Sus scrofa

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|194042132|ref|XP_001928549.1| PREDICTED: similar to antioxidant protein isoform 1 [Sus scrofa]
    MAAAAAAAAGRLLRASVIRHVSAVPWGISASAALRPAPSRRTCLTSVLWSGSSQAKFAFSTSSSHHSPAVTQHAPYFKGT
    AVVNGEFKELSLDDYKGKYLVLFFYPLDFTFV
    CPTEIIAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGH
    MNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTP
    DSPTIKPHPTDSKEYFEKVHQ

    >gi|194042134|ref|XP_001928552.1| PREDICTED: similar to antioxidant protein isoform 2 [Sus scrofa]
    MAAAAAAAAGRLLRASVIRHVSAVPWGISASAALRPAPSRRTCLTSVLWSGSSQHAPYFKGTAVVNGEFKELSLDDYKGK
    YLVLFFYPLDFTFV
    CPTEIIAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYG
    VLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPDSPTIKPHPTDSKEYFEK
    VHQ

    >gi|194039419|ref|XP_001926963.1| PREDICTED: similar to chloride intracellular channel 5 isoform 1 [Sus scrofa]
    MSDEDYSTIYDRVQKERVYENTEQPAENGGPLYDAIHEESRAEDKVYATELETHEYDFVAVYQVGREESSSASFQPEVGE
    YLLPDEVYPEAQDLQPHEAQDDRSTWVGELFSPTQDQQAGLEQPQENGSEMEEAQPSPSSFSTRHSRALSPSEGFPTHSS
    AAAVSEEKEPTSTSPEISLFVKAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNG
    DVKTDVNKIEEFLEETLTPEKYPRLAAKHRESNTAGIDIFSKFSAYIKNTKQQSNAALERGLTKALKKLDDYLNTPLPEE
    IDTSTREDDDKVSRRKFLDGDELTLADCNLLPKLHVVKIVTKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAADSEIE
    LAYADVAKRLSRS

    >gi|194039421|ref|XP_001927000.1| PREDICTED: similar to chloride intracellular channel 5 isoform 2 [Sus scrofa]
    MTDAATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGD
    VKTDVNKIEEFLEETLTPEKYPRLAAKHRESNTAGIDIFSKFSAYIKNTKQQSNAALERGLTKALKKLDDYLNTPLPEEI
    DTSTREDDDKVSRRKFLDGDELTLADCNLLPKLHVVKIVTKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAADSEIEL
    AYADVAKRLSRS

    >gi|194044161|ref|XP_001924216.1| PREDICTED: similar to tumor suppressor candidate 3, partial [Sus scrofa]
    MLNGLILETYKRKETAKKCDLSSTLRRNLEEFFRRNVPRIFIMKEKAGKRKSQKTFDLKGDVTVSHLRKLNPDAINLMDR
    GKVKNLLTEKVEQLMEWSSRRSIFRMNGDKFRKFIKTPPRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAF
    CNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVH

    >gi|194042195|ref|XP_001926014.1| PREDICTED: similar to SFLQ611 isoform 4 [Sus scrofa]
    MQQQQRMDPSFVTMGMWSIGAGAIGAAALALLLANTDIFLPKPQRATLDYLEDIDLKTLEKEPKTFKAKALWEKTGAVIM
    AVRRPG
    CFLCREEAADLSSLKPRLDELGVPLYAVVKEQVKNEVKDFQPYFKGEIFLDEEKKFYGPQRRKMMFMGFVRLGV
    WYNFFRARSGGFSGNLEGEGFVLGGVFVVGPGKQGILLEHREKEFGDKVNPVSVLEAVRKIKPHTSASEKK

    >gi|194042197|ref|XP_001925957.1| PREDICTED: similar to SFLQ611 isoform 2 [Sus scrofa]
    MGMWSIGAGAIGAAALALLLANTDIFLPKPQRATLDYLEDIDLKTLEKEPKTFKAKALWEKTGAVIMAVRRPGCFLCREE
    AADLSSLKPRLDELGVPLYAVVKEQVKNEVKDFQPYFKGEIFLDEEKKFYGPQRRKMMFMGFVRLGVWYNFFRARSGGFS
    GNLEGEGFVLGGVFVVGPGKQGILLEHREKEFGDKVNPVSVLEAVRKIKPHTSASEKK

