucleoredoxin-like 2 [Taeniopygia guttata]
    MVDVFSGRLLVSKDGRSVDPDEALQNKVVGLYFSAGWCSPCRNFTPVLCDFYTELLEETEPPAPFEVVFISSDHSAEEMV
    GYMRAMHGDWLALPFHDPYKHDLKKKYNITAIPKLVIVKQTGEVITDKGRKQIRDKGLSCFRNWLEGADIFQNFSS

    >gi|224057034|ref|XP_002191942.1| PREDICTED: similar to glutaredoxin 2 [Taeniopygia guttata]
    MTREWVEVPDTGPQGNQDRERGVAGVARVCAAAPADRSAVSRVSHTRVCGCTGGPERGVAGVTHACVRLHRRIGARCRGC
    RTRVCAVTTGGSERGVAGVTHACVRLPPAARSVSRVTAPPGARTAAIPPLPCPAGTREAGWLQMLQLKSTLMENSRMGNS
    QTASVGLSNAAVNQIQDIISHNCVVIFSKTT
    CPYCKMAKDLFKGLQVSYTAMELDENTNGRKFQDVLEQMTGSRTVPRVF
    INGTCVGGATDTQKLHDEGKLLPLIHQCKMKANY