    >gi|194042199|ref|XP_001925931.1| PREDICTED: similar to SFLQ611 isoform 1 [Sus scrofa]
    MSFLQDPSFVTMGMWSIGAGAIGAAALALLLANTDIFLPKPQRATLDYLEDIDLKTLEKEPKTFKAKALWEKTGAVIMAV
    RRPG
    CFLCREEAADLSSLKPRLDELGVPLYAVVKEQVKNEVKDFQPYFKGEIFLDEEKKFYGPQRRKMMFMGFVRLGVWY
    NFFRARSGGFSGNLEGEGFVLGGVFVVGPGKQGILLEHREKEFGDKVNPVSVLEAVRKIKPHTSASEKK

    >gi|194042201|ref|XP_001925985.1| PREDICTED: similar to SFLQ611 isoform 3 [Sus scrofa]
    MSFLQDPSFVTMGMWSIGAGAIGAAALALLLANTDIFLPKPQRATLDYLEDIDLKTLEKEPKTFKAKALWEKTGAVIMAV
    RRPG
    CFLCREEAADLSSLKPRLDELGVPLYAVVKEQVKNEVKDFQPYFKGEIFLDEEKKFYGPQRRKMMFMGFVRLGVWY
    NFFRARSGGFSGNLEGEGFVLGGVFVVGPGKQGILLEHREKEFGDKVNPVSVLEAVRKIKPHTSASEKK

    >gi|194042203|ref|XP_001926056.1| PREDICTED: similar to SFLQ611 isoform 5 [Sus scrofa]
    MSFLQDPSFVTMGMWSIGAGAIGAAALALLLANTDIFLPKPQRATLDYLEDIDLKTLEKEPKTFKAKALWEKTGAVIMAV
    RRPG
    CFLCREEAADLSSLKPRLDELGVPLYAVVKEQVKNEVKDFQPYFKGEIFLDEEKKFYGPQRRKMMFMGFVRLGVWY
    NFFRARSGGFSGNLEGEGFVLGGVFVVGPGKQGILLEHREKEFGDKVNPVSVLEAVRKIKPHTSASEKK

    >gi|194042205|ref|XP_001926077.1| PREDICTED: similar to SFLQ611 isoform 6 [Sus scrofa]
    MSFLQDPSFVTMGMWSIGAGAIGAAALALLLANTDIFLPKPQRATLDYLEDIDLKTLEKEPKTFKAKALWEKTGAVIMAV
    RRPG
    CFLCREEAADLSSLKPRLDELGVPLYAVVKEQVKNEVKDFQPYFKGEIFLDEEKKFYGPQRRKMMFMGFVRLGVWY
    NFFRARSGGFSGNLEGEGFVLGGVFVVGPGKQGILLEHREKEFGDKVNPVSVLEAVRKIKPHTSASEKK

    >gi|47522916|ref|NP_999215.1| glutathione S-transferase omega [Sus scrofa]
    MSGGSARSLGKGSAPPGPVPEGLIRVYSMRFCPFAQRTLLVLNAKGIRHQVININLKNKPEWFFQKNPSGLVPVLENSQG
    QLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELSSKVPPLLIRFIRRENEADCSGLKEELRKEFSKLEEVLTKK
    KTTYFGGSSLSMIDYLIWPWFERLEALELNECIDHTPKLKLWMAAMMKDPAVSALHIEPRDLRAFNDLYLQNSPEACDYG
    L

    >gi|194040797|ref|XP_001924181.1| PREDICTED: hypothetical protein [Sus scrofa]
    MAQAFVNSKIQPGKVVVFIKPTCPFCRKTQDLLSQLPFKEGLLEFVNITATSDTTEIQDYLQQLTGARTVPQVFIGKECI
    GGCTDLESMHERGELLTHLEQIGALK

    >gi|194033639|ref|XP_001927971.1| PREDICTED: similar to prostaglandin E synthase 2 [Sus scrofa]
    MAHAARVLWPSGRALAWRLGGRPSLRLPEQSRAGFTGAAGGPGPTATTRKGGPRLLGAAALALGGALGLYHTVRWHLRAQ
    DLRAERTAAQLLLSSRLQLTLYQYKT
    CPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILLAQEGDSLQQLN
    DSSVIISALKTYLVSGQPLEDIVTYYPPMKAVNEQGKEVTEFCNKYWLMLDEKEAQRMYGGKEARTEEMKWRQWADDWLV
    HLISPNVYRTPAEALASFDYIVKEGNFGTVEGAMAKYMGAAAMYLISKRLKSRHHLQDDVREDLYEAANKWVAAVGKDRP
    FMGGQKPNLADLAVYGVLRVMEGLEAFEDLMRHTHIQPWYLRVEKAIAEAVQ

    >gi|194035117|ref|XP_001927634.1| PREDICTED: similar to CG12279 CG12279-PA [Sus scrofa]
    MVLQRLLLGSARQAILGSAEVAFWGLKSIKGSYHNFCTAECKDVTYTELKSLLKSKKIMLIDVRETWEILEYGKIPGSVN
    IPLDDVGKALQMSPKDFKEKYNEVKPSQSDSLVFS
    CLAGVRSKKALNTAVSLGFNSAQHYAGGWKEWATYEFSEKKQGN

    >gi|47523692|ref|NP_999478.1| thioredoxin [Sus scrofa]
    MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVASECEVKCMPTFQFF
    KKGQKVGEFSGANKEKLEATINELI

    >gi|194041947|ref|XP_001929177.1| PREDICTED: similar to arsenic (+3 oxidation state) methyltransferase [Sus scrofa]
    MATGTPDSQARFGQSVKGLLTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQ
    YQQEAIQKKSRASDLRRWAGNQACLLRGGAACVLGLERWLRRTQVLESGDRGDMACPRSDAEIQKNVQTYYGQVLKKSAD
    LQTNACVTAARPVPKHIRKALQNVHEEVSLRYYGCGLVIPECLENCWILDLGSGSGRDCYALSQLVGEKGHVTGVDMTEG
    QVEVANKYIDYHMEKYGFRTPNVTFIHGYIEKLGEAGIKNESYDIVISNCVINLVPDKQQVLQEVYRVLKHGGELYFSDV
    YASLELPEEIRTHKVLWGE
    CLGGALYWKDLAILAREIGFSPPRLVAANFITIQNKELESVVGDCRFVSATFRLFKLSKTG
    PTKRCKVIYNGGITGHEKELIFDVNFTFKKDETVEVDEETAAILKNSRFTQDFLIRPIEEKLPICGGYTALETKDKITDP
    FKLAEESDSAKSRSSPDVAGGCCGTKKC

    >gi|194037976|ref|XP_001925820.1| PREDICTED: similar to Thioredoxin domain-containing protein 5
    CGHCQRLQPTWNDLGDKYNSMEDARVYVAKVDCTAHSELCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFKTLENWMLQTL
    DEAPPTSEPEAEPPRAPELKQGLYELSASNFELHVAQGDHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSATVKIGKVDCT
    AERDLCSKYSVRGYPTLLLFRGGKKVDQYKGKRDLDSLREYVQAQLQSAGPGTPETAQPSEAPAPATEPAAEQGAVLALT
    EDNFDDTVAEGVTFIKFYAPW
    CGHCKNLAPIWEQLSRKEFPGLAGVKIAEVDCTAERDLCSKYSVRGYPTLLLFRGGKKV
    GEHSGGRDLDSLHRFVLRQAKDEL

    >gi|194038359|ref|XP_001929028.1| PREDICTED: similar to glutaredoxin 5 [Sus scrofa]
    MSASLGRAAAALLRWGRGVGGGLWVPGVRAASSGGSGSAEHLDTLVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVR
    DYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALLDEKTDQDSK

    >gi|194037980|ref|XP_001925888.1| PREDICTED: similar to bone morphogenetic protein 6 [Sus scrofa]
    MVVASSQEVRVTDTDPLYIEEDMILCRNCSRCGHCQRLQPTWNDLGDKYNSMEDARVYVAKVDCTAHSELCSAQGVRGYP
    TLKLFKPGQEAVKYQGPRDFKTLENWMLQTLDEAPPASNDSCRSLSFNPIVEYDKELSPRQRHHKEFKFNLSQVPEGEAV
    TAAEFRIYKDCVVGSFKNQTFLISIYQVLQQRQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVLTPQHNLGLQLGV
    VTQDGLSISPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTARSATGRRRQQSRNRSTQAQDVSRASSASDYNSSELKTA
    CRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYF
    DDNSNVILKKYRNMVVRACGCH

    >gi|194037982|ref|XP_001925942.1| PREDICTED: similar to Thioredoxin domain-containing protein 5 precursor (Thioredoxin-like protein p46) (Endoplasmic reticulum protein ERp46) [Sus scrofa]
    MSGCDKGAFVKATPELIDLDVFGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSATVKIGKVDCTQHYELCSGNQVRGYP
    TLLWFRDGKKVDQYKGKRDLDSLREYVQAQLQSAGPGTPETAQPSEAPAPATEPAAEQGAVLALTEDNFDDTVAEGVTFI
    KFYAPW
    CGHCKNLAPIWEQLSRKEFPGLAGVKIAEVDCTAERDLCSKYSVRGYPTLLLFRGGKKVGEHSGGRDLDSLHRF
    VLRQAKDEL

    >gi|194040582|ref|XP_001925334.1| PREDICTED: similar to ATPase, Cu(2+)-transporting, beta polypeptide [Sus scrofa]
    MDAAMERAGDQMPGSSESSCLATLDDPQVILLSVHKQWSFRRSPGAKSSTRPVISEGEDPLSSEAEFPQKVLNRTQEIGS
    NQLQPRWASVLSVFIFHWGAGEAAHGSGGGRRGAREDRRNRKWISVQDAAMLDALTDGRLFESILSKLSWPTHAREPKMK
    QSFAFDNSGYEEGLDGVCPSQTASGTIRVGGMTCQSCVKSIEGRVSSLKGILSVTVSLEQGSAAVRYVPSVLSLPQVCRQ
    IEDMGFEASVEEGKAASWPSRVSPAPEAVVKLRVEGMT
    CQSCVSSIEGRLRKLQGVVRVRVSLGNQEAVITYQPYLIQPQ
    DLREHVNDMGFDAVIKNKVAPVSLGPIDVGRLQSTHPKAPPAPADQNGSSAESSGRQGVTLHLRVDGMH
    CKSCVLNIEEN
    IGQLPGVQSIRVSLEKRTARVQYDPSCVSPGALQAAIEALPPGNFRVSLPDGAAEGTGTDARSRPHRSPGPPWSPPAPGV
    CCTAELAIRGMTCASCVQSIEGLVSQKEGVYHISVSLAERTGTVLYDPLVTQAEELRAAVEDMGFEASVLAENCSSNHVG
    NHSAENATGSTAVGTPMPVQEGAPHPGVLPTNHHPGRASEIPQASAAVAPQKCFLQITGMTCASCVSNIERNLQKEAGLP
    RSPALFPSYPPPPQPSPPTCSSCLAAPNHHGALEQP

    >gi|194040584|ref|XP_001925386.1| PREDICTED: ATPase, Cu++ transporting, beta polypeptide [Sus scrofa]
    MVNDRRNITWSRRTPRQGILSVLVALMAGKAEVKYNPDVIQPLEIAQLIRDLGFEATVLEDYKGSDGDLELVVTGMTCTS
    CVHNIESRLTRTNGVTYASVALATSKAHVKFDPELIGPRDIVRIIEEIGFHASLAQRNPKAHHLDHKVEIKQWKNVPLLT
    VFQFLGGWYFYVQAYKSLRHGAANMDVLIVLATSVAYAYSLVILVVAIAERAERSPVTFFDTPPMLFVFIALGRWLEHVA
    KSKTSEALAKLMSLQATEATVVTFGKDNLIVREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGSTMADESLITGEAMPV
    TKKPGSTVIAGSINAHGSVLVTATHVGNETTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIVIGF
    VDFGVVQKYFPNHSKRISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTV
    MFDKTGTITHGVPKVMRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETLGYCTDFQAVPGCGIGC
    KVSNVEGVLAQGERQQGRPTAHLNGVSSMPSETDAAPQTFSVLIGNREWMMRNGLTVTSDVSDAMTNHEMKGQTAILVAI
    DGVLCGMLAIADAVKQEAALAVHTLKSMGIDVVLITGDNHKTARAIATQVGINKVFAEVLPSHKVAKVQQLQNEGKRVAM
    VGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRLNLVLALIYNLVGIPIAAGVFM
    PIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLARYEAQAQGRMRPLSASQVSVHVGMDDRRRDPPRAAPWDQVSY
    ISQVSLSSLKSDKLSRHSIAADDRGDKWSLLLNDRDEEQCI

    >gi|194041988|ref|XP_001927323.1| PREDICTED: similar to glutathione S-transferase omega 2 [Sus scrofa]
    MLTEELSKEPLYCWAVGSVSLILDVEEIEPDVVPPEFKARAAVLDHFSSAPLGPCCSKVEFGARAGRGHQSSVVLGGCGS
    SSKPHGRGCERWPLRKHRENVTDDATRTLGKGSLPPGPVPEGLIRIYSMRF
    CPYAHRTRLVLRAKGIRHEVVNINLRNKP
    EWYFTKHPFGQIPVLENSKCQLIYESVIACEYLDDAYPGRKLYPYDPYERARQKMLLELFYKVPHLTKECLVALRCGREC
    ADLKLALRQEFCNLEEILGYQNTIFFGGDCISMIDYLFWPWFERLDVYGIADCVNHTPALRLWIAAMKQDPTVCALLIDK
    NIFLGFLNLYFQNNPDAFDYGLNC

    >gi|194041992|ref|XP_001929519.1| PREDICTED: similar to glutathione S-transferase omega [Sus scrofa]
    MSGGSARSLGKGSAPPGPVPEGLIRVYSMRFCPFAQRTLLVLNAKGIRHQVININLKNKPEWFFQKNPSGLVPVLENSQG
    QLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELSSKVPPLLIRFIRRENEADCSGLKEELRKEFSKLEEVLTKK
    KTTYFGGSSLSMIDYLIWPWFERLEALELNECIDHTPKLKLWMAAMMKDPAVSALHIEPRDLRAFNDLYLQNSPEACDYG
    L

    >gi|194037642|ref|XP_001924178.1| PREDICTED: hypothetical protein [Sus scrofa]
    MNGAEELPEMYDYDLIIIGGGSGGLAAAKEAARFNKRVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQAL
    RDSRNYGWNVEETIKHDWERMTEAVQNHIGSLNWGYRVALREKKVTYENAYGQFVGPHRIKATNNKGKEKIYSAEKFLIA
    TGERPRYLGIPGDKEY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
    EEHGVKFIRQFVPIKVEQIEAGMPGRLRVTAKATNSDETIEGEYNTVLLAIGRDACTRNIGLETVGVEIXXXDWKNTCDG


    >gi|194034444|ref|XP_001928284.1| PREDICTED: similar to Trx-like protein [Sus scrofa]
    MAPSGSPMVPLAVLLLLLWEAPWTHGRRSDVRIITDENWKELLEGEWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNV
    AKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISEKEWKSIEPISSWFGPGSILMSSMSALFQLSM
    CIRTCHNYFIEDLGLPVWGSYTVFALATLLSGLLLGLCMIFVADCLCPSKRRRPQPYPTKKLLPESSQPLKKVEEEQEAD
    EEDVSEEESESKEGTNKDFAQNAIRQRSVGPSLATDKS

    >gi|194041571|ref|XP_001924212.1| PREDICTED: similar to peptide methionine sulfoxide reductase, partial [Sus scrofa]
    KHHVNGNRTVEPFPEGTQMALFGMGCFWGAERKFWTLKGVYSTQAGFAGGYTPNPTYKEVCSGRTGHAEVVRVVYQPEHI
    SFEELLKVFWENHDPTQGLRQGQDHGSQYRSAIYPTSAEHMEAALRSKEDYQKVLSEHGFGLITTDIREGQPFYYAEDYH
    QQYLSKNPDGYCGLGGTGVACPLGIRK

    >gi|194037237|ref|XP_001926486.1| PREDICTED: similar to Mercaptopyruvate sulfurtransferase [Sus scrofa]
    MAPQQLFRALVSAQWVAEALRAPRAGQPLQLLDASLYLPKQGRDARLEFEARHIPGAAFFDLDQCSDRTSPYDHMLPSAA
    QFAEYTGRLGVSAATHVVVYDASDQGLYAAPRVWWMFRAFGHRTVSLLDGGLRNWLRQGLPLSAGKSRPVPAEFHAVLDP
    TYVKTYEDIKENLESRRFQVVDARATGRFRGTEPEPRDGIEPGHIPGTINIPFTEFLTPEGLEKSPEEIRRLFQEKKVDL
    SLPLVAT
    CGSGVTACHVALGAYLCGKPDVPIYNGSWVEWYMRAQPEEIISEGRGKTH

    >gi|194037239|ref|XP_001926338.1| PREDICTED: similar to Thiosulfate sulfurtransferase (Rhodanese) [Sus scrofa]
    MVQQVLYRALVSTKWLAESVRTGKLGPSLRVLDASWYSPGTRDARKEYLERHVPGASFFDIEECRNRESPYEMMLPTEAG
    FADYVGRLGISNNTHVVVYDGDNLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSHPEPAIFKATLDRS
    LLKTYEQVLENLESKRFQLVDSRAQGRYLGTEPEPDAVGLDSGHIQGSVNMPFMNFLTEDGFEKGPEELRAMFEAKKVDL
    TKPLIAT
    CRKGVTACHIALAAYLCGKPDVAIYDGSWFEWFHRAPPETRVSQGKGGKA

    >gi|47523090|ref|NP_999051.1| glutathione peroxidase 5 [Sus scrofa]
    MTVQLGAFYLFPLFMAGFVQTNSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPEL
    NTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSEL
    IGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

    >gi|194044822|ref|XP_001927404.1| PREDICTED: similar to peroxiredoxin 4 [Sus scrofa]
    MEAPPPPPPATTLASGRGRKLLLLPLLLFLLRAEALWGLEAEERPRTREEECHFYAGGQVYPGEASRLSVADHSLHLSKA
    KISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAW
    INTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTD
    KHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|194042053|ref|XP_001929043.1| PREDICTED: similar to NHL repeat containing 2 [Sus scrofa]
    MAAPGARSCSLSGLLPAQTSLEYALLDAVTQEEKDSLVYQYLQKVDGWEQDLSVPEFPEGLEWLNTEESISIYKDLCGKV
    VVLDFFTYC
    CINCIHLLPDLHALEHTYSDKDGLLIVGVHSAKFPNEKVLDNIKSAVLRYNITHPVVNDAEASLWQELEVS
    CWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIKDNKIGIKLYKDSLTPSPLLFPGKVTVDHVTNRLVI
    ADTGHHRILVVWKNGQIQYTIGGPNPGRKDGIFSESTFNSPQGVAIRNNIIYVADTENHLIRKIDLEAEMVSTVAGIGIQ
    GTDKEGGANGEEQPISSPWDVVFGRSGSEAPGDDILWIAMAGTHQIWALLLDCGRLPKKNELKKGTCLRFAGSGNEENRN
    NAYPHKAGFAQPSGLSVASEDPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNLFAFGDVDGVGINAKLQHPLGV
    TWDEKRNLLYVADSYNHKIKVVDPKTKSCTTLAGTGDAGDTIGSSFTKSTFNEPGGLCIGENGQLLYVADTNNHQIKVMD
    LETKTVSVLPVFRSESAMVDGPILAEKRTLPKLPKSAPGIRLSPVAASPGQTLQFKLRLDLPSGTKLTEGAPSCWFLSAE
    GNEWLLQGQIPSGEIESISNQPTISLQIPGDCVSLEVVLSISVFLYYCSTDSSACMMKGILFSQPLQITNTQQSYIAPVE
    LKYIF

    >gi|194041281|ref|XP_001924412.1| PREDICTED: similar to ubiquitin-activating enzyme 3 [Sus scrofa]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLETCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRILQWPKEQPFGEGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQARLLTSVCKRTTAQEVT
    PTLQSKRMRGAACSRVNSLSAREAAAAYETETESTGSKATPIRLPALSFPIQPSLLN

    >gi|194036918|ref|XP_001928194.1| PREDICTED: similar to KAT protein [Sus scrofa]
    MLRAPRGRSGATFLKLAFAARTMAGEPTVSLSELRSLLASGRARLIDVRSREEAAAGTIPGALNIPVSELESALQMEPAA
    FKALYSAEKPKLEEENLIFF
    CQMGKRGLQATQLAQGLGYKGARNYEGAYREWFQKEG

    >gi|194041676|ref|XP_001928588.1| PREDICTED: similar to O-6-methylguanine-DNA methyltransferase isoform 1 [Sus scrofa]
    MGKTCEMGRAVVDSPLGKIEISGCEQGLHEIRLCGRKTLDPDPAEAPAPPKQLAGPEEMMEPLGQCAAWLDAYFRKPAVL
    QELPVPALHHPLFQQESFTRQVLWKLLQAVKFGETVSYQQLAALVGSPRAARAVGGAMRSNPVPILVP
    CHRVVLSSGATG
    NYSGGMAVKEWLLAHEGRLAGKLACGGGSRPAGASRQALRGGSTRSQAAGQD

    >gi|194041678|ref|XP_001928595.1| PREDICTED: similar to O-6-methylguanine-DNA methyltransferase isoform 2 [Sus scrofa]
    MGKTCEMGRAVVDSPLGKIEISGCEQGLHEIRLCGRKTLDPDPAEAPAPPKQLAGPEEMMEPLGQCAAWLDAYFRKPAVL
    QELPVPALHHPLFQQESFTRQVLWKLLQAVKFGETVSYQQLAALVGSPRAARAVGGAMRSNPVPILVP
    CHRVVLSSGATG
    NYSGGMAVKEWLLAHEGRLAGKLACGGGSRPAGASRQALRGGSTRSQAAGQD

    >gi|156120144|ref|NP_001095289.1| molybdenum cofactor synthesis 3 [Sus scrofa]
    MAAREEVLALQAEVARREEELSSLKHRLAAALLAEQESERLLPVSPLPPKAALSQDEILRYSRQLVLPELGVQGQLRLAT
    ASVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEVSNLARQVLHGEALAGQAKVFSAAASLRRLNSAVECVPYAQALT
    PATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYGGGPCYRCVFPQPPPAETVTN
    CADG
    GVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGLFRRIQLRRRRPDCAACGERPTVTELQDYEGFCGSSATD
    KCRSLQLLSPEERVSVIDYKRLLDSGSPHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLGEAIREGKQGTQE
    GASLPIYVICKLGNDSQKAVKILQSLPDLDSLLVQDVVGGLMAWAAKVDGTFPQY

    >gi|194042537|ref|XP_001927849.1| PREDICTED: similar to ERO1-like protein beta precursor (ERO1-Lbeta) (Oxidoreductin-1-Lbeta) (Endoplasmic oxidoreductin-1-like protein B) [Sus scrofa]
    MSWGVQRAGAGQGAAAAVQLLVTLSFLPRVVEAQVTGVLDDCLCDIDSIDNFNTFKIYPKIKKLQERDYFRYYKVNLKRP
    CPFWAEDGH
    CSIKDCHVEPCPESKIPVGIKAGSSNKYLKVANNTKELEDCEQASKLGAINSTLSNQSKEAFIDWARYDDS
    QDHFCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDNGESFYTWLEGLC
    LEKRVFYKLISGLHASINLHLCANYLLKETWGKPSWGPNMKEFKRRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPY
    FERSIVDLYTGNVEEDADTKTLLLNIFQDTKSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWG
    KLQTQGLGTALKILFSEKEIQKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKVLLQHSR

    >gi|194033756|ref|XP_001924886.1| PREDICTED: similar to Thioredoxin-like protein 4A (Thioredoxi
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY