Strongylocentrotus purpuratus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|72010836|ref|XP_786637.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAAPMEHTSSTASEKKPSKKKPCRACTDFRSFAQDKGVMLPPGFPVPNGSNSQGATPAQDEKPDRECPLDREELGRNTWS
    FLHTTAAYYPDQPTKTQQSEMSQFIHLFSKFYP
    CEDCSEDLREKLKTNHPDTTSRSNLSQWFCRLHNDVSRRLSKPEFDC
    SKIDERWLDGWKDGSCDW

    >gi|115958268|ref|XP_001176440.1| PREDICTED: similar to thioredoxin peroxidase [Strongylocentrotus purpuratus]
    MAAKARVQDPAPYFEGTAVSTTGEFVDVKLSDYKGKYLVFFFYPLDFTFVCPTEILAFSDRSDEFTKIGCEVLAASCDSH
    FCHLAWTNTTKKLGGVGQLKIPLLSDMSGKIARDYGIMIEKEGISLRGLFIIDDKGTLRQITINDLPVGRSVDEVLRLVQ
    AFQFTDKFGEVCPAGWKPGDDTIKPGVKESKEFFGKQ

    >gi|115968755|ref|XP_001192464.1| PREDICTED: similar to Chloride intracellular channel 2 [Strongylocentrotus purpuratus]
    MLNPAGWNPLAVFVHGKDVCTHVSSFNRVDCKVEAASTAFTVMTKGMPLRNQAGVTSKIADCPLCQRLFMIIVLKKIKYQ
    VCTVNKEILPAEYKKILGNTPPPVLVDPNVQTDNALGKVIDDIIKAEHYLESVFQPKLENANPAAKKVGSNIFSKFSALM
    KNQDKSKKEVLINRLRGELKKLDDFLKDTSEDDELSPGRCLEGDNFTLADCDLLPKLHRVEVACKFFKFEGVMDGFDAVQ
    RYLDAWKETPVYHIIKYDEKEVFNTYRFVVMKS

    >gi|115937279|ref|XP_001194175.1| PREDICTED: similar to MGC81821 protein [Strongylocentrotus purpuratus]
    MARMLSRDIADIENLLALNPTVPSHAKVVLTKTTKANRKYWKRNGPKSCATCGDLDNNFDDVKHTTLSERAALREAARCL
    KCADAPCQKSCPTQLDIKAFITSIANRNYYGASKAIFSDNPLGLTCGMVCPTSDLCVGGCNLYASEEGPINIGGLQQFAT
    EIFKEMKIPQIRDPTLPSHDDLPESYQSKVALIGCGPASISCATFLARLGYTNLTVFEKEEWIGGLSSAEIPQFRLPYEV
    VSFEVDQMKDLGVKVELKKGLGMNGMTLESLKISGHEAIFVGLGLPEAKRAPIFQDLTVEQGFYTSKDYLPLVSLASKAG
    M
    CACKTSLPKLDGNVIVLGAGDTAFDCATSAVRCGAKRVFIVFRKGFTTIRAVPEEMDVAREERCEFMPFLSPRKVILKG
    GRIAALELCRTEQDDEDNWIEDEEQTTRLKADFIISAFGSTLLNEEVKTALSPIRFNRWGLPEVSTDTMQMSEPWAFCGG
    DLGGVAQTTVESVNDGKTAAWFMHKYLQSLHGVPVPSTPALPKFCTPIDLVDTSVEICGLKFPNPYGLASAPPTTSAPMI
    RRAFEAGWGYAVTKTYSLDKDFVTNVSPRIVRGTTSGNVYGPGQGSFLNIELISEKTAAYWCKIVTELKRDFPDRIVIAS
    IMCSFNKDDWTKLAKMSEEAGADALELNLSCPHGMGEKGMGLACGQDPELVLNICRWVRAAVKIPFFAKLTPNVTNILDI
    ARAAKEGNADGVTATNTVSGLMGLKASSNAWPAVGKQKKTTYGGVSGNAIRPIALKAVSVIANNLPGFPILATGGIDSAE
    SALQFLHAGASAVQVCSAIQNQDFTLIEDYVTGLKALLYLNSLDDLGDWDGQSPPTVRHQKGKLVRVADVIGKVRMMIMM
    KVMMIRRMVGLLMFLQGGMR

    >gi|115753806|ref|XP_001193617.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAATWTQVWTPVHEPGGSTEEEENLRGWVSNTDEAEDVKEQLQVAECITFVGDRKGKGFGNGILHLQNPDGKLIHMPRVR
    FSDIKDNVVSADSVPFAIVSRYSLRCMYGKDKNQAAKRKNEELAEKAMKMYWKTQSFLQSSFQVKFQTNDDSGMSKRAIS
    DHIRADLRKGDKFNFERRIYIRLPSKTDHQSVHTLGKLTGFMNPMHKTVSTKLVDLVGHGVTNLNEMKRHLRAHLHTVLF
    PDVEKRPSITDTAFYPSDNTIRQRMYAARMQLRIMAEAGEKETHDQFEKRFSTLVIHGFVSLSTSLGIQSGLFEALIKLK
    DEERTVKEIADTAGLKERYVQEWLGVMVAADIVDINPETEKYSLPPHRIPFFQPGSSVSDLGVLLTELPTFGGLYKKLLD
    CLKKDGPQGLSYSEYTDFHTVMSNHSSIWVLQHLVQDFIPSMPQIEERMKSGIRILDLGCGRGLASLAFAESYPNSTVVG
    LDFSEEAINYGKERAKEKGLTNVEFIREDAACIPDDWNNTIDYIYTFNVIHDLAHADKVLLALNRILKPDGVFSMIDIDC
    KTKHSENASNEYCSMLYTMSLFH
    CLAISLFFEGSVGLGTCWGREKATEFLKDAGFQVDSITKPVGSSQAHYMCTKILK

    >gi|115939548|ref|XP_001191144.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAARQLLQRGLLRQTSWTLGRKVCPGPVSMVTGLKPASVAPIVQRLPQFINSSAPFHSSSHCLDENSFIIQDRDDFQEKV
    LNSKSPVIVDFHAEW
    CNPCKALAPVLDAVLQNTKGQVKLAKVDIDELQDLAIGFGVDSVPTIMAFKGGQKVSKFIGNQSK
    EKVEAFVEKLLT

    >gi|115950168|ref|XP_001180389.1| PREDICTED: similar to ubiquitin-activating enzyme E1-like 2 [Strongylocentrotus purpuratus]
    MATSDVTFDGEPGIWNGAPTVDLENHTHVQICANHTSWNATTTDTYWNTDMADTICQYFGFTGSMIIEVMDFAAPGFAMC
    KKEQNNTDSRLQLSCKFLEVCVGVPIISCLLPGYEGCYTQTATDPFFTNGSLADLGDQQVNIQTCAEACSDSPYLGLTNG
    SNCICGSGLGNRSLVGDCDLGCQGDDLQQCGGEEATSVYSASVIGQCESERVEIIPDQPHYITSPNFPDIYEANVSCSWI
    LDINVPLFHDLEIITTFDFEDDNIQHLDISSESNLVELTPAGTSGTTVLSRTPYSTLQDTITVSLTPSSGGNSTIFVMKF
    TLMSNTMYTPANDYTTAPPPESTTSKAGQNVNLGKLAMSAGLGVILAAILLLTKKETSPKHGLAPDNVPASKHTKMADNA
    DIDDSLYSRQRYVLGDHAMKQMATSNVFLSGLGGIGVEIAKNIVLAGIKSLTINDGKSCSVKDLGTQFFLREQDAKANKT
    RAQATYSRLAELNPYVSIKLSQQTLADNSDLTFLKQFQCVVLTETPLGLQLKINEFCRAQTPQIKFIAADVYGLYSYCFC
    DFGDEFTVQDVNGEEPMQVFIADVTKDNPGVVTCLDQQYHGLETGDYVTFKEVKGMTALNDARHKVKRISPYKFSIEDTS
    GDGFQPYETGGIAIEVKVPSIVKFLPLRDQLTNPSAILVDFTKDLMVSHLAMYALQQFREENGKLPSVRNDDDKDAFVKI
    AMRLNDTLADPIPSPSTKQLASLAYSAEGCFAPLCAALGGFVAQEVLKALTGKFTPLKQWVHLDSSEVLKGLENESADNF
    MPKGDRYDALRICIGDNLVQKIASQNLFMVGCGAIGCEMMKNFAMLGVGVQGGKITVTDNDIIEKSNLNRQFLFRPHHIQ
    KPKSETAAQSTRDINPDMKIEAHQNKICPQTETTIYTDAFFEGLDVVVNALDNVEARRYVDSRCVTNQKPLMESGTLGAK
    GHVQVIVPHLTESYGSKQDPPEQSIPY
    CTLKSFPAQIEHTIQWARDKFESLFAQKPSMYTKYWEVSGAPEDVVKKLESGE
    SLENTLPVTKYLNNRGTSWQDCVRIARIKFEKYFNHKANQLLHAFPLDAKTSDGGMFWQSPKRRIVTDESEGKEGEEDES
    TDMSSASKEITAAIRSGKAVPGLLRLTPAEFEKDDDSNGHIDFITAASNLRANMYSIENADRFKTKLIAGKIVPAIATTT
    AAVAGLSTIEMVKYIKGTAKMEDYHNCFLNLALPMVMFSEPARTVTTKLKQGLTYTEWDRWTVQGSKDFKLQDFNQYFKD
    TYQLDVSMVAIGAKLIYLPVLPGHPKRLKQK

    >gi|115939550|ref|XP_001191190.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAARQLLQRGLLRQTAWTLGRKVCQGPVPMVTGLKSASVVLVVQRFPQFINSSAPFHSSSHCLDENSFIIQDRDDFQEKV
    LNSKSPVIVDFHAEW
    CNPCKALAPVLDAVLQNTKGQVKLAKVDIDELQDLAIGFGVDSVPTIMAFKGGQKVSKFIGNQSQ
    EKVEAFVEKLLT

    >gi|115934350|ref|XP_001186914.1| PREDICTED: similar to ubiquitin-activating enzyme E1 [Strongylocentrotus purpuratus]
    MSASSSDAQTSPAAKKRRLEQESNNTNQNSVNSNNREMAKNGGQDEIDEGLYSRQLYVLGHEAMKRMAVSNILISGVKGL
    GIEIAKNVVLGGVKSVVIHDEEDVSIQDLASQFFFREADVGKNRAEVTEPRLAELNNYVSVTISKSPLNEQFMSKFQVVV
    LTTSSLEAQLRIGDFCHSKGIHLIIADTRGLFGQVFCDFGDDFTVYDSTGEEPMSVMVSAVSKDDQGVVTCLDESRHGFE
    SGDYVSFSEIKGMTELNGCQPKKIKVLGPYTFDIGDTSDLSDYVRGGIVSQVKMPEKVTFKSLRESLAEPEMIITDYAKF
    DRPGQLHIGFQALHKFKTKYGTLPRPRNEDDAAKMIALAKEINSQASDASKQESIDEKLLTQLAYNACGDICPIQAVIGG
    MAAQEVMKACSGKFNPIKQWVYFDALECLPEDESATPTEASCQPTNSRYDSQTAVLGADFQKKMAAQKYFMVGAGAIGCE
    LLKNFAMMGLGSAPEGKIYVTDMDIIEKSNLNRQFLFRPHDVQKPKSDTAAKAAKEMNPEINIIPHLNRVGPETENVYDD
    DFFQSLTGVANALDNVDARMYMDRRCVYYRKSLLESGTLGTKGNVQVVLPFLTESYSSSQDPPEKSIPI
    CTLKNFPNAIE
    HTIQWARDMFEGLFRNPAENAAQYGTDPKFMERTLKMPGCQPIEVLELLKRALIDDRPKSLEDCISWTRHHFESQFVNQI
    KQLLFNFPADQTTSSGAPFWSGPKRCPHPLLFNPDNDMHLSYIVSTSNLLAAVYGLEGNRDDSYFRKVLQSIDVPVFTPK
    AGVKIAVNDAEAQAAAEANADDARLREIVDSLPTPEQLKQITIKPLDFEKDDDTNFHMDFIVATSNLRAENYGISPSDKH
    KTKKIAGKIIPAIATTTSVVAGLVCLELIKLVNQNKKMESYKNGFINLALPFFGFSEPIAPSKMKYYDTEFSLWDRFEVN
    VSDKEMTLKGFLDHFQNDHKLEITMLSQGVCMLYSFFMPAAKLKERLPIKMSEVVTKVSKKKIPKHVKSLVFELCCNDTE
    GEDVEVPYVRYTFR

    >gi|72013805|ref|XP_786989.1| PREDICTED: similar to intermediate chain 1 [Strongylocentrotus purpuratus]
    MPAKKETISLQKEILNQEMWDELLSLEGLTVIDVYQKWCGPCAAVLSLFKRLRNEVGDDLLRFAVAEADSIESLERYRGK
    CEPSFLMYGSGQLVNVVRGANAPKLLKDVERELKQEHKVLEEGVERVVIKDPLLAAFEAEEHQAAQAEEVEKKKQEEDAR
    IKEIKELGDEGEVSVRPVSQGTVDTLMHDRQDGSKTEPLPKEVTVVLIKPDAVASGHVDDIIAKIEEHGFEILATEDKTL
    TEEEAREFYKQHQEEDHFEELVTFMASGPSKILVLTRGNTGEGVVSDIRNLLGPKDIEVAKEQAPESLRAQFGTDKKMNA
    MHGADSSETAARELAFLLPNFSIPLVPGTGPPPIVEKTLALIRPSALKDHKDEMLQKIQEAGFEVCLQKMVQLTEEQAKD
    FYKEQEGTAHFEDLIREMTSGEVLALGLAKESAIQSWRDFIGPTIIDEAKEKAPESLRAQYSVPDTQVNVVHGSDSVDNA
    EKELGFFFPKQSTLAVIKPDAAGEHKEAIIEKIKEAGFNISLQRDVELNKELASKLYMEHEGKEFYENLIEHMSSGLSMV
    MVLSREDAVDGWRTLMGPTDPDYAREHAPESLRALLGKDVMQNAVHGSSNPEEAKTRIERLFPDVEVLPGGEVKDSLTSI
    SMEQSHVKGEEGEEGGEQQTEQPAGEGEEQQAEQPAGESGEQQAEGGEAATEGAEQQAEQPPAEGGEKPAEEGETQQTQE
    GEAPAAEQTEQTQEGEEEKPAEEAAPASEEAAAEQAPAAEETQEGEEKKEEQTQDAPAAEGGEAGAMEGEVPVTEGGEAL
    AAAEGEGDAKPEETAS

    >gi|115942350|ref|XP_001192695.1| PREDICTED: similar to LOC496161 protein [Strongylocentrotus purpuratus]
    MAGLISVKSVEDFGKEVDQTVSGLLVVHFRAQWAPQCEQMDGVMVELAKEHTQVRFSTVEAEELPEISKQYSIAAVPTFI
    LIKGKNEVDRLDGANVPELTKKVKHHADPNASPVMLPASSQPPKEDLNTKLKGLINAAPCVLFVKGSRQEPR
    CGFSRTLM
    GLLDERKIDYSTFDILGDEEVRQGLKKYSDWPTYPQVYVNGELIGGLDIIKELDASGELDQSLPKKQDLDDRLKALITRS
    PVMLFMKGSPGEPK
    CGFSRTITSILTGTGLKYDTFDILQDQEVRQGLKTYSNWPTFPQLYVSGELVGGLDIVKNTIMCTP
    NAKDFLKCYLNNVSHEHHLFPRLIYA

    >gi|115712104|ref|XP_794871.2| PREDICTED: similar to mitochondrial truncated thioredoxin-dependent peroxide reductase precursor [Strongylocentrotus purpuratus]
    MSLFHQICRLGVTGARATRFCSGSFSTVCCRATVPKPLASQLLPPYAAAAELGQRAWSCIQRQLSTSCQLNVAIQEPAPD
    FEGTAVIDGQFKEIKLSDYKGKYLVLFFYPLDFTFV
    CPTEIIAFSDRADEFGAINTEVVAASIDSHFSHLAWINTPRKQG
    GLGPMKIPLLSDMKKQIAEDYGVLLKDAGVALRGLFLIDPEGVVRHMSINDLPVGRSVDETLRLVKAFQFVAEHGEVCPA
    GWTPDSETIKPDPEGSKTYFEKVN

    >gi|115696807|ref|XP_791682.2| PREDICTED: similar to LOC495430 protein [Strongylocentrotus purpuratus]
    MELYSTLLIGTFLVVLGGALAQDTKGRGLGEQYDWVTFEDGLKLAKENNKPMMLVIHKTWCGACKALKPKFAASEEILKL
    SSDFVMVNVEDDEEPEGSQFQPDGGYIPRILFLNSDGVVQPDLINTLGNPQYKYFYSNALMVTEAMKSAVKALGGSRNDE
    L

    >gi|115969579|ref|XP_001187596.1| PREDICTED: similar to ENSANGP00000027744 [Strongylocentrotus purpuratus]
    MTCGGCVGAVERVLKRLEGENDVEINLDAKKVYVTTALPSEYVLETLKKTGKATTFVGVC

    >gi|115925087|ref|XP_001175757.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MALLSSRSRMFSRTTVAIAAARRGLFYGNDECTRFSNRARQICTSSTILQADGESSPPVSRFPIPDRKTLPDDVQQVMDE
    VEEKSGFLPNVFKMLSYHPDSFRSFVNYYNVLMENSGNLTKADKEMIVVATSSVNNCMY
    CIIAHSALHRIYSKNPTLADQ
    IVANVDMAALDSRQRAILDLALAVCKNEPITDEHFTNLEAHGLDQEDAFMVGSVAAFFAMSNRLAHLTSSRPNKEFYLLG
    RIPREKK

    >gi|115762093|ref|XP_001201507.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MSRRHLKQGEANPTVKPDVLRLYSMGFCPFAQRALLVLAVKGIDYELVNCNLNHKPEFLLERNPAGTVPVLEFQGNIVTE
    SLVICDLLEDLFPDKPLKAKDPFQKAKNRLAVGKFDSIVSLFYKVGYNPDDADAKETLRKSMKEYQAFFTAKKTNFFGGD
    QWGMVDLMVWPWIERMHVLGAVIIDDFVPEFKAWVDRMGTVPAVQACRISKEKLSEMYTGYFARNAVYD

    >gi|115933957|ref|XP_001191688.1| PREDICTED: similar to glutathione peroxidase, partial [Strongylocentrotus purpuratus]
    WGILFSHPADYTPVCTTELGRVATLTPEFEKRGVKLIALSCDGVESHRGWIK

    >gi|115958713|ref|XP_001195859.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDSFRLKGCGYLVSSTVFLLCCVVCHTNQQATVDLMDSNMDNILQHNDIVFVNFYANWCRFSQMLKPIFEEAAKVAQQEF
    PGQGQVVFGGLDCDKYPALAKKYHISKYPTLKLFRGGQLAKREYRSQRSKDAFVSHIRDNLKDPLVKLTNPDEVPNLDES
    KRKVIGYFKSYEDAEYTAFRRVASSLRDDCSFFAGSGEAFSKELAPGNSIMYRPPRSIDQDMLFMGSMTNVELLRAWSTD
    KCIPLVREITFENGEELTEEGLPFLILFHKPEDTEVVRQYNDMILRELISERGNMNFLTADGTKFTHPLHHLGKTPKDLP
    VIAIDSFRHMYLFPNIADVPVPGKLKQFVLDLHSGKLHREFHHGPDPAIQKTVPGSPKTVIDTDQTDPPESQFVKLMPSE
    NRYSFRDEL

    >gi|115972635|ref|XP_001177338.1| PREDICTED: similar to thioredoxin peroxidase [Strongylocentrotus purpuratus]
    MIRILSLILAVSTLVAAEEACHSFAGGHVYPGETPRSTAHAVHWSKVQISKPAPVFEGTAVVEGEFKAMKLSDFAGKYLV
    LVFYPLDFTFV
    CPTEIIAFSDRVDEFRAINTEVVAISVDSQFTHLAWINTPRTQGGLGPIKLPILSDLTHQIAKDYGVLL
    EDLGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTVSPSIIPNPADKLKYFA
    KQPNGGNA

    >gi|115935984|ref|XP_001185042.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    MRFARCGFLLGVAILAVIICDQQSYAVKKEEQLGERVKQLVEWGNKRAVIRMNGDKYRLYAKSAPRNYSLVIMLTAMQPQ
    RQ
    CSVCKAVGEEFQIMANSWRYSQAYSNRLFFASVDYDEAADVFKSLKINSAPSIIHFPAKGKSKKGDTYDIQRLGFQAE
    NLAKWVAERTDVHIRIFRPPNYSGTIALGILLAMVAGFLYFRRNNLEFLYNKTMWGVGALSIVFAMTSGQMWNHIRGPPY
    AHRNPQNGQVSYIHGSSQGQFVAETHIVILLNAAVTCGIILLNKNSITDGDVRKRRVVTVIGLALVVFFFSLLLSIFRAK
    YRGYPY

    >gi|72007952|ref|XP_786535.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MALSVCRLFTRSRPALAIRRVLSPQSQKASSQNSLERCLARFQGTSSKLYESPTPESKPVSRFPIPERETLPEDIQRIMK
    EVEKQSGFLPNIFKIMSYDPTSFKYFFGYYDHLISDRGNLTKEDKSFISLAVSTENKCIY
    CTVSHRMVFRLNTNDPVLTD
    QMTVNWETADVTDRQRAILEMAMAVTKNEPITDEHFTNLERHGLDQRDAFDIGHYAAFFALANRLAIFTKLRPNDEFSE

    >gi|115894374|ref|XP_782981.2| PREDICTED: similar to Grp58-prov protein [Strongylocentrotus purpuratus]
    MNALLLISLLFGVAYGSDVIDFTDDDFKDNIGDHSLILVEFFAPWCGHCKKLAPEFETAATTLQRESPPIALAKVDCTAN
    TQTCGAYGVSGYPTLKVFRNGEPSDYQGPRESAGIISFMKKQAGPKSVVIATEAQFDDFTSGATAAIVGFFADETSAGLK
    EFKKLTDAFFEEFRFAYTLDSGLAEKHSGTDKVVLFRPPQLASKFEESQAVFDGAIKKKDVEKFIRENVHGLCGYMTADN
    QAQFTKKPLLTAYYNVDYKLDKKVMNVGREFIGSVYLSIASASDFQRKLDDYDTSFDAEGGSPVVAIEGAKGEKFVMPEK
    FTVKTLKAFIQAFVNGELEPFIKSEDIPASNDGPVKVVVGKTFDEIVNDETKDVLIEFYAPW
    CGHCKTLEPKYNELGEAV
    NNNIVIAKMDATANDVPPAFEVRGFPTLYWAPKNNKSSPKKYEGGREVPDFIKFIKKEATSKPVNTGDKTEL

    >gi|47551041|ref|NP_999697.1| ER calcistorin [Strongylocentrotus purpuratus]
    MKYLALCFIALACAVHAAVEVEIEEDVAVLTDAAFADYVAENEFVLVEFYAPWCGHCKSLAPQYSIAAKTLKDSGSSIKL
    AKVDATVETQLPGKYGVRGYPTLKFFRSGKDSEYAGGRTGPEIVAWLNKKTGPPAATIASVEDAEAFLADKEVAVIGFFK
    DVPQTFLDVAVNIDDIPFAIVSDDAVISNYEAKDGSIILFKKFDEGKNVFEGELTSEDLTSFVRKNSLSVVTEFGEETAS
    KIFGGEIKIHNLLFVKKDSDDFKTIYDQFYAAATTFKGEVLFVLIDAAAESNSRILEYFGLGDEEVPTVRLITLDGDMKK
    YKPTVPELTTESLSQFVIDFKDGKLKPHLMSESVPEDWNANPVTILVGENFAEVALDPTKDVLVEFYAPW
    CGHCKQLAPI
    YEELGEHFKEREDVVIAKVDSTKNEVEDAVVRSFPTLKFWKKGENEMVDYSGDRTLEAMIQFVESGGEIIAEVDDEDMEE
    DEEMDEGAEDQAKDEL

    >gi|115955292|ref|XP_001191329.1| PREDICTED: similar to 0-6-alkylguanine-DNA-alkyltransferase [Strongylocentrotus purpuratus]
    MPSLKKAACDLATVVLATPIGHVTITGCEVGVHKICLTAAKTLPQQSTKIVEVHEEPSHWSASLKECSDWLKKYFENANA
    IKGLPLPPLHITEFKSDSFSSQVWTKLASDVPAGQTVTYGELAAMLDNPKGARAVGGAMRNNPTPLVVP
    CHRVLGSGGKL
    GGFMSDKGIVLKEWLLKHEGASY

    >gi|115930505|ref|XP_001177901.1| PREDICTED: similar to Thioredoxin domain containing 9 [Strongylocentrotus purpuratus]
    MDQVLQQQLSLVAEIMEGQVDAEIHRLDNLDEDELDVLRQRRLVALKKQREKEDEWRSIGHGQYQEIPVEKDFFAECKKS
    TNVVCHFYRESAER
    CRIVDMHLHRLAPKHMETRFLKINAEKCPFLAERLRIVVIPTIALIKDGKSKDYIVGFDDMGGRDD
    FPTEMLEWRLGCAEVINYSGSLTDPPTGGKGAKPTSKASDLLGRRTQKIIKGGRYNDSDSDLED

    >gi|115624750|ref|XP_001177235.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MMSPKLRIFVLLLAVLSLSIHVVSSQDDEETEESNVVEEIVEEAFHVEEEDDVLVLTTDNFDDVVNGEDIILVEFYAPWC
    GH
    CKTLAPEYAAAALEMKSATPPVSLAKVDATENKELASRFDVSGYPTLKIFRKGKPFAYDGPREKNGIVQFMKKESDPN
    WTPPPEAVLTLTSENFDDIVNEADLILVEFYAPW
    CGHCKKMAPELETAATALKSNDPPVLIAKVDATAESDLGTRYDVSG
    YPTLKIFRKGKESEYKGPRESRGIIQYMQKQVGDSSQLLGSTKALREFLAHQDDVSIVGFFNSNQDPLYTTYLDAGNGLR
    DNYRFAHVFDQDSRDSYKINAPSVVVFLPERFRSKYEPWRHVFTQTEGSVQDLENFYKENDVPLVGQMTKENRERRYTDR
    PQLVAFFSVDWSFDHRVATEIYRQKIVEVAKDKEFDELHFAIADEEEFAAEMKQLELDDSGEDINVGIFTADGLRFKLEP
    EDDFESDVLREFIRTWQNGDLKPVIKSQPIPKKSKAAVKTIVGKTFEKIVLDKSKDVLIEFYAPW
    CGHCKKLDPVYKKLG
    KKFANTKNLVIAKMDATANDVSNGAYTTTGFPTIYFSKAGDKDNPIKFEGGERSLEKLSEFIEEHATVAVLQDRDEL

    >gi|115637497|ref|XP_786239.2| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    DKPMMLVIHKTWCGACKALKPKFAASEEILKLSSDFVMVNVEDDEEPEGSQFQPDGGYIPRILFLNSDGVVQPDLINTLG
    NPQYKYFYSNALMVTEAMKSAVKALGGSRNDEL

    >gi|115681541|ref|XP_796387.2| PREDICTED: similar to peroxiredoxin V protein [Strongylocentrotus purpuratus]
    MPIKPGNPVPSVEVCENTPGDKVNVAELFKGKTGVLFAVPGAFTPGCSKTHLPGYVGDFDKLKAKGAEVIACVAVNDPFV
    MAAWGKAHEADGKVTIVGTLF

    >gi|115722906|ref|XP_001200801.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAKFFGKVSRGLTTCILVSVLILATEAAKKNVNRKFVADFTDLKEFKKELRTHNNIMVLFSKDAKSAESLMNIYSDVAAE
    MKGLATLAFIDCSEAKKLCKKYKVSPLPTVLKHYKDGDYHKDYDRLMRKKSLINFLRDPEGDVPWEEEPDADDVIHIEST
    KEFEKLISKEKRPVLTMFYAPW
    CGHCKRMKPEFAGAATDLKGDAVLAGMDVDRPENMASRQAYNITGFPTILYFEKGKRK
    FDFGG
    CGHCKKMKPEYVEAAAELKENGLEGVMGAVDATKARALAERFEVKGFPTLKYFKNGEHAWDLNERTADKFVEHLT
    E

    >gi|115943298|ref|XP_791549.2| PREDICTED: similar to interferon gamma-inducible protein 30, partial [Strongylocentrotus purpuratus]
    VQKQCLLWQSEQKAADAPLVRYELYFESLCPGCRQLLTTELYPAWQKVKSIVNVTLVPYGNAIELEVAGKWQYTCQHGPQ
    ECVGNLVETCALSILPFDKAFPFIYCLETNNPATAGSQCAKELGLLSEYPSIQNCSEGSMGNALEHSMALKTEALNPPHE
    YVPWVVLNGAHTNAIQNQAETDSLGLICQAYTGVKPAGCTQEGRMRSPRD

    >gi|115634671|ref|XP_796277.2| PREDICTED: similar to Chain , Thiosulfate:cyanide Sulfurtransfe
    MLERAGHTTVSSHAQYPGLVSTEWLAEAMGTRKTPDGRPFRVLDATRIGMETGKAHIPGSHHIDIHQLSNKDSSYHFTAP
    TPANFAEYVGKTLGIDNDTHVVLYEGKVKVMTAPRMWWMFRLFNHDAVSVLDGGLQQWVAENRTVTEIPTPVPEAVEFKV
    TERREDLFKSYEDVLQNVKDPKFQIMDSRLVEWYDGSQPSVYEGINLGIMKMATNIPFPNVLVDDGSDKFRSPADLRALF
    KSNGIDLSRPLTSS
    CYVGITASILALGAFHAGKEDVGRVWRMQINALPKDISVAAGFKPSTM

    >gi|115634673|ref|XP_796293.2| PREDICTED: similar to Thiosulfate sulfurtransferase [Strongylocentrotus purpuratus]
    MNHTTVSSYAQYPGLVSTEWLAEAMGTRKTPDGRPFRVLDATRIGMETGKAHIPGSHHIDIHYLTDEHSPYGFTAPTPEN
    FADYVGKTLGIDNDTHVVLYEGKVKVMTAPRMWWMFRLFNHDAVSVLDGGFQQWVGENRTVTEIPTPVPEPVEFKVTERR
    EDLFKSYEDVLQNVKDPKIQIMDARLVEWYDGSQPSVYEGINLGIMKMATNIPFTNLLVDDGSDKFRSPAELRALFKSNG
    IDLSRPLTAS
    CFVGITASILALGAFHAGKEDVAVYDGSWEEYSQKGPEDSMNLYTYEKEP

    >gi|115940439|ref|XP_001183380.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDVDDLKELHLLREENARLRLQLEKHELELMKAEDENHSSNDTSAEARPSITHLDNASIKRYSRQLILPELGVKGQLQIA
    NSSALIVGAGGLGCPAAIYLAAAGIGRLGVVDYDEVELSNLHRQILHTEQRVGWSKSDSIKSSIKSLNSSVQCIAYHLQL
    DRNNAMDIIRQYDMVLDCTDNVATRYLLNDACVLAGKPLVSGSALRFEGQLTVYNQGGGPCYRCLYPRPPPADTVTN
    CSE
    GGVLGVVPGIIGCIQALEALKMAAGIGTSYSQKLLLFDGLDGTYRSIKLRPKKPTCDVCGDNPSVTQLIDYEEFCGASAT
    DKCITLHLLEAKDRLSPQTLASQLLSQDSSSRLLLDCRPEIEFEICRLPDSISILDYDYE

    >gi|72012368|ref|XP_781174.1| PREDICTED: similar to Chain A, Nmr-Structure Of Tryparedoxin 1 [Strongylocentrotus purpuratus]
    MALVELLGEKLQGAGGVEIETSSLCGSGKYVGLYFSAHWCPPCRMFTPELAEFYDEFTKKDGNQGKLEIVFVSSDQNADQ
    FKDYFKDMPWKCLPFADRDRKGAVTTKFGVRGIPTLIILDSESGEIVCKDARGHVGSDPDGAKFPWKN

    >gi|115940441|ref|XP_001183425.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MWLLTVYNQGGGPCYRCLYPRPPPAETVTNCSEGGVLGVVPGIIGCIQALEALKMAAGIGTSYSQKLLLFDGLDGTYRSI
    KLRPKKPTCDVCGDNPSVTQLIDYEEFCGASATDKCITLHLLEAKDRLSPQTLASELLSQDSSSRLLLDCRPEIEFEICR
    LPDSINVPIDDIENEKGIPRLKEVVTKQLANQHDNPFPIYVVCRRGNDSQKAVLKLRKELDSLPVAIKDVCGGLTAWTNQ
    VDPDFPEY

    >gi|115760433|ref|XP_001178016.1| PREDICTED: similar to nucleoredoxin [Strongylocentrotus purpuratus]
    MALVELLGEKLQGAGGAEVETSSLCGSGRYVGLYFSAHWCPPCRMFTPKLAEFYEAFTKKNEGKLEIVFVSADGKLEEFD
    DYFKEMPWLSLPYADRDREGKLSTKFGVQGIPTFIIIDSETGDVICSEARDEVMGDPEGANFPWKK

    >gi|115894393|ref|XP_001198281.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MWLLTVYNQGGGPCYRCLYPRPPPAETVTNCSEGGVLGVVPGIIGCIQALEALKMAAGIGTSYSQKLLLFDGLDGTYRSI
    KLRPKKPTCDVCGDNPSVTQLIDYEEFCGASATDKCITLHLLEAKDRLSPQTLASELLSQDSSSRLLLDCRPEIEFEICR
    LPDSINVPIDDIENEKGIPRLKEVVTKQLANQHDNPFPIYVVCRRGNDSQKAVLKLRKELDSLPVAIKDVCGGLTAWTNQ
    VDPDFPEY

    >gi|115894395|ref|XP_786162.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDVDDLKELHLLREENARLRLQLEKHELELMKAEDENHSSNDTSAEARPSITHLDNASIKRYSRQLILPELGVKGQLQIA
    NSSALIVGAGGLGCPAAIYLAAAGIGRLGVVDYDEVELSNLHRQILHTEQRVGWSKSDSIKSSIKSLNSSVQCIAYHLQL
    DRNNAMDIIRQYDMVLDCTDNVATRYLLNDACVLAGKPLVSGSALRFEGQLTVYNQGGGPCYRCLYPRPPPADTVTN
    CSE
    GGVLGVVPGIIGCIQALEALKMAAGIGTSYSQKLLLFDGLDGTYRSIKLRPKKPTCDVCGDNPSVTQLIDYEEFCGASAT
    DKCITLHLLEAKDRLSPQTLASQLLSQDSSSRLLLDCRPEIEFEICRLPDSISILDYDYE

    >gi|115925133|ref|XP_001175826.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MSLFTQIIRPSTRLFRSFQATGLPHCQLRLLSTELKERIDGLIQGKKVVVFMKGVPEEPQCGFSNAVVQIMRMHGVDNYE
    SHNVLEDKDLREGIKEYSEWPTIPQIYMEGEFVGGCDIVIQMHQTGDLIDELKKIGIRSALLDAPKEEEPSK

    >gi|115760437|ref|XP_794300.2| PREDICTED: similar to nucleoredoxin [Strongylocentrotus purpuratus]
    MALVELFGETLHGAGGAEVATSTLAGSGRYVGLYFSAHWCPPCRSFTPKLAEFYKAFAKKNESKLEIVFVSSDRDQGEFD
    GYFKDMTWLSLPFSDRDRKEKLGEMFSVKGIPTFIILDSETGAIVCSEARDEVMDDPEGEDFPWKK

    >gi|115958338|ref|XP_001177136.1| PREDICTED: similar to Chain A, Nmr-Structure Of Tryparedoxin 1 [Strongylocentrotus purpuratus]
    MALVELLGEKLQGAGGVEIETSSLCGSGKYVGLYFSAHWCPPCRMFTPELAEFYDEFTKKDGNQGKLEIVFVSSDQNADQ
    FKDYFKDMPWKCLPFADRDRKGAVTTKFGVRGIPTLIILDSESGEIVCKDARGHVGSDPDGAKFPWKN

    >gi|115958340|ref|XP_001177271.1| PREDICTED: similar to nucleoredoxin [Strongylocentrotus purpuratus]
    MALVELLGEKLQGAGGAEVETSSLCGSGRYVGLYFSAHWCPPCRMFTPKLAEFYEAFTKKNEGKLEIVFVSADGKLEEFD
    DYFKEMPWLSLPYADRDREGKLSTKFGVQGIPTFIIIDSETGDVICSEARDEVMGDPEGANFPWKK

    >gi|72087185|ref|XP_786407.1| PREDICTED: similar to GA18927-PA [Strongylocentrotus purpuratus]
    MANLHTISEDSQFKPKLDSAGQKLVVVDFNASWCQPCRTIAPVFAQLATAHPNAVFLKVDVDVCKQTAQKYNVTSMPTFI
    FLKGGVKIDDVKGANAPGLTQKIKQHYVSGDDDDEEGSGVPGYIELNGMIDKQQTECLNESDDHRLEACLKKGDSYLESD
    CDEQLIITMSFQQNMKLHSLKVLGPTKNGPKVIKLFINQPQTLSFDAAERMEAVQELTVTPEQLAGEIIPLRFVKFQNVQ
    NVTIFVMNNQDDEETTTIQYISFIGTQVNTTNMNEFKRVAGKKGESH

    >gi|115722919|ref|XP_781398.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MGTSQSVALKEKTVVVIGCSFGGKAVAYPLRGQCKLIVIDPREAMHITIAAPRACVEPGFAKRVLIPLKEVFGDSFEQDT
    VEKISPAAGQVVLSNGKEISYDYLVIATGTTGPFPGKLQNDCTIDQALDLYKDACEKVKAAKTVVIIGGGAVGVEIAGEV
    ATDYPDKEVTIIHARDSLVEPATSDTFRASVQKQLEELNVKLVFGEKVTNLDDIPRDLSGATVLTDKGKSIQADVVFVCI
    GSSINSQAYAEELGSKMDARGSLQVNQYLQVEGHENIFAVGDCCNADIQKMAYRAGEQGKAVYHNLIQHASGYPLKPYKS
    PCVMFALSIGRHRGQLQNGNMVLGSWLMKRVKSHDLFTGKMNLLFLKDYRGDICDLGLTFTVMDNDFGEAQVHDLKPGGS
    DIPVTASNRIEYIHLMADFRLNKQTCTREHNEGGACDRTQVVLQLSNTRSNKGLICSCNEEDCLKTNNSCVIETDHGICV
    FRLTRGKSQEEMRFLMCENEPHGPQERLFSCENPPPSPQYVSVCCTESNYCNGVRWKDTHLNPMDPLDPPPGN

    >gi|115958346|ref|XP_001185195.1| PREDICTED: similar to nucleoredoxin [Strongylocentrotus purpuratus]
    MALVELFGETLHGAGGAEVATSTLAGSGRYVGLYFSAHWCPPCRSFTPKLAEFYKAFAKKNESKLEIVFVSSDRDQGEFD
    GYFKDMTWLSLPFSDRDRKEKLGEMFSVKGIPTFIILDSETGAIVCSEARDEVMDDPEGEDFPWKK

    >gi|72044766|ref|XP_789825.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAAPMRYATARYAHVLGRSFPQNAIKLTENGFNNARYFSQQKFFTFNANDRRNIVKSLSAVSGLICGAYIGQRWMSTPES
    GQTWGLLSPIAKQRGQVWDGEKCTDEPQLLNRVPRALSAEDAAKLNLTLYQYQV
    CPFCCKVRAYLDYFGVPYTIVEVNPV
    SRKEIKFSEYRKVPILVQRSPGKEDMQLNDSSVIISILTSFMVTNEKDLGRLMSYYPKMTYTNEKGKEVSEFTNRFNIML
    LETPGLSKAEKVEMKWRKWVDNVLVHNLPPNIYRSPSEALQAFSYISSLGNFNSVEKVIMKYVGAAGMYFIAMKLKRKYN
    IKPDARESLYDAANEWMDVVGKKAFLGGEKPNLADLSVYGVLSSIEGLDAFHDMCRMTKIGPWYQRTKKSVQSHAGAQ

    >gi|115940461|ref|XP_001184576.1| PREDICTED: similar to Grp58-prov protein [Strongylocentrotus purpuratus]
    MNALLLISLLFGVAYGSDVIDFTDDDFKDNIGDHSLILVEFFAPWCGHCKKLAPEFETAATTLQRESPPIALAKVDCTAN
    TQTCGAYGVSGYPTLKVFRNGEPSDYQGPRESAGIISFMKKQAGPKSVVIATEAQFDDFTSGATAAIVGFFADETSAGLK
    EFKKLTDAFFEEFRFAYTLDSGLAEKHSGTDKVVLFRPPQLASKFEESQAVFDGAIKKKDVEKFIRENVHGLCGYMTADN
    QAQFTKKPLLTAYYNVDYKLDKKVMNVGREFIGSVYLSIASASDFQRKLDDYDTSFDAEGGSPVVAIEGAKGEKFVMPEK
    FTVKTLKAFIQAFVNGELEPFIKSEDIPASNDGPVKVVVGKTFDEIVNDETKDVLIEFYAPW
    CGHCKTLEPKYNELGEAV
    NNNIVIAKMDATANDVPPAFEVRGFPTLYWAPKNNKSSPKKYEGGREVPDFIKFIKKEATSKPVNTGDKTEL

    >gi|115628177|ref|XP_001188599.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    ECLAGALCWTDLEKYAEEIGFTKPRVVTARKVKVEDKKLLEVTVTYRLFRPNVPVKVDAELAEIMRKSRYSKVFTIGDGA
    QSGETEIAKDCPVDPYVYLGCADAAPGCC

    >gi|72163529|ref|XP_792563.1| PREDICTED: similar to Glutathione peroxidase 1 (GSHPx-1) (GPx-1) (Cellular glutathione peroxidase) [Strongylocentrotus purpuratus]
    MLDAVCYDDAESLSDVAMTKSLSLDDYRGKVVLVVNTASFCTYTYQYPYFNELKNEFGDQLAILGFPCNQFWLQEPGVGQ
    EIPNTLRYVRPGGGYEPNFYLNEEKIDVNGPKAHPLFKKLKNSCPPVKMEIGDPSNLYWSPMTIGDVTWNFNKFLLDKEG
    VPFKRYDSVVEPLQLVSDIQLVVDGDYKTVKRPSRPKYATEEL

    >gi|115929344|ref|XP_001190441.1| PREDICTED: similar to copper-transporting P-type ATPase, partial [Strongylocentrotus purpuratus]
    MATESRGHQLQLAIIDVEGMTCNSCVRSIEERMGDTKGVYLVKVSLSEKKAFVTFDPTDIDQSTLKDVIYDMGFDACLGS
    NACSVECGVVSIAGMT
    CQSCVKKIEEKLAGLDGVEKVRVLLERNCGVIMLNRNKIGLLDIVGEISALGFNAGIANGMPSE
    DDGKNNKRVVIGIEGMT
    CGSCVKSIEGHVGSLPGVSTINVSLANKEGILTYDATLTSAEKLKEAIYDMGFDATLPCSTPP
    SPNNGTPLAMVIVGIEGMT
    CQSCVRSIEDRIGTIQGVTSIKVSLEDKIADVKYMSSQIKAEEIRVAIYDMGFEATLPESF
    DVSAHDKSQRATLRVEGMT
    CGSCVKSIENTLSDHPGLASIQVSLEGKSATLTFDPQVTTLLAIRDAIYDMGFECYMPDPD
    NERTEAGVLGIQGMTCNSCVKSIEGMLSDNPAVRSAKVSLKEENAIVTFDPNTITMEQLKEIVYDMGFDVTIKESPLLEI
    NSPNSCTPSYSTTQASEPLSKQSPITPHGAFMQEVSQDSAGQEVKADSSKKCFLRVTGMTCSSCVALIEGRMAKREGIES
    IRISLMAQKAEVKYNAKGLSPSKIANLIDDLGFGAEVIDAEVANAKEGVIELHISGMTCSSCVHLIESALVKKTGIKLAA
    VALATSRGHFEYDPNLTGPRDIILAIKEAGFEASLVSSDKNVHSSVDHSQTINQWRRSFFISLLFGGPVIAIWLYEIISH
    PSPKCIFPG

    >gi|115924397|ref|XP_001195004.1| PREDICTED: similar to omega class glutathione S-transferase [Strongylocentrotus purpuratus]
    MTSKAKPNPKHLVQGDPIPPLKKGVPRLFSFRFCPFAHRSRLVLAAKNVDYELVNISLSKKPEWYKTKNPFGTTPCFEHD
    EKIVRDSSIVCDYVNDAYPGVDLWPEDPYRKAQDKMLLDYFGSKISPPFFKATYHPPPSTTEDFLAIYQKELHVLEEELK
    KRGSAFFFGEKPGLVDFIMWPWFERWAVLGADFHRENYPTLMGYCGRMKEDPAIIEAATPDEIYQDNFKKQMEGNPQDDY


    >gi|115928551|ref|XP_001183726.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAATWTQVWTPVHEPGGSTEEEENLRGWVSNTDEAEDVKEQLQVAECITFVGDRKGKGFGNGILHLQNPDGKLIHMPRVR
    FSDIKDNVVSADSVPFAIVSRYSLRCMYGKDKNQAAKRKNEELAEKAMKMYWKTQSFLQSSFQVKFQTNDDSGMSKRAIS
    DHIRADLRKGDKFNFERRIYIRLPSKTDHQSVHTLGKLTGFMNPMHKTVSTKLVDLVGHGVTNLNEMKRHLRAHLHTVLF
    PDVEKRPSITDTAFYPSDNTIRQRMYAARMQLRIMAEAGEKETHDQFEKRFSTLVIHGFVSLSTSLGIQSGLFEALIKLK
    DEERTVKEIADTAGLKERYVQEWLGVMVAADIVDINPETEKYSLPPHRIPFFQPGSSVSDLGVLLTELPTFGGLYKKLLD
    CLKKDGPQGLSYSEYTDFHTVMSNHSSIWVLQHLVQDFIPSMPQIEERMKSGIRILDLGCGRGLASLAFAESYPNSTVVG
    LDFSEEAINYGKERAKEKGLTNVEFIREDAACIPDDWNNTIDYIYTFNVIHDLAHADKVLLALNRILKPDGVFSMIDIDC
    KTKHSENASNEYCSMLYTMSLFH
    CLAISLFFEGSVGLGTCWGREKATEFLKDAGFQVDSITKPVGSSQAHYMCTKILK

    >gi|115973522|ref|XP_001191584.1| PREDICTED: similar to mitochondrial truncated thioredoxin-dependent peroxide reductase precursor [Strongylocentrotus purpuratus]
    MSLFHQICRLGVTGARATRFCSGSFSTVCCRATVPKPLASQLLPPYAAAAELGQRAWSCIQRQLSTSCQLNVAIQEPAPD
    FEGTAVIDGQFKEIKLSDYKGKYLVLFFYPLDFTFV
    CPTEIIAFSDRADEFGAINTEVVAASIDSHFSHLAWINTPRKQG
    GLGPMKIPLLSDMKKQIAEDYGVLLKDAGVALRGLFLIDPEGVVRHMSINDLPVGRSVDETLRLVKAFQFVAEHGEVCPA
    GWTPDSETIKPDPEGSKTYFEKVN

    >gi|115949852|ref|XP_001178274.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MALSVCRLFTRSRPALAIRRVLSPQSQKASSQNSLERCLARFQGTSSKLYESPTPESKPVSRFPIPERETLPEDIQRIMK
    EVEKQSGFLPNIFKIMSYDPTSFKYFFGYYDHLISDRGNLTKEDKSFISLAVSTENKCIY
    CTVSHRMVFRLNTNDPVLTD
    QMTVNWETADVTDRQRAILEMAMAVTKNEPITDEHFTNLERHGLDQRDAFDIGHYAAFFALANRLAIFTKLRPNDEFSE

    >gi|115946608|ref|XP_001192697.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAAPMRYATARYAHVLGRSFPQNAIKLTENGFNNARYFSQQKFFTFNANDRRNIVKSLSAVSGLICGAYIGQRWMSTPES
    GQTWGLLSPIAKQRGQVWDGEKCTDEPQLLNRVPRALSAEDAAKLNLTLYQYQV
    CPFCCKVRAYLDYFGVPYTIVEVNPV
    SRKEIKFSEYRKVPILVQRSPGKEDMQLNDSSVIISILTSFMVTNEKDLGRLMSYYPKMTYTNEKGKEVSEFTNRFNIML
    LETPGLSKAEKVEMKWRKWVDNVLVHNLPPNIYRSPSEALQAFSYISSLGNFNSVEKVIMKYVGAAGMYFIAMKLKRKYN
    IKPDARESLYDAANEWMDVVGKKAFLGGEKPNLADLSVYGVLSSIEGLDAFHDMCRMTKIGPWYQRTKKSVQSHAGAQ

    >gi|115956542|ref|XP_001177604.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    LEWFNTSGPLSFKSNLQGKLVVLDFFTYCCINCMHILPDLEALEEKYSVEDGVVVVGVHSAKFENEKVSANIKNAILRYN
    IHHPVVNDHDAVMWNDLNIQCWPTLLIVGPSGEPILSIIGEGHRDILFEVVQLSLDHFKSKLSPQSLPVVALKDSLVDSP
    LLYPGKVTTNPEGTLLAVSDTGHNRVIIVALDGVVQHCIGGPETGFNDGLYQEARFHSPQGLCWAQDVIYVADTENHAIR
    KIDLKEKRVTTIAGTGEQGVDWYGAGRGTEQVISSPWDVVLGPPNEDVLFIAMAGTHQLWGLFLSDGHWLKAV

    >gi|72070002|ref|XP_798979.1| PREDICTED: similar to predicted protein [Strongylocentrotus purpuratus]
    MDWWSPSLAKFKRGAENWWQVFYVIGAIAGACISAAASGSLGSTPGVSLMSSFLGGVLLIFGSRLAGGCTSGHGLSGMGV
    LSVLSFVTVAAMFAGGTAFGFIFWAVSNASKWDYYTF

    >gi|72090196|ref|XP_790088.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDTDAGEASGSGYVGRDTEKDCDDGFVDEDELFDELENEDIPANIREARIGQMKREAAAARAMEDKGLGLYTEIEKEEDL
    LKMTTTIPKVIVHFYKTDFRR
    CCIMDKHLKILAEQYRDVKFSKVCVDIVPFFVTRLQIQVLPAVLLFIDGVVADRVVGFD
    ELGNTDNFTTDTLENRIAKSEIIKPLNAAGSANKTIFGFDRRRDDSSDEDY

    >gi|115673378|ref|XP_001199385.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    QDFDSILSTSGDKLVVIYFSATWCGPCRSISPEFETLSKDPEIASNVVFCKADVDEAS

    >gi|115872185|ref|XP_791945.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDSFRLKGCGYLVSSTVFLLCCVVCHTNQQATVDLMDSNMDNILQHNDIVFVNFYANWCRFSQMLKPIFEEAAKVAQQEF
    PGQGQVVFGGLDCDKYPALAKKYHISKYPTLKLFRGGQLAKREYRSQRSKDAFVSHIRDNLKDPLVKLTNPDEVPNLDES
    KRKVIGYFKSYEDAEYTAFRRVASSLRDDCSFFAGSGEAFSKELAPGNSIMYRPPRSIDQDMLFMGSMTNVELLRAWSTD
    KCIPLVREITFENGEELTEEGLPFLILFHKPEDTEVVRQYNDMILRELISERGNMNFLTADGTKFTHPLHHLGKTPKDLP
    VIAIDSFRHMYLFPNIADVPVPGKLKQFVLDLHSGKLHREFHHGPDPAIQKTVPGSPKTVIDTDQTDPPESQFVKLMPSE
    NRYSFRDEL

    >gi|115940094|ref|XP_001190071.1| PREDICTED: similar to rhodanese [Strongylocentrotus purpuratus]
    MVDQVPPLVTTSWLSQHLDSKMEPLVILDATWNPRGKSGNEEHQEQHIPGSLYFNLDECKDKESHFKVTLPRLNEFEDYV
    SKLGISNGTRVVVYENDPRYKAKTSARVWWMFRYFGHSKVSVLDGGLEQWVKDGFPVTSDKTEDPVKAMFKAEVQVQLRK
    TCDEVLEDMKEGSVQLVDTRPSHWFDGTKPSLWPDLRLGTIHGAKHVNFEECMDKHSTRLRPADELQDLFTSTGIDLSKP
    VTTT
    CNVGVTACIVAMAAFLLGKEDVAVFDGSWDEFSQKAPDNLVHINIYNKT

    >gi|115745082|ref|XP_001203026.1| PREDICTED: similar to GA18927-PA [Strongylocentrotus purpuratus]
    MANLHTISEDSQFKPKLDSAGQKLVVVDFNASWCQPCRTIAPVFAQLATAHPNAVFLKVDVDVCKQTAQKYNVTSMPTFI
    FLKGGVKIDDVKGANAPGLTQKIKQHYVSGDDDDEEGSGVPGYIELNGMIDKQQTECLNESDDHRLEACLKKGDSYLESD
    CDEQLIITMSFQQNMKLHSLKVLGPTKNGPKVIKLFINQPQTLSFDAAERMEAVQELTVTPEQLAGEIIPLRFVKFQNVQ
    NVTIFVMNNQDDEETTTIQYISFIGTQVNTTNMNEFKRVAGKKGESH

    >gi|115709888|ref|XP_796844.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MASSKQGRKHQAKEAIGAFCHILNSNVFITRITPEQFRQAKFDQPEAISSMWTLLKELLQLNFTSSTISKSAKNLAASHL
    EKADVQSLLYQMGYRCLGFHDDGDVGSRDILVAIGWLLAKLDFVNEQAKVKLEDASPPISTFHLGAVQKALNSGITKASS
    QWLKDSGPSTPVGQAKYLVWLMGRLRLALKTLYCEQQGLCAAIHHVHEATQGVSMPHPSRVNHLTAWETFILRHPKQLQQ
    MSVHEAKMSSAAVNPIPPISSNNHHAHHVVATKERSRRIQRLHDLEIELNRQRQVLEDELESRGANDLVSQLSDHPDIHK
    RKADIDNAVRAKLTNSFEEHRKVNTRSYPLPTVQFSFKPEQAKNRRLKPEALPPNTLNIKDEITRMLDGVRRLQEELDSV
    KLKQQQRLDGFAEGLMNVVCIPPMLEKTSYSSSGTSTFSGNAKKNNNDVHRCFCELNGVVDDCTCKVESVSEFNNIRLFP
    PLNSLLNKNYFKFFKVNLHRPCPFWADDSR
    CAMKGCHVCPCSPDDLPCGLKEESNENKYSSDSNKPVDDTSDEEEECNKE
    ETEEDEDQLGALDTTISRENMLAFETWKTHDDAQLNFCEKEDEHSGDVEYVDLLLNPERYTGYKGTSPHRIWSSIYNENC
    FRPETPESTATTYESFLSNKKLKDMCLEKRVFYRLISGLHSSINIHLCAKYLLSEGLFEQERWGRNIEEFQSRFDPETTD
    GEGPIRLKNLYFTYLVALRAIAKAAPVLEKEFFYTGEPVEDQEVQRIVKEILKIANSFPEHFDESAMFQGDQQQALQLRE
    EFRTHFRNISRIMDCVGCDKCKLWGKLQIKGLGTALKILFTEQGVGKKSKLTLDRGEIVALFNVFGKLSGSIVEIEEFQE
    LLSQDKASAPKKMPGFL

    >gi|115953106|ref|XP_792917.2| PREDICTED: similar to Dihydrolipoyl dehydrogenase, mitochondrial precursor (Dihydrolipoamide dehydrogenase) [Strongylocentrotus purpuratus]
    MSRTTCVEKNDTLGGTCLNVGCIPSKALLNNSHLYHMAASKDFKSRGIDVGDIKLNLPKMMGQKSDAVKGLTNGVAHLFK
    QNSVTKLLINEIAEQENVEMQKKIASLMADLKRAESELNHLKSQCSPLPYMAPSLPVRPPRSPGHIPSTSPSHLPLSPID
    CPSGTPLGLEPPVPSRPSFSIRSNSQEEKVGDYDVVQPKSSNRTSIGLASTDLEKELKNLLAEKVLILQSKLDKQTKKLS
    EIDQTLEALRDEEDCYDLMVPGHKNTSKHSHGKEHHILPKRPPTETTLKKTSTLRPPNIPLPSVPACPGISTLPRGTEHK
    DPRAEYDPLPISMRADKENPSLRPRLKSPTKISSPARRVPLPTEPLQPHPSLKSSDLMSLPLSQQTDSFKRSMTARPSHP
    HSISPGGQFAFTSAPVSEYDLPDLAPPLPPLPEPRNVPVTQSSKISEYDLPYDEVPPPPAKFRAQKSSVSPLSPNHSFNP
    VMYATPDTNLNTFTKENVAVLLKSLNLDNCVSRFLEESVDGVLLMSIDEEMMMKELGMTRFQARKLTIKIDELTTR

    >gi|115752502|ref|XP_001178754.1| PREDICTED: similar to J1A crystallin [Strongylocentrotus purpuratus]
    MSSVSSRAAGAIVGSFIADAASLPVHWVYDQEKLAAEVSKHPTPEFLPEGICPYYKLPTGKNSAYGDHLYVLLKSVVESK
    GFDVGAYKAGLKVMFGPGSAYDYQRPSGQAEGPYIHGYMKKYLANIAQDKEDTGDTGSTDTDGVINSAVIVALYGGDPQM
    TSKLEEAVKVVQNTPICIKYALTGAKLLEGLIMNGPNPNAVADLKGLVDNDVAQEISKAEDMKVHPHNVAAKKLGYA
    CSL
    PGGFLSMLHCLLNAKPGKFTESIRPTLLAGGDNCSRAAMLGAILGAQMGLEGLPMDLLAKVERGQEVKALAEQLVAMRQS


    >gi|115936451|ref|XP_001182263.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MEGKEATYIKGITHDKCVVVFSKTHCPFCHKVKTIFEDFGASYEVVEMDKRSDTSAMQAVLGKMTGASTVPRVFIQGKCV
    GGYDDTKRLQDSGRLEEMLRDCNAIE

    >gi|115968865|ref|XP_001176073.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MESSCNLSNNLVTNVQTGETITLSSIWEEGACVIQFLRRFGCPICRMGARDITHLKPRLDAANVRLVAIGQEETGAKEFI
    ESGFWTGDLFIDQQKKTYGDLKYKRYNFLTIMANLMCKMTREAVSKATSEGITGNMTGDALQMGGTLVIDKGGKVLLDFK
    QETPADSVPLDRVLHVLGIGRQSRTLSVESR

    >gi|115637218|ref|XP_784500.2| PREDICTED: similar to glutathione peroxidase, partial [Strongylocentrotus purpuratus]
    WGILFSHPADYTPVCTTELGRVATLTPEFEKRGVKLIALSCDGVESHRGWIKDIVDYAKFEKTWPYPIIADPKRELAVQF
    GMLDPDEKDSAGIALTARCVFIIGPDKKLKLSLLYPATTGRNFDEILRVIDSLQLTATKRVATPADWKSGEDCMVLPNIS
    EEDAAKLFPQHRKVAVPSGKGYIRLTPQP

    >gi|72006969|ref|XP_782974.1| PREDICTED: similar to MGC81459 protein [Strongylocentrotus purpuratus]
    MGDPSSSPWMSRKSTFLIALTLVALIGIVQSEDFYELLGIERDADAKDIRRAFKRLALTMHPDKNQDDPKAHDKFVRINR
    AYEVLKDDDLRKKYDRFGEEGLKEQNQRYNKYESWQFYKTEFGLYDEDPEIVTLSKSDFEQSVFGEDIWIVNFYSPR
    CHH
    CHDLAPAWREFAKEVEGVIRVGAVNCWDDRPLCTAQNVKRFPTLFVYPKHEEYTGTRSLEPLVKFALNLVDVTIHPLWIG
    NFKKVLLADEAKDHPWLISYCGSPVGTEDEDTHDMASVGCLDRDDQLKLAAILNKVVSVGSVDCSASSQLCTKLKIEEST
    IRFYNKAKEVTKGGKELELEQPKQMADEILKQLPDLSSFTSAELQLYFKIYTLSQEARQALEVGGEAPPVVTYFMKKAGD
    DDLELKKLPHLLTDMKVRKFNCSTDQALCDDLYLGTHLPKVALFRKGGGHEFHHGRLFAQDIAAFARHGLTSRLRVLGPK
    DFPDPVINSGELWFVDFFSPH
    CPPCKQLLPEVRKAASRVPYVNFGTVDCTTHQALCSQQNIRSYPTTVFFNDSKPHVSVG
    FSNSHAIQEFIEDTLNPKVITLSQDLFDSLVKNRAKGDLWLVDFYAPW
    CGPCQALMPEWRKFAKKLNGTAHVGSVDCVEH
    SSLCVQLGVNSYPTIRAYPMGRTGAGGFSAYQGWNRDVMALMGWVQNFLPTSVEIITQGNFRDLVLRSTDPWVVDFYAPW
    CGPCMAYMPSLEEVAKALKGYVRVGKINCQSYQSTCGQASIQSYPSLRIYKGTETKGYSQNWFGEQVYQKEPQYLIPYLK
    QKFTKNLESTGQIKDEL

    >gi|115736135|ref|XP_001197282.1| PREDICTED: similar to Dihydropyrimidine dehydrogenase, partial [Strongylocentrotus purpuratus]
    MARMLSRDIADIENLLALNPTVPSHAKVVLTKTTKANRKYWKRNGPKSCATCGDLDNNFDDVKHTTLSERAALREAARCL
    KCADAPCQKSCPTQLDIKAFITSIANRNYYGASKAIFSDNPLGLTCGMVCPTSDLCVGGCNLYASEEGPINIGGLQQFAT
    EIFKEMKIPQIRDPTLPSHDDLPESYQSKVALIGCGPASISCATFLARLGYTNLTVFEKEEWIGGLSSAEIPQFRLPYEV
    VSFEVDQMKDLGVKVELKKGLGMNGMTLESLKSSGQEAIFVGLGLPEAKRAPIFQDLTVEQGFYTSKDYLPLVSLASKAG
    M
    CACKSSLPKLHGNVIVLGAGDTAFDCATSAVRCGAKRVFIVFRKGFTTIRAVPEEMDVAREERCEFMPFLSPRKVILKG
    GRIAALELCRTEQDDEDNWIEDEEQTTRLKADFIISAFGSTLLNEEVKTALSPIRFNRWGLPEVSTDTMQMSEPWAFCGG
    DLGGVAQTTVESVNDGKTAAWFMHKYLQSLHGVPVPSTPALPKFCTPIDLVDTSVEICGLKFPNPYGLASAPPTTSAPMI
    RRAFEAGWGYAVTKTYSLDKDFVTNVSPRIVRGTTSGNVYGPGQGSFLNIELISEKTAAYWCKIVTELKRDFPDRIVIAS
    IMCSFNKDDWTKLAKMSEEAGADALELNLSCPHGMGEKGMGLACGQDPELVLNICRWVRAAVKIPFFAKLTPNVTNILDI
    ARAAKEGNADGVTATNTVSGLMGLKASSNAWPAVGKQKKTTYGGVSGNAIRPIALKAVSVIANNLPGFPILATGGIDSAE
    SALQFLHAGASAVQVCSAIQNQDFTLIEDYVTGLKALLYLNSLDDLGDWDGQSPPTVRHQKGKQVRVADVIGK

    >gi|72004836|ref|XP_784535.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MSLFTQIIRPSTRLFRSFQATGLPHCQLRLLSTELKERIDGLIQGKKVVVFMKGVPEEPQCGFSNAVVQIMRMHGVDNYE
    SHNVLEDKDLREGIKEYSEWPTIPQIYMEGEFVGGCDIVIQMHQTGDLIDELKKIGIRSALLDAPKEEEPSK

    >gi|115638715|ref|XP_786396.2| PREDICTED: hypothetical protein isoform 3, partial [Strongylocentrotus purpuratus]
    NQKVRHQNCNKRVYFESTDQFCLDEDELFELELEAEEHNHLEAGAIYHQNKQKSLNSLFSSVSQWRFSSNHLLFETFPID
    PIKENYVRQVQNVIFSQVLPTPLRYKTKLVAYSEDVLTGLLDLHPSVTETEPFVAFVAGNTFLDGSIPLAHRYGGHQFGG
    WSGQLGDGRAHLLGEYINRNGERWELQLKGSGKTPYSRRGDGRAVLRSSVREFLGSEAMFYLGFGGWSGQLGDGRAHLLG
    EYINRNGERWELQLKGSGKTPYSRRGDGRAVLRSSVREFLGSEAMFYLGVSTSRALSLVVSEDPIWRDQFYDGNPRQEKA
    AVVLRLAPSWFRIGSLEILAKNREIDLLRSLVDFIIKHHFKEIDSEDDDRYLAFYSEIINKTAYMIAKWQSIGFAHGVMN
    TDNFSLLSITIDYGPFGFLDAYDPQYIPNTSDDEGRYSYEKQPEVGLFNMRKLADALAPLLTLPQRKQLPIITSGYVDIY
    KARFMELFRKKLGLIGAEEQDEYIVAMLLQMMEDTHSDFTTTFRQLGVISMAMLRSSTQDAATKLWALTDLSRHEMFQEW
    ARMYARDRTVNPNYILRNWMAQAAIEDAGRGDFTTVKDLLKILKRPFXNQPEADERGYANRPPHWARDIRVS
    CSS

    >gi|115663086|ref|XP_795302.2| PREDICTED: similar to ubiquitin-activating enzyme E1 [Strongylocentrotus purpuratus]
    MSASSSDAQTSPAAKKRRLEQESNNTNQNSVNSNNREMAKNGGQDEIDEGLYSRQLYVLGHEAMKRMAVSNILISGVKGL
    GIEIAKNVVLGGVKSVVIHDEEDVSIQDLASQFFFREADVGKNRAEVTEPRLAELNNYVSVTISKSPLNEQFMSKFQVVV
    LTTSSLEAQLRIGDFCHSKGIHLIIADTRGLFGQVFCDFGDDFTVYDSTGEEPMSVMVSAVSKDDQGVVTCLDESRHGFE
    SGDYVSFSEIKGMTELNGCQPKKIKVLGPYTFDIGDTSDLSDYVRGGIVSQVKMPEKVTFKSLRESLAEPEMIITDYAKF
    DRPGQLHIGFQALHKFKTKYGTLPRPRNEDDAAKMIALAKEINSQASDASKQESIDEKLLTQLAYNACGDICPIQAVIGG
    MAAQEVMKACSGKFNPIKQWVYFDALECLPEDESATPTEASCQPTNSRYDSQTAVLGADFQKKMAAQKYFMVGAGAIGCE
    LLKNFAMMGLGSAPEGKIYVTDMDIIEKSNLNRQFLFRPHDVQKPKSDTAAKAAKEMNPEINIIPHLNRVGPETENVYDD
    DFFQSLTGVANALDNVDARMYMDRRCVYYRKSLLESGTLGTKGNVQVVLPFLTESYSSSQDPPEKSIPI
    CTLKNFPNAIE
    HTIQWARDMFEGLFRNPAENAAQYGTDPKFMERTLKMPGCQPIEVLELLKRALIDDRPKSLEDCISWTRHHFESQFVNQI
    KQLLFNFPADQTTSSGAPFWSGPKRCPHPLLFNPDNDMHLSYIVSTSNLLAAVYGLEGNRDDSYFRKVLQSIDVPVFTPK
    AGVKIAVNDAEAQAAAEANADDARLREIVDSLPTPEQLKQITIKPLDFEKDDDTNFHMDFIVATSNLRAENYGISPSDKH
    KTKKIAGKIIPAIATTTSVVAGLVCLELIKLVNQNKKMESYKNGFINLALPFFGFSEPIAPSKMKYYDTEFSLWDRFEVN
    VSDKEMTLKGFLDHFQNDHKLEITMLSQGVCMLYSFFMPAAKLKERLPIKMSEVVTKVSKKKIPKHVKSLVFELCCNDTE
    GEDVEVPYVRYTFR

    >gi|115931401|ref|XP_001183945.1| PREDICTED: similar to peroxiredoxin V protein [Strongylocentrotus purpuratus]
    MPIKPGNPVPSVEVCENTPGDKVNVAELFKGKTGVLFAVPGAFTPGCSKTHLPGYVGDFDKLKAKGAEVIACVAVNDPFV
    MAAWGKAHEADGKVTIVGTLF

    >gi|115940114|ref|XP_001190582.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MTTVHQVLLPGEADGGDSPRLSITDDTYHLLANTSRRHTLVGANNESAMPRTENIEERCVVTNEINTQKSEESSPREQTA
    ETSSQQAQSSPDGIIGTDRNANMHRTTTAGTKTRIPSETGSESFHNSGHNGIRLDIKSNCDEKPILAEADYKDSKTRKNS
    PLIGSNIARTVGKLAACFLCGIIFGIAAEKGRVFETATIRGQFIYQRWIMMKMFLSAAATSCFCLALLSVIPLTKNVFES
    SRTAYVAGLTHKGIISVTIGGAILGAAMVLSGSCPGMVLVQIGAWLSNGGGAMTFFGCMVGVYLYALVEPWTRKMMSPTK
    PYDKYLADSYTEKWKVPFFAIALAAGVLMGLAVVTIEILVPWTTDLVNPNVEGSWFFETLAWPPYVSGVMIGCLQIPLVL
    IVSDTIGGSSSFCTLGAQALVTERMESWSPYLAKFKRGAENWWQVFYVIGAIAGACISAAASGSLGSTPGVSLMSSFLGG
    VLLIFGSRLAGG
    CTSGHGLSGMGVLSVLSFVTVAAMFAGGTAFGFIFWAVSNASKWDYYTF

    >gi|72111257|ref|XP_787070.1| PREDICTED: similar to thioredoxin isoform 2 [Strongylocentrotus purpuratus]
    MAGSVVQIANLGEYKDFIKDSPAVIDFYATWCGPCKVISPKFVGLATEYPAVKFGKVDVDDASEVSEECGISAMPTFQFF
    KNGEKVAEVKGASEKALVDALKELIK

    >gi|115758217|ref|XP_001175648.1| PREDICTED: similar to thioredoxin isoform 1 [Strongylocentrotus purpuratus]
    MAGSVVQIANLGEYKDFIKDSPAVIDFYATWCGPCKGLATEYPAVKFGKVDVDDASEVSEECGISAMPTFQFFKNGEKVA
    EVKGASEKALVDALKELIK

    >gi|115961178|ref|XP_001177412.1| PREDICTED: similar to interferon, gamma-inducible protein 30 [Strongylocentrotus purpuratus]
    MSGRICITSIAVLLVIPSVVLGCGFHPNLWCSSPEISERCGVQKQCLLWQSEQKVADAPLVRYELYYESLCPGCKQLILT
    QLFPAWQKVKSIVNVTLVPYGNAQEYQSGDQWVFTCQHGPSECVGNIMETCALSILPFDKAFPFIQCLEYYGPTATNLAY
    CASLVATAAEAQSIKELHWRTYGKQARAFHGP

    >gi|115758219|ref|XP_001179923.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MLYCLRAVDGAITVLLHLKHIILRIRRIAFPQDFDNILTTSGDKLVVIYFSATWCGPCRSISPEFETLSKDPEIASNVVF
    CKADVDEASEIAEECEVQCMPTFCFFRGESKIYQFSGGNKGRLREYIAKYK

    >gi|115733001|ref|XP_001201177.1| PREDICTED: similar to Thioredoxin domain-containing protein 5
    MKCVSLAVLVIFGLNLVCGEEEEASFDLNYDTASFVEEIGKGDHFVKFFAPWCGHCQRLAPIWSQLSEKYNKPEDSTVTI
    AKVDCTEETKLCSEHGVTGYPTLKLYKKDKEPLKYKGKRDFATLDAYIEKELNPQEADVPQVPAAKNGLYELTVATFKDH
    VAKGNHFIKFYAPW
    CGHCKRLAPTWDDLAKGFQHSDIVTIAKVDCTAHRAVCDQYGVKGYPTLKFFTDGEAVESYKGGRD
    HVAMKEYVSKMTKGAEAAPLPGSEEAIKVVPVREEPAGGEQPAVESKVVVLSTNNFLTQTAKGTSLVKFYAPW
    CPHCQKL
    VPVWDELAEKFDSRKDVTIGKVDCTVETEKPLCKKHAIEGYPTLLLFKDGEMVEKHSGTRTLAALETYLKSKLPKEEL

    >gi|115965050|ref|XP_001178739.1| PREDICTED: similar to thioredoxin isoform 2 [Strongylocentrotus purpuratus]
    MAGSVVQIANLGEYKDFIKDSPAVIDFYATWCGPCKVISPKFVGLATEYPAVKFGKVDVDDASEVSEECGISAMPTFQFF
    KNGEKVAEVKGASEKALVDALKELIK

    >gi|115965052|ref|XP_001178656.1| PREDICTED: similar to thioredoxin isoform 1 [Strongylocentrotus purpuratus]
    MAGSVVQIANLGEYKDFIKDSPAVIDFYATWCGPCKGLATEYPAVKFGKVDVDDASEVSEECGISAMPTFQFFKNGEKVA
    EVKGASEKALVDALKELIK

    >gi|115653924|ref|XP_001176683.1| PREDICTED: similar to predicted protein [Strongylocentrotus purpuratus]
    MDWWSPSLAKFKRGAENWWQVFYVIGAIAGACISAAASGSLGSTPGVSLMSSFLGGVLLIFGSRLAGGCTSGHGLSGMGV
    LSVLSFVTVAAMFAGGTAFGFIFWAVSNASKWDYYTF

    >gi|115965054|ref|XP_001193822.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    QDFDNILTTSGDKLVVIYFSATWCGPCRSISPEFETLSKDPEIASNVVFCKADVDEASEIAEECEVQCMPTFCFFRGESK
    IYQFSGGNKGRLREYIAKYK

    >gi|72027721|ref|XP_793270.1| PREDICTED: similar to Glutathione S-transferase omega 1 [Strongylocentrotus purpuratus]
    MPEQSEHHHFKTGEALPPLKPGVLRLYSMAFCPFAERTRFVLAAKGIDYELVNVNTFHKPEWYFDKNPDGVVPTLEQDDK
    LIQESIVTCEYLDELYPDTAPMFPSDPYLRSRDKLFIQRFGKFISGFYLSGKEKGENEELRSAAIKNVESVEQELKKRGT
    PFFSGSSPGMVDFSIWPFIYRLPYSRSLGDGGLDSFVLLKQWMDRMRQDKIIAPRIVEDEALLEFSTHYRTPGSRFDEIQ
    TKAIK

    >gi|115960785|ref|XP_001191456.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    NQKVRHQNCNKRVYFESTDQFCLDEDELFELELEAEEHNHLEAGAIYHQNKQKSLNSLFSSVSQWRFSSNHLLFETFPID
    PIKENYVRQVQNVIFSQVLPTPLRYKTKLVAYSEDVLTGLLDLHPSVTETEPFVAFVAGNTFLDGSIPLAHRYGGHQFGG
    WSGQLGDGRAHLLGEYINRNGERWELQLKGSGKTPYSRRGDGRAVLRSSVREFLGSEAMFYLGFGGWSGQLGDGRAHLLG
    EYINRNGERWELQLKGSGKTPYSRRGDGRAVLRSSVREFLGSEAMFYLGVSTSRALSLVVSEDPIWRDQFYDGNPRQEKA
    AVVLRLAPSWFRIGSLEILAKNREIDLLRSLVDFIIKHHFKEIDSEDDDRYLAFYSEIINKTAYMIAKWQSIGFAHGVMN
    TDNFSLLSITIDYGPFGFLDAYDPQYIPNTSDDEGRYSYEKQPEVGLFNMRKLADALAPLLTLPQRKQLPIITSGYVDIY
    KARFMELFRKKLGLIGAEEQDEYIVAMLLQMMEDTHSDFTTTFRQLGVISMAMLRSSTQDAATKLWALTDLSRHEMFQEW
    ARMYARDRTVNPNYILRNWMAQAAIEDAGRGDFTTVKDLLKILKRPFXNQPEADERGYANRPPHWARDIRVS
    CSS

    >gi|72017697|ref|XP_796376.1| PREDICTED: similar to copper-transporting P-type ATPase, partial [Strongylocentrotus purpuratus]
    MATESRGHQLQLAIIDVEGMTCNSCVRSIEERMGDTKGVYLVKVSLSEKKAFVTFDPTDIDQSTLKDVIYDMGFDACLGS
    NACSVECGVVSIAGMT
    CQSCVKKIEEKLAGLDGVEKVRVLLERNCGVIMLNRNKIGLLDIVGEISALGFNAGIANGMPSE
    DDGKNNKRVVIGIEGMT
    CGSCVKSIEGHVGSLPGVSTINVSLANKEGILTYDATLTSAEKLKEAIYDMGFDATLPCSTPP
    SPNNGTPLAMVIVGIEGMT
    CQSCVRSIEDRIGTIQGVTSIKVSLEDKIADVKYMSSQIKAEEIRVAIYDMGFEATLPESF
    DVSAHDKSQRATLRVEGMT
    CGSCVKSIENTLSDHPGLASIQVSLEGKSATLTFDPQVTTLLAIRDAIYDMGFECYMPDPD
    NERTEAGVLGIQGMTCNSCVKSIEGMLSDNPAVRSAKVSLKEENAIVTFDPNTITMEQLKEIVYDMGFDVTIKESPLLEI
    NSPNSCTPSYSTTQASEPLSKQSPITPHGAFMQEVSQDSAGQEVKADSSKKCFLRVTGMTCSSCVALIEGRMAKREGIES
    IRISLMAQKAEVKYNAKGLSPSKIANLIDDLGFGAEVIDAEVANAKEGVIELHISGMTCSSCVHLIESALVKKTGIKLAA
    VALATSRGHFEYDPNLTGPRDIILAIKEAGFEASLVSSDKNVHSSVDHSQTINQWRRSFFISLLFGGPVIAIWLYEIISH
    PSPKCIFPG

    >gi|115953788|ref|XP_001181272.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MLVISCSSYDYDLAVIGGGSGGLACAKEAAGFDKKVIVLDYVDPSPQGTKWGLGGTCVNVGCIPKKLLHHASLLRESMHD
    AKHYGWQVPDDIGLSWSTLIGGIQGHVKSLNWGHRVQLQDKNVEYVNGKGSFIDEHTVKVKMKDGKETQFSAANIVLATG
    GRPKYPDKVPGAMEYGITSDDIFSLKTPPGRSLVIGGSYVALECAGFLHGLGFPTTVMVRSICLRGFDQQMSRLVADHME
    ASGIQFLWQQVPESVAKNQNGSLNVRWRSDQGQEGHGEFDTVMFAVGREPETAQLGLDNTGVQLSEGGKVMGSNEQSSVP
    HIHAIGDILESGIELTPVAIRTGKLLAQRLFGQGTEHMNYEQVATTVFTPLEYSCVGLSEETATERYGEDHIEVYHAFYK
    PLEYVVPNKPAEQCYIKAICLRDGDQRILGLHITGPGAGEIMQGFALAVKMGATYQHLSSTIGIHPTCAEEVVKIHITKR
    SGLDPMVTGC

    >gi|72107094|ref|XP_787379.1| PREDICTED: similar to Y34D9A.6 [Strongylocentrotus purpuratus]
    MAQTFVDAQIRDNKVVMFSKTFCPYCKMAKDSLASAGLKDYKVVELENHNMCAEIQDYLNKLTGARSVPRVFIGGKCIGG
    GSETKALQESGKLTTMLQQNGAM

    >gi|115945864|ref|XP_001185701.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MGTSQSVALKEKTVVVIGCSFGGKAVAYPLRGQCKLIVIDPREAMHITIAAPRACVEPGFAKRVLIPLKEVFGDSFEQDT
    VEKISPAAGQVVLSNGKEISYDYLVIATGTTGPFPGKLQNDCTIDQALDLYKDACEKVKAAKTVVIIGGGAVGVEIAGEV
    ATDYPDKEVTIIHARDSLVEPATSDTFRASVQKQLEELNVKLVFGEKVTNLDDIPRDLSGATVLTDKGKSIQADVVFVCI
    GSSINSQAYAEELGSKMDARGSLQVNQYLQVEGHENIFAVGDCCNADIQKMAYRAGEQGKAVYHNLIQHASGYPLKPYKS
    PCVMFALSIGRHRGQLQNGNMVLGSWLMKRVKSHDLFTGKMNLLFLKDYRGDICDLGLTFTVMDNDFGEAQVHDLKPGGS
    DIPVTASNRIEYIHLMADFRLNKQTCTREHNEGGACDRTQVVLQLSNTRSNKGLICSCNEEDCLKTNNSCVIETDHGICV
    FRLTRGKSQEEMRFLMCENEPHGPQERLFSCENPPPSPQYVSVCCTESNYCNGVRWKDTHLNPMDPLDPPPGN

    >gi|115608277|ref|XP_001175658.1| PREDICTED: similar to Methyltransferase like 2 isoform 2 [Strongylocentrotus purpuratus]
    MILGCHFLKHGLALGSKIIRHRKGFSTSVHAYQVRGDENLHVKELLEERNHQYPSSDSGKIMSAGEELPVTKDDAASVKR
    PQFGNRFLENPDNVFQHNAWDNVAWDPEQLEAAKKKVGENSSQQVETEKKELYEADADRYWNEFYSLHQHKFFKDRHWLF
    TEFPELSSDNAQASAKECSSERGASQETSEPRTMDTSDDFPGKSAHKRILEVGCGVGNTIFPILQTNADPGLFVYGCDFS
    SVAVDIVRQHAEYNPSRCHAFVCDVSDPAASFPVPDNSLDLVVLIFVMSAINPDRFLSTIQTLTRLLKPGGRILFRDYGR
    YDLAQLRFKKGR
    CLSENFYVRGDGTRVYFFTQDELRELFISAGLVEEQNTIDKRLQVNRGRQLTMYRVWIQCKYRKP

    >gi|115608279|ref|XP_001175509.1| PREDICTED: similar to Methyltransferase like 2 isoform 1 [Strongylocentrotus purpuratus]
    MILGCHFLKHGLALGSKIIRHRKGFSTSVHAYQVRGDENLHVKELLEERNHQYPSSDSGKIMSAGEELPVTKDDAASVKR
    PQFGNRFLENPDNVFQHNAWDNVAWDPEQLEAAKKKVGENSSQQVETEKKELYEADADRYWNEFYSLHQHKFFKDRHWLF
    TEFPELSSDNAQASAKEILEVGCGVGNTIFPILQTNADPGLFVYGCDFSSVAVDIVRQHAEYNPSRCHAFVCDVSDPAAS
    FPVPDNSLDLVVLIFVMSAINPDRFLSTIQTLTRLLKPGGRILFRDYGRYDLAQLRFKKGR
    CLSENFYVRGDGTRVYFFT
    QDELRELFISAGLVEEQNTIDKRLQVNRGRQLTMYRVWIQCKYRKP

    >gi|115675945|ref|XP_001195522.1| PREDICTED: similar to intermediate chain 1, partial [Strongylocentrotus purpuratus]
    MPAKKETISLQKEILNQEMWDELLSLEGLTVIDVYQKWCGPCAAVLSLFKRLRNEVGDDLLRFAVAEADSIESLERYRGK
    CEPSFLMYGSGQLVNVVRGANAPKLLKDVERELKQEHKVLEEGVERVVIKDPLLAAFEAEEHQAAQAEEVEKKKQEEDAR
    IKEIKELGDEGEVSVRP

    >gi|115627904|ref|XP_781238.2| PREDICTED: similar to MGC81821 protein [Strongylocentrotus purpuratus]
    MARMLSRDIADIENLLALNPTVPSHAKVVLTKTTKANRKYWKRNGPKSCATCGDLDNNFDDVKHTTLSERAALREAARCL
    KCADAPCQKSCPTQLDIKAFITSIANRNYYGASKAIFSDNPLGLTCGMVCPTSDLCVGGCNLYASEEGPINIGGLQQFAT
    EIFKEMKIPQIRDPTLPSHDDLPESYQSKVALIGCGPASISCATFLARLGYTNLTVFEKEEWIGGLSSAEIPQFRLPYEV
    VSFEVDQMKDLGVKVELKKGLGMNGMTLESLKISGHEAIFVGLGLPEAKRAPIFQDLTVEQGFYTSKDYLPLVSLASKAG
    M
    CACKTSLPKLDGNVIVLGAGDTAFDCATSAVRCGAKRVFIVFRKGFTTIRAVPEEMDVAREERCEFMPFLSPRKVILKG
    GRIAALELCRTEQDDEDNWIEDEEQTTRLKADFIISAFGSTLLNEEVKTALSPIRFNRWGLPEVSTDTMQMSEPWAFCGG
    DLGGVAQTTVESVNDGKTAAWFMHKYLQSLHGVPVPSTPALPKFCTPIDLVDTSVEICGLKFPNPYGLASAPPTTSAPMI
    RRAFEAGWGYAVTKTYSLDKDFVTNVSPRIVRGTTSGNVYGPGQGSFLNIELISEKTAAYWCKIVTELKRDFPDRIVIAS
    IMCSFNKDDWTKLAKMSEEAGADALELNLSCPHGMGEKGMGLACGQDPELVLNICRWVRAAVKIPFFAKLTPNVTNILDI
    ARAAKEGNADGVTATNTVSGLMGLKASSNAWPAVGKQKKTTYGGVSGNAIRPIALKAVSVIANNLPGFPILATGGIDSAE
    SALQFLHAGASAVQVCSAIQNQDFTLIEDYVTGLKALLYLNSLDDLGDWDGQSPPTVRHQKGKLVRVADVIGKVRMMIMM
    KVMMIRRMVGLLMFLQGGMR

    >gi|72017550|ref|XP_794769.1| PREDICTED: similar to GA15005-PA [Strongylocentrotus purpuratus]
    MQNPNEDTQWNDILRAKGIIPEKEATVTEDQIEGMLDQAIQKKTGVGAQDKALEDMTLDELDELEDEEEERILQQYRQQR
    VAEIKRIQDKAIYGSVKDISAQDYVQEVNNAGEGVWVVLHLYKAGIPL
    CALINQHLTQLAGKFRATKFLRSIATTCIPNY
    PDKNLPTIFVYNEGEMKTQFVGPLEFGGMNLTIEELEWKLAEAGAMKTDMKDPPKPQVRSTLNIFSGRNQNVDDSDDEDD
    Y

    >gi|72014688|ref|XP_784275.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDSVHDDVKEYYGKTIQTATDLLTDTCQLGASTAKDKLSVRQAISSVHDDILATYYGCGLTIPSLIEDARVVDLGSGTGR
    DCYAISKLVGPKGFVVGVDMTDEQLELARKYVTHHQEKFGYPAPNVEFRKGYIENLKDAHVEDNQYDIVVSNCVINLSPD
    KPSVVREAHRVLKEGGEFYFSDIYVQQDIPEHIRKHKVLWGE
    CLAGALCWTDLEKYAEEIGFTKPRVVTARKVKVEDKKL
    LEVTGDIVFMSVTYRLFKLSKDDCKNPAVVTYNGTLAEYETELPFDIENTFKANVPVKVDAELAEIMRKSRYSKVFTIGD
    GAKSGETEIAKDCPVDPYVTHLTKDQDFHSEPELTPIGSSLGSLRTWTDFIQVQLFKDSLL

    >gi|115681653|ref|XP_001181924.1| PREDICTED: similar to nucleoredoxin, partial [Strongylocentrotus purpuratus]
    NEVSRRFKVSAIPTLIILDSVTGEVTCVDGVDEVKCDGEGKKFPWKSRPFPEIITGNFINQEMKTVTSESLKDKVLGIYF
    SAHW
    CPPCRVFTKELKSTYDKIKESGQSFEIIFASRDRAEDAFKNYFGEMPWLGFPFGDKRIGELAKLFSVQGIPKLAIV
    DAQGKVITADARGSVTKDPEGKEFPWYPKACCELDAVSAAMVNVESCLILFTEIEEDEEGEECTRKAMEMMKPIAEETKA
    AEEAKGQELACKFIVAGDDETVEGLQQFLSIADESLPMLVLLDIPRERVSCCEGKEITPDLIREYYTKFVKDELQWTTLS
    P

    >gi|115928284|ref|XP_790496.2| PREDICTED: similar to ENSANGP00000020140 [Strongylocentrotus purpuratus]
    MRLFIVLIAVGAASALFDTSDDVVELTAANFNQKVINGDEVWLVEFYAPWCGHCKNLAPEWKKAATALKGVVKVGAVDMD
    VHSSVGAPYNVRGFPTIKVFGANKASPTDYNGARTATGIIESALKTVKDMVNARSSGGGGGGRGSGGSGSGGSGSGGSGG
    KADDVVELTDGNFEKEVLNSKDGVLVEFFAPW
    CGHCKSLAPEWAKAATELKGKMKLGALDATVHTVTASRYNVRGYPTLR
    YFPAGVKDANSAEEYDGGRTATAIVAWALDKFSANIPPPEVMELIEQKVLTDSCDVKPLCIISVLPHILDSGAVGRKQYL
    QILKGMGEKYKKKDWGTVSVGRGSSESIRGDALPSIETKEPWDGKDGEMPEEDDIDLSDFDMDDDDEDEDVEVEKKDEL

    >gi|115751765|ref|XP_782086.2| PREDICTED: similar to protein disulfide isomerase, partial [Strongylocentrotus purpuratus]
    CGHCKKMKPEYVEAAAELKENGLEGVMGAVDATKARALAERFEVKGFPTLKYFNPQEPPPPPPPEPSWSDSESEVDHLTD
    DNFKSFTKKKKHTLLEGVMGAVDATKARALAERFEVKGFPTLKYFKNGEHAWDLNERTADKFVEHLTDPQEPPPPPPPEP
    SWSDSESEVDHLTDDNFKSFTKKKKHTLVMFYAPW
    CGHCKKAKPEYMGAAEEFKEENKVSYAAIDCTEHKDSCTAFGVTG
    YPTIKYFSYGKLVQDYTSGREEADFIRFMHNQLSPGSAPSEPPPPPPDVNFWAELDGGENVFQIDDSIFESFLTSSPSVL
    IMFYAPW
    CGHCKRMKPAFAEAATLAKEQNLPGRFAAVDATVAVMTASAFEVKGFPTLKYFKNGKEDMTYSGARTAEALLE
    FIKDPASVPPPPPPEPAWSDVPSAVNHLTGQTFGQFIQDNTHVLTMFYAPW
    CGHCKKAKPSFQQAAEIFKDTPGRKLAAV
    DCTVEKGLCEQYEVKGFPTLNLYSNGQFVEKYTGGRMAEDFEAYMQKTELPEQTSEETPESENLDTPKKKVEL

    >gi|115946681|ref|XP_001178458.1| PREDICTED: similar to Chloride intracellular channel 2 [Strongylocentrotus purpuratus]
    MNGEEVENVEQLDNMKIEDEEEIVTNEEENATYEEEDAPNEDQEEETSDTAAGDANGNGDGDGAEPETTETAAPDTNGDG
    AEQEEDSGDQPITLYIKAGVTSKIAD
    CPLCQRLFMIIVLKKIKYQVCTVNKEILPAEYKKILGNTPPPVLVDPNVQTDNA
    LGKVIDDIIKAEHYLESVFQPKLENANPAAKKVGSNIFSKFSALMKNQDKSKKEVLINRLRGELKKLDDFLKDTSEDDEL
    SPGRCLEGDNFTLADCDLLPKLHRVEVACKFFKFEGVMDGFDAVQRYLDAWKETPVYHIIKYDEKEVFNTYRFVVMKS

    >gi|115670788|ref|XP_782876.2| PREDICTED: similar to Thioredoxin domain containing 9 [Strongylocentrotus purpuratus]
    MDQVLQQQLSLVAEIMEGQVDAEIHRLDNLDEDELDVLRQRRLVALKKQREKEDEWRSIGHGQYQEIPVEKDFFAECKKS
    TNVVCHFYRESAER
    CRIVDMHLHRLAPKHMETRFLKINAEKCPFLAERLRIVVIPTIALIKDGKSKDYIVGFDDMGGRDD
    FPTEMLEWRLGCAEVINYSGSLTDPPTGGKGAKPTSKASDLLGRRTQKIIKGGRYNDSDSDLED

    >gi|115972776|ref|XP_001183397.1| PREDICTED: similar to Glutathione S-transferase omega 1 [Strongylocentrotus purpuratus]
    MSEHHFRTGETLPPLKPGVLRLYTMAFCPFAERTRLVLAAKGIDYELVNVNTFQKPEWYFDKNPDGVVPTLEQDDKLIQE
    SIVTCEYLDELYPDTAPMFPSDPYLRSRDKLFIQRFGKYISAFYQSAKQKGANEELRSAALKQVEWVEQELKKRGTPFFS
    GLSPGMVDFSIWPFIYRIPSSRSLGDGGLDSFVLLKQWMDRMRQDEIIAPRIVEDEALIEFSTHYRTPGSRFDEIQTKAV
    K

    >gi|115976525|ref|XP_001177822.1| PREDICTED: similar to Dihydropyrimidine dehydrogenase [Strongylocentrotus purpuratus]
    MARMLSRDIADIENLLALNPTVPSHAKVVLTKTTKANRKYWKRNGPKSCATCGDLDNNFDDVKHTTLSERAALREAARCL
    KCADAPCQKSCPTQLDIKAFITSIANRNYYGASKAIFSDNPLGLTCGMVCPTSDLCVGGCNLYASEEGPINIGGLQQFAT
    EIFKEMKIPQIRDPTLPSHDDLPESYQSKVALIGCGPASISCATFLARLGYTNLTVFEKEEWIGGLSSAEIPQFRLPYEV
    VSFEVDQMKDLGVKVELKKGLGMNGMTLESLKSSGQEAIFVGLGLPEAKRAPIFQDLTVEQGFYTSKDYLPLVSLASKAG
    M
    CACKSSLPKLHGNVIVLGAGDTAFDCATSAVRCGAKRVFIVFRKGFTTIRAVPEEMDVAREERCEFMPFLSPRKVILKG
    GRIAALELCRTEQDDEDNWIEDEEQTTRLKADFIISAFGSTLLNEEVKTALSPIRFNRWGLPEVSTDTMQMSEPWAFCGG
    DLGGVAQTTVESVNDGKTAAWFMHKYLQSLHGVPVPSTPALPKFCTPIDLVDTSVEICGLKFPNPYGLASAPPTTSAPMI
    RRAFEAGWGYAVTKTYSLDKDFVTNVSPRIVRGTTSGNVYGPGQGSFLNIELISEKTAAYWCKIVTELKRDFPDRIVIAS
    IMCSFNKDDWTKLAKMSEEAGADALELNLSCPHGMGEKGMGLACGQDPELVLNICRWVRAAVKIPFFAKLTPNVTNILDI
    ARAAKEGNADGVTATNTVSGLMGLKASSNAWPAVGKQKKTTYGGVSGNAIRPIALKAVSVIANNLPGFPILATGGIDSAE
    SALQFLHAGASAVQVCSAIQNQDFTLIEDYVTGLKALLYLNSLDDLGDWDGQSPPTVRHQKGKQVRVADVIGKHLPSFGA
    YQEERIKVVAAHKRNLDLTGDDQQPAPQRPAREPKKPIPTIRDVIGQALDRIGSYGQLDNTEQVVALIDEEMCINCGKCY
    MTCNDSGYQSITFDPKTHLPRVTKDCTGCTLCASVCPIIDCIQMVKRDGPYSPYRGIPLAVGTSS

    >gi|115702924|ref|XP_001200162.1| PREDICTED: similar to protein disulfide isomerase, partial [Strongylocentrotus purpuratus]
    CGHCKKMKPEYVEAAAELKENGLEGVMGAVDATKARALAERFEVKGFPTLKYFNPQEPPPPPPPEPSWSDSESEVDHLTD
    DNFKSFTKKKKHTLLEGVMGAVDATKARALAERFEVKGFPTLKYFKNGEHAWDLNERTADKFVEHLTDPQEPPPPPPPEP
    SWSDSESEVDHLTDDNFKSFTKKKKHTLVMFYAPW
    CGHCKKAKPEYMGAAEEFKEENKVSYAAIDCTEHKDSCTAFGVTG
    YPTIKYFSYGKLVQDYTSGREEADFIRFMHNQLSPGSAPSEPPPPPPDVNFWAELDGGENVFQIDDSIFESFLTSSPSVL
    IMFYAPW
    CGHCKRMKPAFAEAATLAKEQNLPGRFAAVDATVAVMTASAFEVKGFPTLKYFKNGKEDMTYSGARTAEALLE
    FIKDPASVPPPPPPEPAWSDVPSAVNHLTGQTFGQFIQDNTHVLTMFYAPW
    CGHCKKAKPSFQQAAEIFKDTPGRKLAAV
    DCTVEKGLCEQYEVKGFPTLNLYSNGQFVEKYTGGRMAEDFEAYMQKTELPEQTSEETPESENLDTPKKKVEL

    >gi|115736718|ref|XP_001201614.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDSVHDDVKEYYGKTIQTATDLLTDTCQLGASTAKDKLSVRQAISSVHDDILATYYGCGLTIPSLIEDARVVDLGSGTGR
    DCYAISKLVGPKGFVVGVDMTDEQLELARKYVTHHQEKFGYPAPNVEFRKGYIENLKDAHVEDNQYDIVVSNCVINLSPD
    KPSVVREAHRVLKEGGEFYFSDIYVQQDIPEHIRKHKVLWGE
    CLAGALCWTDLEKYAEEIGFTKPRVVTARKVKVEDKKL
    LEVTGDIVFMSVTYRLFKLSKDDCKNPAVVTYNGTLAEYETELPFDIENTFKANVPVKVDAELAEIMRKSRYSKVFTIGD
    GAKSGETEIAKDCPVDPYVTHLTKDQDFHSEPELTPIGSSLGSLRTWTDFIQVQLFKDSLL

    >gi|72069971|ref|XP_798918.1| PREDICTED: similar to CG8198-PA [Strongylocentrotus purpuratus]
    MAALGRATVRAVQGKKRLIPQRAALVLTQAAVEKIKTLVINKSEVEGLRVGVKTRGCNGLSYTLDYAKEKQKFDEEVVQD
    GVKIFIDSKAQLTLLGTEMDFVNTKLSSEFVFNNPNIKGTCGCGESFNV

    >gi|115746847|ref|XP_001201569.1| PREDICTED: similar to PDI-like protein, partial [Strongylocentrotus purpuratus]
    MALVELFGETLHGAGGAEVATSTLAGSGRYVGLYFSAHWCPPCRMFTPTLAEFYKAFTKKNEGKLEIVFVSSDQSQEDFD
    GYFKDMPWLSLPYVDRERK

    >gi|115702932|ref|XP_001200190.1| PREDICTED: similar to CG8198-PA [Strongylocentrotus purpuratus]
    MAALGRATVRAVQGKKRLIPQRAALVLTQAAVEKIKTLVINKSEVEGLRVGVKTRGCNGLSYTLDYAKEKQKFDEEVVQD
    GVKIFIDSKAQLTLLGTEMDFVNTKLSSEFVFNNPNIKGTCGCGESFNV

    >gi|115619683|ref|XP_001189890.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    ECLAGALCWTDLEKYAEEIGFTKPRVVTARKVKVEDKKLLEVTVTYRLFRPNVPVKVDAELAEIMRKSRYSKVFTIGDGA
    QSGETEIAKDCPVDPYVYLGCADAAPGCC

    >gi|115926010|ref|XP_001185732.1| PREDICTED: similar to glutathione peroxidase, partial [Strongylocentrotus purpuratus]
    WGILFSHPADYTPVCTTELGRVATLTPEFEKRGVKLIALSCDGVESHRGWIKDIVDYAKFEKTWPYPIIADPKRELAVQF
    GMLDPDEKDSAGIALTARCVFIIGPDKKLKLSLLYPATTGRNFDEILRVIDSLQLTATKRVATPADWKSGEDCMVLPNIS
    EEDAAKLFPQHRKVAVPSGKGYIRLTPQP

    >gi|115911624|ref|XP_783841.2| PREDICTED: similar to conserved hypothetical protein, partial [Strongylocentrotus purpuratus]
    TQALKCAPTTGSKTQLMSTGAEAQESTQPELKLSDSCVKQLHKLGEDKEFLRILVEGGGCSGFQYKFEMDSEMTEDDRVF
    ERDGAKVVVDDVSLEYIKGSTIDYHEELIRSAFSVIDNPGAEMGCSCGASFSFKL

    >gi|115637269|ref|XP_786413.2| PREDICTED: similar to LOC496161 protein [Strongylocentrotus purpuratus]
    MAGLISVKSVEDFGKEVDQTVSGLLVVHFRAQWAPQCEQMDGVMVELAKEHTQVRFSTVEAEELPEISKQYSIAAVPTFI
    LIKGKNEVDRLDGANVPELTKKVKHHADPNASPVMLPASSQPPKEDLNTKLKGLINAAPCVLFVKGSRQEPR
    CGFSRTLM
    GLLDERKIDYSTFDILGDEEVRQGLKKYSDWPTYPQVYVNGELIGGLDIIKELDASGELDQSLPKKQDLDDRLKALITRS
    PVMLFMKGSPGEPK
    CGFSRTITSILTGTGLKYDTFDILQDQEVRQGLKTYSNWPTFPQLYVSGELVGGLDIVKNTIMCTP
    NAKDFLKCYLNNVSHEHHLFPRLIYA

    >gi|115698606|ref|XP_001180085.1| PREDICTED: similar to PDI-like protein, partial [Strongylocentrotus purpuratus]
    MALVELFGETLHGAGGAEVATSTLAGSGRYVGLYFSAHWCPPCRMFTPTLAEFYKAFTKKNEGKLEIVFVSSDQSQEDFD
    GYFKDMPWLSLPYVDRERK

    >gi|115746534|ref|XP_787930.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MYPKREVFILLFLICVFRYGESGKTNVVKITDKDWSRTLEGEWLIKFYAPWCPACKSIMPVWKELSDWSQELNTNIAEVD
    VTEEPGLSGRFAVTSLPSIFHAKDGIFRRYLGPRTKDDLISLVEERKYEEIEPVAGWQSPNSIA

    >gi|115970172|ref|XP_001187684.1| PREDICTED: similar to GA15005-PA [Strongylocentrotus purpuratus]
    MQNPNEDTQWNDILRAKGIIPEKEATVTEDQIEGMLDQAIQKKTGVGAQDKALEDMTLDELDELEDEEEERILQQYRQQR
    VAEIKRIQDKAIYGSVKDISAQDYVQEVNNAGEGVWVVLHLYKAGIPL
    CALINQHLTQLAGKFRATKFLRSIATTCIPNY
    PDKNLPTIFVYNEGEMKTQFVGPLEFGGMNLTIEELEWKLAEAGAMKTDMKDPPKPQVRSTLNIFSGRNQNVDDSDDEDD
    Y

    >gi|115975735|ref|XP_001175593.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MRFARCGFLLGVAILAVIICDQQSYAVKKEEQLGERVKQLVEWGNKRAVIRMNGDKYRLYAKSAPRNYSLVIMLTAMQPQ
    RQ
    CSVCKAVGEEFQIMANSWRYSQAYSNRLFFASVDYDEAADVFKSLKINSAPSIIHFPAKGKSKKGDTYDIQRLGFQAE
    NLAKWVAERTDVHIRIFRPPNYSGTIALGILLAMVAGFLYFRRNNLEFLYNKTMWGVGALSIVFAMTSGQMWNHIRGPPY
    AHRNPQNGQVSYIHGSSQGQFVAETHIVILLNAAVTCGIILLNKNSITDGDVRKRRVVTVIGLALVVFFFSLLLSIFRAK
    YRGYPYSFLIK

    >gi|115970178|ref|XP_001187865.1| PREDICTED: similar to ENSANGP00000020140 [Strongylocentrotus purpuratus]
    MRLFIVLIAVGAASALFDTSDDVVELTAANFNQKVINGDEVWLVEFYAPWCGHCKNLAPEWKKAATALKGVVKVGAVDMD
    VHSSVGAPYNVRGFPTIKVFGANKASPTDYNGARTATGIIESALKTVKDMVNARSSGGGGGGRGSGGSGSGGSGSGGSGG
    KADDVVELTDGNFEKEVLNSKDGVLVEFFAPW
    CGHCKSLAPEWAKAATELKGKMKLGALDATVHTVTASRYNVRGYPTLR
    YFPAGVKDANSAEEYDGGRTATAIVAWALDKFSANIPPPEVMELIEQKVLTDSCDVKPLCIISVLPHILDSGAVGRKQYL
    QILKGMGEKYKKKDWGTVSVGRGSSESIRGDALPSIETKEPWDGKDGEMPEEDDIDLSDFDMDDDDEDEDVEVEKKDEL

    >gi|115930680|ref|XP_001180040.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MFNSPLGIIFLVGLWYGGEGNAIEEPAQKLLHRGESGDQGSCPNHFAEFFYQISQRNRGTIYLADTTDIEQQAWLSTSFQ
    LFELSELLKGLNGTAGNKSQPDQKPSPKFKCGENGGIENGSGEVIMVNSSELVRLVSQRPNASAIANSSAEASTNTSDNS
    SQSSENVCVVVMFFATS
    CRFSAATAPHYNAFGRAMSAVDVLAFDINQSNGVNSRYGIVAVPSIVLFHNGKLAARFNESQR
    SLESMMDFVHNLTGLPVNKSVTVLEGDHEGPVPTTAVIGPDYFLWFSNTFLFLCALRLLQQKVGAAVRAKITAIQEYVVQ
    VWRTGEFYEQVGIADNDEVPMNNDAAEIR

    >gi|115953201|ref|XP_783642.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MSRRHLKQGEANPTVKPDVLRLYSMGFCPFAQRALLVLAVKGIDYELVNCNLNHKPEFLLERNPAGTVPVLEFQGNIVTE
    SLVICDLLEDLFPDKPLKAKDPFQKAKNRLAVGKFDSIVSLFYKVGYNPDDADAKETLRKSMKEYQAFFTAKKTNFFGGD
    QWGMVDLMVWPWIERMHVLGAVIIDDFVPEFKAWVDRMGTVPAVQACRISKEKLSEMYTGYFARNAVYD

    >gi|115698327|ref|XP_001176684.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MILGCHFLKHGLALGSKIIRHRKGFLTSVHAYQVRGDENLHVKELLEERNHQYPSSDSGKKMSAGEELPVTKDDAASVKR
    PQFGNRFLENPDNVFQHNAWDNVAWDPEQLEAAKKKVGENSSQQVEPDKKELYEADADRYWNEFYSLHQHKFFKDRHWLF
    TEFPELSSDNAQASAKEILEVGCGVGNTIFPILQTNADPGLFVYGCDFSSVAVDIVRQHAEYNPSRCHAFVCDVSDPAAS
    FPVPDNSLDLVVLIFVMSAINPDRFLSTIQTLTRLLKPGGRILFRDYGRYDLAQLRFKKGR
    CLSENFYVRGDGTRVYFFT
    QDELRELFISAGLVEEQNTIDKRLQVNRGRQLTMYRVWIQCKYRKP

    >gi|115666271|ref|XP_782723.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MRFARCGFLLGVAILAVIICDQQSYAVKKEEQLGERVKQLVEWGNKRAVIRMNGDKYRLYAKSAPRNYSLVIMLTAMQPQ
    RQ
    CSVCKAVGEEFQIMANSWRYSQAYSNRLFFASVDYDEAADVFKSLKINSAPSIIHFPAKGKSKKGDTYDIQRLGFQAE
    NLAKWVAERTDVHIRIFRPPNYSGTIALGILLAMVAGFLYFRRNNLEFLYNKTMWGVGALSIVFAMTSGQMWNHIRGPPY
    AHRNPQNGQVSYIHGSSQGQFVAETHIVILLNAAVTCGIILLNKNSITDGDVRKRRVVTVIGLALVVFFFSLLLSIFRAK
    YRGYPYSFLIK

    >gi|115644435|ref|XP_786503.2| PREDICTED: similar to thioredoxin peroxidase [Strongylocentrotus purpuratus]
    MAAKARVQDPAPYFEGTAVSTTGEFVDVKLSDYKGKYLVFFFYPLDFTFVCPTEILAFSDRSDEFTKIGCEVLAASCDSH
    FCHLAWTNTTKKLGGVGQLKIPLLSDMSGKIARDYGIMIEKEGISLRGLFIIDDKGTLRQITINDLPVGRSVDEVLRLVQ
    AFQFTDKFGEVCPAGWKPGDDTIKPGVKESKEFFGKQ

    >gi|115770607|ref|XP_001188365.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    CTRFSNRARQICTSSTILQADGESSPPVSRFPIPDRKTLPDDVQQVMDEVEEKSGFLPNVFKMLSYHPDSFRSFVNYYNV
    LMENSGNLTKADKEMIVVATSSVNNCMY
    CIIAHSALHRIYSKNPTLADQIVANVDMAALDSRQRAILDLALAVCKNEPIT
    DEHFTNLEAHGLDQEDAFMVGSVAAFFAMSNRLAHLTSSRPNKEFYLLGRIPREKK

    >gi|115938045|ref|XP_001197806.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MEGKEATYIKGITHDKCVVVFSKTHCPFCHKVKTIFEDFGASYEVVEMDKRSDTSAMQAVLGKMTGASTVPRVFIQGKCV
    GGYDDTKRLQDSGRLEEMLRDCNAIE

    >gi|115901735|ref|XP_796486.2| PREDICTED: similar to Glutathione S-transferase omega 1 [Strongylocentrotus purpuratus]
    MSEHHFRTGETLPPLKPGVLRLYTMAFCPFAERTRLVLAAKGIDYELVNVNTFQKPEWYFDKNPDGVVPTLEQDDKLIQE
    SIVTCEYLDELYPDTAPMFPSDPYLRSRDKLFIQRFGKYISAFYQSAKQKGANEELRSAALKQVEWVEQELKKRGTPFFS
    GLSPGMVDFSIWPFIYRIPSSRSLGDGGLDSFVLLKQWMDRMRQDEIIAPRIVEDEALIEFSTHYRTPGSRFDEIQTKAV
    K

    >gi|72094692|ref|XP_795849.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDRTIQLISAALLRVELSSDERKTIIEKQLQRLSEKEDKTDNVEIPAGLEWFNTSGPLSFKSNLQGKLVVLDFFTYCCIN
    CMHILPDLEALEEKYSVEDGVVVVGVHSAKFENEKVSANIKNAILRYNIHHPVVNDPDAVMWNDLNIQCWPTLLIVGPSG
    EPILSIIGEGHRDILFEVVQLSLDHFKSKLSPHSLPVVDLKDSLVDSPLLYPGKVTTNPEGTLLAVSDTGHNRVIIVALD
    GVVQHCIGGPETGFNDGLYREARFHSPQGLCWAQDVIYVADTENHAIRKIDLKEQCVTTIAGTGEQGVDWYGAGRGTEQV
    ISSPWDVVLGPPNEDVLFIAMAGTHQLWGLFLSDGHWLKAVSHDAGICMNYAGSGKEENRNNSYPRKAGFAQPSGLALAP
    QEPFNCMFVADSESSSIRRVSFKDGAVKNVVGGEMDPMNLFAYGDSDGKGLEAKLQHPLGVAWDHSKLLFVADSYNHKIK
    MIDPEERYCATYAGTGEPGKGGDDEHILKAQFNEPGGLAISPCGCKIYVADTNNHTIRCIDIKTSTVTELKVVLPPVTSV
    DSKPSAPKKVKTMLPKHASPTTVEGLSVGLDGSVTLVLDVSLPPESYLTEGAPSAWQIFIPGSEPQSVMSITRLESLSNP
    LPSYTWTPPPDTQLPVTLQVESTLYYCLTSGVCKRQVLGYSVPVTRQEGAPQDVKVELSHQVLEDS

    >gi|115746275|ref|XP_001175647.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MILGCHFLKHGLALGSKIIRHRKGFLTSVHAYQVRGDENLHVKELLEERNHQYPSSDSGKKMSAGEELPVTKDDAASVKR
    PQFGNRFLENPDNVFQHNAWDNVAWDPEQLEAAKKKVGENSSQQVEPDKKELYEADADRYWNEFYSLHQHKFFKDRHWLF
    TEFPELSSDNAQASAKEILEVGCGVGNTIFPILQTNADPGLFVYGCDFSSVAVDIVRQHAEYNPSRCHAFVCDVSDPAAS
    FPVPDNSLDLVVLIFVMSAINPDRFLSTIQTLTRLLKPGGRILFRDYGRYDLAQLRFKKGR
    CLSENFYVRGDGTRVYFFT
    QDELRELFISAGLVEEQNTIDKRLQVNRGRQLTMYRVWIQCKYRKP

    >gi|115899553|ref|XP_784460.2| PREDICTED: similar to thioredoxin peroxidase [Strongylocentrotus purpuratus]
    MIRILSLILAVSTLVAAEEACHSFAGGHVYPGETPRSTAHAVHWSKVQISKPAPVFEGTAVVEGEFKAMKLSDFAGKYLV
    LVFYPLDFTFV
    CPTEIIAFSDRVDEFRAINTEVVAISVDSQFTHLAWINTPRTQGGLGPIKLPILSDLTHQIAKDYGVLL
    EDLGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTVSPSIIPNPADKLKYFA
    KQPNGGNA

    >gi|115954650|ref|XP_001192224.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MASSKQGRKHQAKEAIGAFCHILNSNVFITRITPEQFRQAKFDQPEAISSMWTLLKELLQLNFTSSTISKSAKNLAASHL
    EKADVQSLLYQMGYRCLGFHDDGDVGSRDILVAIGWLLAKLDFVNEQAKVKLEDASPPISTFHLGAVQKALNSGITKASS
    QWLKDSGPSTPVGQAKYLVWLMGRLRLALKTLYCEQQGLCAAIHHVHEATQGVSMPHPSRVNHLTAWETFILRHPKQLQQ
    MSVHEAKMSSAAVNPIPPISSNNHHAHHVVATKERSRRIQRLHDLEIELNRQRQVLEDELESRGANDLVSQLSDHPDIHK
    RKADIDNAVRAKLTNSFEEHRKVNTRSYPLPTVQFSFKPEQAKNRRLKPEALPPNTLNIKDEITRMLDGVRRLQEELDSV
    KLKQQQRLDGFAEGLMNVVCIPPMLEKTSYSSSGTSTFSGNAKKNNNDVHRCFCELNGVVDDCTCKVESVSEFNNIRLFP
    PLNSLLNKNYFKFFKVNLHRPCPFWADDSR
    CAMKGCHVCPCSPDDLPCGLKEESNENKYSSDSNKPVDDTSDEEEECNKE
    ETEEDEDQLGALDTTISRENMLAFETWKTHDDAQLNFCEKEDEHSGDVEYVDLLLNPERYTGYKGTSPHRIWSSIYNENC
    FRPETPESTATTYESFLSNKKLKDMCLEKRVFYRLISGLHSSINIHLCAKYLLSEGLFEQERWGRNIEEFQSRFDPETTD
    GEGPIRLKNLYFTYLVALRAIAKAAPVLEKEFFYTGEPVEDQEVQRIVKEILKIANSFPEHFDESAMFQGDQQQALQLRE
    EFRTHFRNISRIMDCVGCDKCKLWGKLQIKGLGTALKILFTEQGVGKKSKLTLDRGEIVALFNVFGKLSGSIVEIEEFQE
    LLSQDKASAPKKMPGFL

    >gi|72043691|ref|XP_791396.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MMSPKLRIFVLLLAVLSLSIHVVSSQDDEETEESNVVEEIVEEAFHVEEEDDVLVLTTDNFDDVVNGEDIILVEFYAPWC
    GH
    CKTLAPEYAAAALEMKSATPPVSLAKVDATENKELASRFDVSGYPTLKIFRKGKPFAYDGPREKNGIVQFMKKESDPN
    WTPPPEAVLTLTSENFDDIVNEADLILVEFYAPW
    CGHCKKMAPELETAATALKSNDPPVLIAKVDATAESDLGTRYDVSG
    YPTLKIFRKGKESEYKGPRESRGIIQYMQKQVGDSSQLLGSTKALREFLAHQDDVSIVGFFNSNQDPLYTTYLDAGNGLR
    DNYRFAHVFDQDSRDSYKINAPSVVVFLPERFRSKYEPWRHVFTQTEGSVQDLENFYKENDVPLVGQMTKENRERRYTDR
    PQLVAFFSVDWSFDHRVATEIYRQKIVEVAKDKEFDELHFAIADEEEFAAEMKQLELDDSGEDINVGIFTADGLRFKLEP
    EDDFESDVLREFIRTWQNGDLKPVIKSQPIPKKSKAAVKTIVGKTFEKIVLDKSKDVLIEFYAPW
    CGHCKKLDPVYKKLG
    KKFANTKNLVIAKMDATANDVSNGAYTTTGFPTIYFSKAGDKDNPIKFEGGERSLEKLSEFIEEHATVAVLQDRDEL

    >gi|115758869|ref|XP_001203858.1| PREDICTED: similar to interferon gamma-inducible protein 30, partial [Strongylocentrotus purpuratus]
    VQKQCLLWQSEQKAADAPLVRYELYFESLCPGCRQLLTTELYPAWQKVKSIVNVTLVPYGNAIELEVAGKWQYTCQHGPQ
    ECVGNLVETCALSILPFDKAFPFIYCLETNNPATAGSQCAKELGLLSEYPSIQNCSEGSMGNALEHSMALKTEALNPPHE
    YVPWVVLNGAHTNAIQNQAETDSLGLICQAYTGVKPAGCTQEGRMRSPRD

    >gi|115926055|ref|XP_001187770.1| PREDICTED: similar to maleylacetoacetate isomerase [Strongylocentrotus purpuratus]
    MAASMPILHSYFRSTCSWRVRTTLALKGIDYEYKGVNLLKGEQLSDAYLTVNPMGQVPALEIDGLLMTQSLPIIEYLDET
    IPNCSLFPKDPIKRYMARQVAETINAGIQPVQNLSMCKFVGAERKMELGNTFITKGFVALEKTLASTSGKYCIGDEVTVA
    DVFLVPQVYNANRFKVDMSAFPVISKINDVLGELDAFKASHPSKQPDCPEDLRQ

    >gi|115774617|ref|XP_001178018.1| PREDICTED: similar to Chloride intracellular channel 2 [Strongylocentrotus purpuratus]
    MNGEEVENVEQLDNMKIEDEEEIVTNEEENATYEEEDAPNEDQEEETSDTAAGDANGNGDGDGAEPETTETAAPDTNGDG
    AEQEEDSGDQPITLYIKAGVTSKIAD
    CPLCQRLFMIIVLKKIKYQVCTVNKEILPAEYKKILGNTPPPVLVDPNVQTDNA
    LGKVIDDIIKAEHYLESVFQPKLENANPAAKKVGSNIFSKFSALMKNQDKSKKEVLINRLRGELKKLDDFLKDTSEDDEL
    SPGRCLEGDNFTLADCDLLPKLHRVEVACKFFKFEGVMDGFDAVQRYLDAWKETPVYHIIKYDEKEVFNTYRFVVMKS

    >gi|115929118|ref|XP_001182751.1| PREDICTED: similar to Glutathione S-transferase omega 1 [Strongylocentrotus purpuratus]
    MPEQSEHHHFKTGEALPPLKPGVLRLYSMAFCPFAERTRFVLAAKGIDYELVNVNTFHKPEWYFDKNPDGVVPTLEQDDK
    LIQESIVTCEYLDELYPDTAPMFPSDPYLRSRDKLFIQRFGKFISGFYLSGKEKGENEELRSAAIKNVESVEQELKKRGT
    PFFSGSSPGMVDFSIWPFIYRLPYSRSLGDGGLDSFVLLKQWMDRMRQDKIIAPRIVEDEALLEFSTHYRTPGSRFDEIQ
    TKAIK

    >gi|115717983|ref|XP_781903.2| PREDICTED: similar to transposase [Strongylocentrotus purpuratus]
    MKLIKVNYDTFKPIHSVKNKGESELLKEYEDVFDDARPGKLPGLVHLVTDQARDVRPTQCNAKPVPVSMKEKIKKGLNDL
    VQQDILAPVDEPTDWCSRLVVTEKKGTKELRYCIDPRPLNKQALAGLEGVECVADDIIVFGVGSTEEEAEGSHDQRLRAL
    LQRCRERGIKLNQKKSVLKAPSVTFPGHIVSAEGLKPDPSKIKAIVDLPDPTDATEVQRVQGSVQYLARFLLRLSETFEP
    IHKLTHKGVPWEWKTEHETAMKETKRLLTAAPILAFYDPEKELVIQCDASKSGLGSTLLQEGKPVAYASRALTETEQHYA
    QIEKEALAIVFSLERFHQYTFGRHVKVHSDHKPLETIVKKPLHRAPRRLQGMLMRMLHYDIEITWVKGKDIHIADLLSRA
    YLPETTGAGDFAEVNAVTGPSMNEDKIKELAEHTSKDENLQILKAVIMQGWPEEKSLVPEEAKPSRDELSYQNGLLYRGE
    RIVIPVTMRKKMREMLHDSHLGVESCLRRARECLHRPGMNADIKTFISTCDTCRTYERQNQKETLQPTELPDCPWEKVGV
    DLFELKGKHYLVTVDYFSNFWEIDRLHELDSRMVIKKLKGHFARYGIPNTIISDNGPQFASEAFAKFRKKWEFDHLTISP
    RHSQTNGKAEPSLVVNVASD
    CGYTDRTYRDLVDLSKDPQFEDRLNILAFPCNQFGHQEPQSNEEIKHYVKALYDVEFPLF
    AKVEVKGYDADPAWQYLTSNAHQEPTWNFWKFLVDSEGKVKDAWGPDVPIHSIYGELLNEALMADPYHYHHAHFDDEF

    >gi|115752588|ref|XP_782447.2| PREDICTED: similar to Dihydrolipoyl dehydrogenase, mitochondrial precursor (Dihydrolipoamide dehydrogenase) [Strongylocentrotus purpuratus]
    MSLLPVANRAGRCLSTVNHVHKLSRCSTSALWRGQRRHMASVEEQDLVVIGSGPGGYVAAIKAAQLGLKTTCVEKNDTLG
    GT
    CLNVGCIPSKALLNNSHLYHMAASKDFKSRGIDVGDIKLNLPKMMGQKSDAVKGLTNGVAHLFKQNSVTRIQGHGKVM
    GPNEVAVLHPDGKIKEVVKTKNILIATGSEVTPFPGIEVDEKTVVSSTGALSLERVPDHMVLIGGGVIGLELGSVWQRLG
    AKVTAVEFLGHIGGVGIDMEMAKNFQRILTKQGIKFKLNTKVTGATRTGDDISVSVESVKDPNKKEDLQCDTLLVCVGRR
    PYTNNLGLEELGISLDERGRIPVDNRFATSVPSVFAIGDCIQGPMLAHKAEDEGIIAVEGMAGGPVHIDYNCVPSVIYTH
    PEVAWVGKTEEQLKEEGIKYKVGKFPFAANSRAKTNGDTDGLVKMLSDAATDRILGAHIIGSGAGEMINEAALAMEYGAS
    CEDVARVCHAHPTVSEAFREANMAAYSGKAINF

    >gi|115949609|ref|XP_001180729.1| PREDICTED: similar to transposase [Strongylocentrotus purpuratus]
    MKLIKVNYDTFKPIHSVKNKGESELLKEYEDVFDDARPGKLPGLVHLVTDQARDVRPTQCNAKPVPVSMKEKIKKGLNDL
    VQQDILAPVDEPTDWCSRLVVTEKKGTKELRYCIDPRPLNKQALAGLEGVECVADDIIVFGVGSTEEEAEGSHDQRLRAL
    LQRCRERGIKLNQKKSVLKAPSVTFPGHIVSAEGLKPDPSKIKAIVDLPDPTDATEVQRVQGSVQYLARFLLRLSETFEP
    IHKLTHKGVPWEWKTEHETAMKETKRLLTAAPILAFYDPEKELVIQCDASKSGLGSTLLQEGKPVAYASRALTETEQHYA
    QIEKEALAIVFSLERFHQYTFGRHVKVHSDHKPLETIVKKPLHRAPRRLQGMLMRMLHYDIEITWVKGKDIHIADLLSRA
    YLPETTGAGDFAEVNAVTGPSMNEDKIKELAEHTSKDENLQILKAVIMQGWPEEKSLVPEEAKPSRDELSYQNGLLYRGE
    RIVIPVTMRKKMREMLHDSHLGVESCLRRARECLHRPGMNADIKTFISTCDTCRTYERQNQKETLQPTELPDCPWEKVGV
    DLFELKGKHYLVTVDYFSNFWEIDRLHELDSRMVIKKLKGHFARYGIPNTIISDNGPQFASEAFAKFRKKWEFDHLTISP
    RHSQTNGKAEPSLVVNVASD
    CGYTDRTYRDLVDLSKDPQFEDRLNILAFPCNQFGHQEPQSNEEIKHYVKALYDVEFPLF
    AKVEVKGYDADPAWQYLTSNAHQEPTWNFWKFLVDSEGKVKDAWGPDVPIHSIYGELLNEALMADPYHYHHAHFDDEF

    >gi|115963170|ref|XP_001185904.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAAPMEHTSSTASEKKPSKKKPCRACTDFRSFAQDKGVMLPPGFPVPNGSNSQGATPAQDEKPDRECPLDREELGRNTWS
    FLHTTAAYYPDQPTKTQQSEMSQFIHLFSKFYP
    CEDCSEDLREKLKTNHPDTTSRSNLSQWFCRLHNDVSRRLSKPEFDC
    SKIDERWLDGWKDGSCDW

    >gi|115711963|ref|XP_791907.2| PREDICTED: similar to Ubiquitin-activating enzyme E1C (UBA3 homolog, yeast) [Strongylocentrotus purpuratus]
    MDSVTTMALSGFRQIDVIDMDTIDLSNLNRQFLFRTKDVGKGKATVAADFINDRVAGCKVTPHFDRIESFDETFYRRKTL
    LILMRIPWVNKTIYSSATLSMVGYDDEGNMDPDTIKPMIDGGTEGFKGNARVIMPGMTPCIECTLDLYPPQVNFPM
    CTIA
    HTPRLPEHCIEYAKVLLWPQEDPFAGILLDGDDPSHVQWIFEKAQDRADQYNITGVTYRLTQGVVKRIIPAVASTNAVIA
    AQCVTEAFKIATSCCFPLKNYMVFNDTDGLYTYTYEAERKEDCLACSRKPQNLELPEDATLQMLVDHLTESNTLQMKAPS
    ITTTVDGRNKTLYMQSVESIRKRTKENLPKKLTDLGLLSGNELAVADATTPSCLIFILKLVPK

    >gi|115732236|ref|XP_001203895.1| PREDICTED: similar to KIAA0962 protein, partial [Strongylocentrotus purpuratus]
    HPDKSDDPNASDKFIKIQQSYEILSDEAKRREYDQFGIVDPQESQRRQRDPFADQFFQQNNNFGGGFNFHNSGNNDPRRV
    TLSRLQDGILPQSTDKPYLIFVTGSF
    CFNCMNIERMWSDITPEIESWGVGVGSVNIDSDRRLASVLGIRHRPAIAGIING
    QVTDYGQGSVTLKAMRDFVDRLLPSSLIQEVHNNNYEDFFANFYNENKPRVLLYSRNRDIPIIFKVGAFAFREHQTFGFT
    SAKYSNTDGVLKHVGVQHRTGKVLVFKENIKESVDMVEEKHMTLEALTHLLNYNKYLYLPRLSSQTLFEEMCPETPNLVG
    RKLCVIQITKATPEHEPFRASFRDMVMSTPSWPHEAKMTYMLFENQEQVAAAMEGLMVEVQHAVPVAIVWRQRGNQIRHA
    WLPDGWEGQDITLERRGIKEFLYRLNDGTSKFAHKGILPQFNDENAPAWPIRKFRELTQKMTDLYNAAYNFIFGSS

    >gi|115960496|ref|XP_001182038.1| PREDICTED: similar to GA20735-PA [Strongylocentrotus purpuratus]
    MTHFDDWSLQSMLGLASLVQGLIKGHRIMLFSKSYCPFCLMAKSVLQDVGANPVKVLEIEERSDEQEIQDVLLDLTGVRT
    VPSVFIDQDYLGGGSDLQRMMEEGHLQKLLREKGLLNAGNESSADR

    >gi|72004828|ref|XP_784122.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MSLFTQIIRPSTRLFRSFQATGLPHCQLRLLSTELKERIDGLVQGKKVVVFMKGVPEEPQCGFSNAVVQIMRMHGVDNYE
    SHNVLEDKDLREGIKEYSEWPTIPQIYMEGEFVGGCDIVIQMHQTGDLIDELKKIGIRSALLDAPKEEEPSK

    >gi|72011673|ref|XP_784555.1| PREDICTED: similar to mercaptopyruvate sulfurtransferase [Strongylocentrotus purpuratus]
    MQRVSALVSCEWLSRILSPQTQYLRVLDGTWYMPSSGMDPKAEFAKKHIPGAEQFSIDDCTLPHSPFSNTLPTPEFFAEY
    VGERGICNNTHVVVYDNHPQLGVFSAARVWWLFRVFGHNAVSVLDGGLPLWEKAGHPLCSSTAPSEVEKQEFKAELQPNL
    VKRFSDMTGNLNTNKFQVMDARSKARFLGKVPEPREGLTCGHMPGSANVPFSTLLNDDDSERARLMKSPEELVKIFADSG
    IDLSGPVTAT
    CGSGVTACILALAAHQTGKKDVGVYDGSWEEYAQKATEDQMVVCNPETASAG

    >gi|115968200|ref|XP_001179554.1| PREDICTED: similar to LOC495430 protein [Strongylocentrotus purpuratus]
    MELYSTLLIGTFLVVLGGALAQDTKGRGLGEQYDWVTFEDGLKLAKENNKPMMLVIHKTWCGACKALKPKFAASEEILKL
    SSDFVMVNVEDDEEPEGSQFQPDGGYIPRILFLNSDGVVQPDLINTLGNPQYKYFYSNALMVTEAMKSAVKALGGSRNDE
    L

    >gi|115971422|ref|XP_001191833.1| PREDICTED: similar to methionine-R-sulfoxide reductase family protein [Strongylocentrotus purpuratus]
    MIIAHHSCVPYGWPSFSDMAGQGTVKSKEDYSHGMLRTEVVCAKCGAHLGHVFNDGPKTTGLRYCINSACLNFKGEAKPG
    L

    >gi|115921037|ref|XP_001180576.1| PREDICTED: similar to methionine-R-sulfoxide reductase family protein [Strongylocentrotus purpuratus]
    MIIAHHSCVPYGWPSFSDMAGQGTVKSKEDYSHGMLRTEVVCAKCGAHLGHVFNDGPKTTGLRYCINSACLNFKGEAKPG
    L

    >gi|72011671|ref|XP_784494.1| PREDICTED: similar to Thiosulfate sulfurtransferase [Strongylocentrotus purpuratus]
    MTSSEGKVPALVSTEWLAEALRTQKTPDGRPLRVLDATYRPGPASAGRDAHDKQHIPGSLHIDLDQLRDKDTTYYYTMPT
    PEFFAEFVGKTLGIDKDTHVVIYENELFYKIMSAPRIWWMFRYFDHGVVSVLDGGLQQWIAENRAVTDEATPSPKPATFK
    VTKTRAEIFKNYDDVLQNVKEPSFQLMDSRPVDWYDGSMPSAYPGLKLGIMKMALNIPFPNVLLEDSTKFKSADDLRALF
    QSNGIDLSRPLTST
    CFVGVTACILALGAFVVGKEDVAVFDGSWDEYSQRGPEDSMTIYEEKVKP

    >gi|115955510|ref|XP_001180735.1| PREDICTED: similar to J1A crystallin [Strongylocentrotus purpuratus]
    MSSVSSRAAGAIVGSFIADAASLPVHWVYDQEKLAAEVSKHPTPEFLPEGICPYYKLPTGKNSAYGDHLYVLLKSVVESK
    GFDVGAYKAGLKVMFGPGSAYDYQRPSGQAEGPYIHGYMKKYLANIAQDKEDTGDTGSTDTDGVINSAVIVALYGGDPQM
    TSKLEEAVKVVQNTPICIKYALTGAKLLEGLIMNGPNPNAVADLKGLVDNDVAQEISKAEDMKVHPHNVAAKKLGYA
    CSL
    PGGFLSMLHCLLNAKPGKFTESIRPTLLAGGDNCSRAAMLGAILGAQMGLEGLPMDLLAKVERGQEVKALAEQLVAMRQS


    >gi|115724766|ref|XP_001192881.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    MASGEVKTYDYLVLGGGSGGIASARRATEFGVTAAVIEGSRLGGTC

    >gi|115680285|ref|XP_001175667.1| PREDICTED: similar to Y34D9A.6 [Strongylocentrotus purpuratus]
    MAQTFVDAQIRDNKVVMFSKTFCPYCKMAKDSLASAGLKDYKVVELENHNMCAEIQDYLNKLTGARSVPRVFIGGKCIGG
    GSETKALQESGKLTTMLQQNGAM

    >gi|115940262|ref|XP_001195243.1| PREDICTED: similar to Glutathione peroxidase 1 (GSHPx-1) (GPx-1) (Cellular glutathione peroxidase) [Strongylocentrotus purpuratus]
    MLDAVCYDDAESLSDVAMTKSLSLDDYRGKVVLVVNTASFCTYTYQYPYFNELKNEFGDQLAILGFPCNQFWLQEPGVGQ
    EIPNTLRYVRPGGGYEPNFYLNEEKIDVNGPKAHPLFKKLKNSCPPVKMEIGDPSNLYWSPMTIGDVTWNFNKFLLDKEG
    VPFKRYDSVVEPLQLVSDIQLVVDGDYKTVKRPSRPKYATEEL

    >gi|115974985|ref|XP_001204478.1| PREDICTED: similar to Thiosulfate sulfurtransferase [Strongylocentrotus purpuratus]
    MTSSEGKVPALVSTEWLAEALRTQKTPDGRPLRVLDATYRPGPASAGRDAHDKQHIPGSLHIDLDQLRDKDTTYYYTMPT
    PEFFAEFVGKTLGIDKDTHVVIYENELFYKIMSAPRIWWMFRYFDHGVVSVLDGGLQQWIAENRAVTDEATPSPKPATFK
    VTKTRAEIFKNYDDVLQNVKEPSFQLMDSRPVDWYDGSMPSAYPGLKLGIMKMALNIPFPNVLLEDSTKFKSADDLRALF
    QSNGIDLSRPLTST
    CFVGVTACILALGAFVVGKEDVAVFDGSWDEYSQRGPEDSMTIYEEKVKP

    >gi|115639671|ref|XP_001202290.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDRTIQLISAALLRVELSSDERKTIIEKQLQRLSEKEDKTDNVEIPAGLEWFNTSGPLSFKSNLQGKLVVLDFFTYCCIN
    CMHILPDLEALEEKYSVEDGVVVVGVHSAKFENEKVSANIKNAILRYNIHHPVVNDPDAVMWNDLNIQCWPTLLIVGPSG
    EPILSIIGEGHRDILFEVVQLSLDHFKSKLSPHSLPVVDLKDSLVDSPLLYPGKVTTNPEGTLLAVSDTGHNRVIIVALD
    GVVQHCIGGPETGFNDGLYREARFHSPQGLCWAQDVIYVADTENHAIRKIDLKEQCVTTIAGTGEQGVDWYGAGRGTEQV
    ISSPWDVVLGPPNEDVLFIAMAGTHQLWGLFLSDGHWLKAVSHDAGICMNYAGSGKEENRNNSYPRKAGFAQPSGLALAP
    QEPFNCMFVADSESSSIRRVSFKDGAVKNVVGGEMDPMNLFAYGDSDGKGLEAKLQHPLGVAWDHSKLLFVADSYNHKIK
    MIDPEERYCATYAGTGEPGKGGDDEHILKAQFNEPGGLAISPCGCKIYVADTNNHTIRCIDIKTSTVTELKVVLPPVTSV
    DSKPSAPKKVKTMLPKHASPTTVEGLSVGLDGSVTLVLDVSLPPESYLTEGAPSAWQIFIPGSEPQSVMSITRLESLSNP
    LPSYTWTPPPDTQLPVTLQVESTLYYCLTSGVCKRQVLGYSVPVTRQEGAPQDVKVELSHQVLEDS

    >gi|115950834|ref|XP_001185464.1| PREDICTED: similar to nucleoredoxin, partial [Strongylocentrotus purpuratus]
    NEVSRRFKVSAIPTLIILDSVTGEVTCVDGVDEVKCDGEGKKFPWKSRPFPVSRRFKVSAIPTLIILDSVTGEVTCVDGV
    DEVKCDGEGKKFPWKSRPFPEIITGNFINQEMKTVTSESLKDKVLGIYFSAHW
    CPPCRVFTKELKSTYDKIKESGQSFEI
    IFASRDRAEDAFKNYFGEMPWLGFPFGDKRIGELAKLFSVQGIPKLAIVDAQGKVITADARGSVTKDPEGKEFPWYPKAC
    CELDAVSAAMVNVESCLILFTEIEEDEEGEECTRKAMEMMKPIAEETKAAEEAKGQELACKFIVAGDDETVEGLQQFLSI
    ADESLPMLVLLDIPRERVSCCEGKEITPDLIREYYTKFVKDELQWTTLSP

    >gi|115754836|ref|XP_787619.2| PREDICTED: similar to dimethylanaline monooxygenase [Strongylocentrotus purpuratus]
    MTVKKVAVIGAGISGLVSTKTCLEEGFEPVCFEQTEQCGGVWVTSDKRAPGTETRGAIYDCLITNSSKEMMCFSDYPFDP
    SVSPYIQGNQVLNYFQGYAKHFGLEPYIRLNTKVVRVEPTEDFQNTGQWHVKSQVQSGEVDEEVFDAVMVCSGLHNKSYI
    PSFPGMDEFKGDIVHS
    CDFKNGGKFAGKTVVVVGGSHSAGDVAVDTSRHAKMVRIWCGALKAKANIARFTETDVIFVDGT
    VVENVDAVIFATGYEFKFPFIDKSILQETYAELELYWHVFPPRLAHQTIALVGATNAVGAQGPMYELQARLAGRVFKGLV
    ELPCQEMMLEDVARRKNIFKKIYGHPKVHFPPIPYCDMIAAKLGCLPRFTDLLMSDPILAYKFFFGPNYPPFYRLVGPHA
    WPGARNAIMKAKHNTDTPTKTRKGLFLTTWKLAQGSHYVASAKVCKLIPSWIPRIEV

    >gi|115628023|ref|XP_798581.2| PREDICTED: similar to methionine sulfoxide reductase [Strongylocentrotus purpuratus]
    MATDGAGCGDPESFLRYRKIEPSTVPYSEPLVSTTKATFGMGCFWGVEASFGALPGVVRVKAGYTGGKLDNPNYRILILV
    RVVFDGELNTFDHETNLSRTLNWKIEPSTVPYSEPLVSTTKATFGMG
    CFWGVEASFGALPGVVRVKAGYTGGKLDNPNYR
    VLGDHTEAVEIEFNPTKTSYGALLKVFHQDHDPTELYKPQYMSAIFYHDDVQRHHAEASLQAEQKRRGEGSQLVTKILPA
    GQFYSAEDYHQKYFLRQQHALVESLHLKDADFLSSSRASRLLGYMSGPGTVEGFDAEVESLALSPSQADFMRVLIENKDG
    GTCH

    >gi|72179672|ref|XP_789243.1| PREDICTED: similar to ENSANGP00000027744 [Strongylocentrotus purpuratus]
    MTCGGCVGAVERVLKRLEGENDVEINLDAKKVYVTTALPSEYVLETLKKTGKATTFVGVC

    >gi|115941061|ref|XP_001186876.1| PREDICTED: similar to Wilsons disease protein [Strongylocentrotus purpuratus]
    MASVAIIKVPNMNCELCRRTIEIELTKLQGVKLVKSSLPTRIVRVFYDNELIGHDVIAHVIDELGYIVGKVESFANPVSP
    DVGSKDENAPVVSESGKSDDDDSAVANVQTDFEEKEIGPPKCETFNLIIKVEGKIIRGSQLPACVLEKVRECPGVMRATV
    NHEGALTVVHDPGRKSMKSFVMDVIAKLGYQSESSTDCSQPADDAHLPKSTSDCIQSYHNPRGGGNDDHPSTSPAHPKEK
    PTSVDRAEIQALIASEGDTPPSTSRENGIKNGDVVLEMKPRVAMVKDDGKVEVGRCVITVTGMT
    CASCVNTIEKSLIKQR
    GIEAVTVSLIAQKTEVKYQVAVVTPAEIALMIEDMGFDAEVKEEQMAGEETLNLIINGME
    CSSCVNNIESLTKALEGVKD
    ASVALTTCKGVFRYDPGSIGPRTIMDSIEDAGFDCEISTEENQINLANQHMKTIKKWRTSFFISLIFGVPAITTMLYFMI
    SKNHIIVIPGLSLENLILFICATMVQFLGGRYFYVQAYKALKHRTANMDVLIMMATSTAYVYSLIIVLVAIGRQEDGSPM
    TFFDTPPMLLVFVSLGRWLEHMAKAKTSDALSKLMSLQPAEAILVELGPEYQVLKERQISIELVQRGDKLKVVPGSKLPV
    DGEVIYGISSVDEALITGESMPVSKKPGSKVIGGSINQTGVLMMEATHVGKDTALAQIVKLVEDAQTSKAPIQQIADKIS
    GRFVPTILFLSIITLGIWLTIGFVDIEIVPIYSPPAENATEDVIHQERMETIFSFAFELAIAVMAIACPCALGLATPTAV
    MVGTGIGARNGILIKGGEPLEMAHKVKTVVFDKTGTVTYGKPRVMRTKLFSAGLDSMTEEEFLAICGTAESGSEHPLGTA
    VLKHAKEVLNLCVRGADGDTMGAEQVGRCSDFNAEPGYGLRCTVSHVGAMLDNFPTMQLLANESEKQEKCGEIKKAVDQK
    NEFTVLIGNREWMKKNDLTVTADMNEALGHNEAQGQTAVLVAVDDQIVGMIAIADTVKPEAKQSIKWIIINVSWQVGISQ
    VFAEVLPHNKVEKITELQAKGQRVAMVGDGVNDSPALVKADVGIAIGTGTDVAVEAGDIVLIKSDLMDVAGAIDLSKHTV
    RRIYINFFFACIYNSVGIPIAAGVLAPVNIFLRPWMASAAMAMSSVSVVSSSLMLKL

    >gi|72006659|ref|XP_785986.1| PREDICTED: similar to maleylacetoacetate isomerase [Strongylocentrotus purpuratus]
    MAASMPILHSYFRSTCSWRVRTTLALKGIDYEYKGVNLLKGEQLSDAYLTVNPMGQVPALEIDGLLMTQSLPIIEYLDET
    IPNCSLFPKDPIKRYMARQVAETINAGIQPVQNLSMCKFVGAERKMELGNTFITKGFVALEKTLASTSGKYCIGDEVTVA
    DVFLVPQVYNANRFKVDMSAFPVISKINDVLGELDAFKASHPSKQPDCPEDLRQ

    >gi|72010707|ref|XP_781649.1| PREDICTED: hypothetical protein isoform 3 [Strongylocentrotus purpuratus]
    MAARQLLQRGLLRQTSWTLGRKVCPGPVSMVTGLKPASVAPIVQRLPQFINSSAPFHSSSHCLDENSFIIQDRDDFQEKV
    LNSKSPVIVDFHAEW
    CNPCKALAPVLDAVLQNTKGQVKLAKVDIDELQDLAIGFGVDSVPTIMAFKGGQKVSKFIGNQSK
    EKVEAFVEKLLT

    >gi|115665161|ref|XP_790171.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAARQLLQRGLLRQTAWTLGRKVCQGPVPMVTGLKSASVVLVVQRFPQFINSSAPFHSSSHCLDENSFIIQDRDDFQEKV
    LNSKSPVIVDFHAEW
    CNPCKALAPVLDAVLQNTKGQVKLAKVDIDELQDLAIGFGVDSVPTIMAFKGGQKVSKFIGNQSQ
    EKVEAFVEKLLT

    >gi|115973354|ref|XP_001185437.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MEGKEATYIKGITHDKCVVVFSKTHCPFCHKVKTIFEDFGASYEVVEMDKRSDTSAMQAVLGKMTGASTVPRVFIQGKCV
    GGYDDTKRLQDSGRLEEMLRDCNAIE

    >gi|115898722|ref|XP_787822.2| PREDICTED: similar to KIAA0962 protein, partial [Strongylocentrotus purpuratus]
    HPDKSDDPNASDKFIKIQQSYEILSDEAKRREYDQFGIVDPQESQRRQRDPFADQFFQQNNNFGGGFNFHNSGNNDPRRV
    TLSRLQDGILPQSTDKPYLIFVTGSF
    CFNCMNIERMWSDITPEIESWGVGVGSVNIDSDRRLASVLGIRHRPAIAGIING
    QVTDYGQGSVTLKAMRDFVDRLLPSSLIQEVHNNNYEDFFANFYNENKPRVLLYSRNRDIPIIFKVGAFAFREHQTFGFT
    SAKYSNTDGVLKHVGVQHRTGKVLVFKENIKESVDMVEEKHMTLEALTHLLNYNKYLYLPRLSSQTLFEEMCPETPNLVG
    RKLCVIQITKATPEHEPFRASFRDMVMSTPSWPHEAKMTYMLFENQEQVAAAMEGLMVEVQHAVPVAIVWRQRGNQIRHA
    WLPDGWEGQDITLERRGIKEFLYRLNDGTSKFAHKGILPQFNDENAPAWPIRKFRELTQKMTDLYNAAYNFIFGSS

    >gi|72083893|ref|XP_788896.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MEGKEATYIKGITHDKCVVVFSKTHCPFCHKVKTIFEDFGASYEVVEMDKRSDTSAMQAVLGKMTGASTVPRVFIQGKCV
    GGYDDTKRLQDSGRLEEMLRDCNAIE

    >gi|115949672|ref|XP_001182669.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAKFFGKVSRGLTTCILVSVLILATEAAKKNVNRKFVADFTDLKEFKKELRTHNNIMVLFSKDAKSAESLMNIYSDVAAE
    MKGLATLAFIDCSEAKKLCKKYKVSPLPTVLKHYKDGDYHKDYDRLMRKKSLINFLRDPEGDVPWEEEPDADDVIHIEST
    KEFEKLISKEKRPVLTMFYAPW
    CGHCKRMKPEFAGAATDLKGDAVLAGMDVDRPENMASRQAYNITGFPTILYFEKGKRK
    FDFGG
    CGHCKKMKPEYVEAAAELKENGLEGVMGAVDATKARALAERFEVKGFPTLKYFKNGEHAWDLNERTADKFVEHLT
    E

    >gi|115929988|ref|XP_001194682.1| PREDICTED: similar to Dihydrolipoyl dehydrogenase, mitochondrial precursor (Dihydrolipoamide dehydrogenase) [Strongylocentrotus purpuratus]
    MSLLPVANRAGRCLSTVNHVHKLSRCSTSALWRGQRRHMASVEEQDLVVIGSGPGGYVAAIKAAQLGLKTTCVEKNDTLG
    GT
    CLNVGCIPSKALLNNSHLYHMAASKDFKSRGIDVGDIKLNLPKMMGQKSDAVKGLTNGVAHLFKQNSVTRIQGHGKVM
    GPNEVAVLHPDGKIKEVVKTKNILIATGSEVTPFPGIEVDEKTVVSSTGALSLERVPDHMVLIGGGVIGLELGSVWQRLG
    AKVTAVEFLGHIGGVGIDMEMAKNFQRILTKQGIKFKLNTKVTGATRTGDDISVSVESVKDPNKKEDLQCDTLLVCVGRR
    PYTNNLGLEELGISLDERGRIPVDNRFATSVPSVFAIGDCIQGPMLAHKAEDEGIIAVEGMAGGPVHIDYNCVPSVIYTH
    PEVAWVGKTEEQLKEEGIKYKVGKFPFAANSRAKTNGDTDGLVKMLSDAATDRILGAHIIGSGAGEMINEAALAMEYGAS
    CEDVARVCHAHPTVSEAFREANMAAYSGKAINF

    >gi|115758030|ref|XP_001198445.1| PREDICTED: similar to Thiosulfate sulfurtransferase [Strongylocentrotus purpuratus]
    MTSSEGKVPALVSTEWLAEALRTQKTPDGRPLRVLDATYRPGPASAGRDAHDKQHIPGSLHIDLDQLRDKDTTYYYTMPT
    PEFFAEFVGKTLGIDKDTHVVIYENELFYKIMSAPRIWWMFRYFDHGVVSVLDGGLQQWIAENRAVTDEATPSPKPATFK
    VTKTRAEIFKNYDDVLQNVKEPSFQLMDSRPVDWYDGSMPSAYPGLKLGIMKMALNIPFPNVLLEDSTKFKSADDLRALF
    QSNGIDLSRPLTST
    CFVGVTACILALGAFVVGKEDVAVFDGSWDEYSQRGPEDSMTIYEEKVKP

    >gi|115960992|ref|XP_001180175.1| PREDICTED: similar to MGC81459 protein [Strongylocentrotus purpuratus]
    MGDPSSSPWMSRKSTFLIALTLVALIGIVQSEDFYELLGIERDADAKDIRRAFKRLALTMHPDKNQDDPKAHDKFVRINR
    AYEVLKDDDLRKKYDRFGEEGLKEQNQRYNKYESWQFYKTEFGLYDEDPEIVTLSKSDFEQSVFGEDIWIVNFYSPR
    CHH
    CHDLAPAWREFAKEVEGVIRVGAVNCWDDRPLCTAQNVKRFPTLFVYPKHEEYTGTRSLEPLVKFALNLVDVTIHPLWIG
    NFKKVLLADEAKDHPWLISYCGSPVGTEDEDTHDMASVGCLDRDDQLKLAAILNKVVSVGSVDCSASSQLCTKLKIEEST
    IRFYNKAKEVTKGGKELELEQPKQMADEILKQLPDLSSFTSAELQLYFKIYTLSQEARQALEVGGEAPPVVTYFMKKAGD
    DDLELKKLPHLLTDMKVRKFNCSTDQALCDDLYLGTHLPKVALFRKGGGHEFHHGRLFAQDIAAFARHGLTSRLRVLGPK
    DFPDPVINSGELWFVDFFSPH
    CPPCKQLLPEVRKAASRVPYVNFGTVDCTTHQALCSQQNIRSYPTTVFFNDSKPHVSVG
    FSNSHAIQEFIEDTLNPKVITLSQDLFDSLVKNRAKGDLWLVDFYAPW
    CGPCQALMPEWRKFAKKLNGTAHVGSVDCVEH
    SSLCVQLGVNSYPTIRAYPMGRTGAGGFSAYQGWNRDVMALMGWVQNFLPTSVEIITQGNFRDLVLRSTDPWVVDFYAPW
    CGPCMAYMPSLEEVAKALKGYVRVGKINCQSYQSTCGQASIQSYPSLRIYKGTETKGYSQNWFGEQVYQKEPQYLIPYLK
    QKFTKNLESTGQIKDEL

    >gi|115934267|ref|XP_001184533.1| PREDICTED: similar to Thioredoxin domain-containing protein 5
    MPQITRLCGAYHSVVTLWYTMWFIPQCGPHVNLGHVVLNAVVYYVGDTTSSATCGNAVVYYVVDTTVWAICDFGTCGNAV
    VYYVVDTTVWATCDFGTYGNAVVYYVVGTTVWATCDFGTCGNAVVYYVVDTTVWATCDFGTCGNTVVYYVVYTTVWATCV
    FQELKNLERLFLGMNKLLDLPEDIFKDLSSLVYLDLSNNSLSSLTIDLFVHMDHLMTIDLSGNRLVAIGNVLNLPNIRLD
    LRWNSLLQLDNVTLEILTNNVEILFLEGNPWDCICGLEPLRQCKNLVMKCVSLAVLVIFGLNLVCGEEEEASFDLNYDTA
    SFVEEIGKGDHFVKFFAPW
    CGHCQRLAPIWSQLSEKYNKPEDSTVTIAKVDCTEETKLCSEHGVTGYPTLKLYKKDKEPL
    KYKGKRDFATLDAYIEKELNPQEADVPQVPAAKNGLYELTVATFKDHVAKGNHFIKFYAPW
    CGHCKRLAPTWDDLAKGFQ
    HSDIVTIAKVDCTAHRAVCDQYGVKGYPTLKFFTDGEAVESYKGGRDHVAMKEYVSKMTKGAEAAPLPGSEEAIKVVPVR
    EEPAGGEQPAVESKVVVLSTNNFLTQTAKGTSLVKFYAPW
    CPHCQKLVPVWDELAEKFDSRKDVTIGKVDCTVETEKPLC
    KKHAIEGYPTLLLFKDGEMVEKHSGTRTLAALETYLKSKLPKEEL

    >gi|115964413|ref|XP_001189917.1| PREDICTED: similar to Ubiquitin-activating enzyme E1C (UBA3 homolog, yeast) [Strongylocentrotus purpuratus]
    MDSVTTMALSGFRQIDVIDMDTIDLSNLNRQFLFRTKDVGKGKATVAADFINDRVAGCKVTPHFDRIESFDETFYRRKTL
    LILMRIPWVNKTIYSSATLSMVGYDDEGNMDPDTIKPMIDGGTEGFKGNARVIMPGMTPCIECTLDLYPPQVNFPM
    CTIA
    HTPRLPEHCIEYAKVLLWPQEDPFAGILLDGDDPSHVQWIFEKAQDRADQYNITGVTYRLTQGVVKRIIPAVASTNAVIA
    AQCVTEAFKIATSCCFPLKNYMVFNDTDGLYTYTYEAERKEDCLACSRKPQNLELPEDATLQMLVDHLTESNTLQMKAPS
    ITTTVDGRNKTLYMQSVESIRKRTKENLPKKLTDLGLLSGNELAVADATTPSCLIFILKLVPK

    >gi|115627194|ref|XP_001190834.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    DKPMMLVIHKTWCGACKALKPKFAASEEILKLSSDFVMVNVEDDEEPEGSQFQPDGGYIPRILFLNSDGVVQPDLINTLG
    NPQYKYFYSNALMVTEAMKSAVKALGGSRNDEL

    >gi|115689689|ref|XP_792662.2| PREDICTED: similar to omega class glutathione S-transferase [Strongylocentrotus purpuratus]
    MTSKAKPNPKHLVQGDPIPPLKKGVPRLFSFRFCPFAHRSRLVLAAKNVDYELVNISLSKKPEWYKTKNPFGTTPCFEHD
    EKIVRDSSIVCDYVNDAYPGVDLWPEDPYRKAQDKMLLDYFGSKISPPFFKATYHPPPSTTEDFLAIYQKELHVLEEELK
    KRGSAFFFGEKPGLVDFIMWPWFERWAVLGADFHRENYPTLMGYCGRMKEDPAIIEAATPDEIYQDNFKKQMEGNPQDDY


    >gi|115973760|ref|XP_001181159.1| PREDICTED: similar to conserved hypothetical protein, partial [Strongylocentrotus purpuratus]
    TQALKCAPTTGSKTQLMSTGAEAQESTQPELKLSDSCVKQLHKLGEDKEFLRILVEGGGCSGFQYKFEMDSEMTEDDRVF
    ERDGAKVVVDDVSLEYIKGSTIDYHEELIRSAFSVIDNPGAEMGCSCGASFSFKL

    >gi|115609795|ref|XP_780030.2| PREDICTED: similar to Methyltransferase like 2 isoform 1 [Strongylocentrotus purpuratus]
    MILGCHFLKHGLALGSKIIRHRKGFSTSVHAYQVRGDENLHVKELLEERNHQYPSSDSGKIMSAGEELPVTKDDAASVKR
    PQFGNRFLENPDNVFQHNAWDNVAWDPEQLEAAKKKVGENSSQQVETEKKELYEADADRYWNEFYSLHQHKFFKDRHWLF
    TEFPELSSDNAQASAKECSSERGASQETSEPRTMDTSDDFPGKSAHKRILEVGCGVGNTIFPILQTNADPGLFVYGCDFS
    SVAVDIVRQHAEYNPSRCHAFVCDVSDPAASFPVPDNSLDLVVLIFVMSAINPDRFLSTIQTLTRLLKPGGRILFRDYGR
    YDLAQLRFKKGR
    CLSENFYVRGDGTRVYFFTQDELRELFISAGLVEEQNTIDKRLQVNRGRQLTMYRVWIQCKYRKP

    >gi|115964862|ref|XP_001187106.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MDTDAGEASGSGYVGRDTEKDCDDGFVDEDELFDELENEDIPANIREARIGQMKREAAAARAMEDKGLGLYTEIEKEEDL
    LKMTTTIPKVIVHFYKTDFRR
    CCIMDKHLKILAEQYRDVKFSKVCVDIVPFFVTRLQIQVLPAVLLFIDGVVADRVVGFD
    ELGNTDNFTTDTLENRIAKSEIIKPLNAAGSANKTIFGFDRRRDDSSDEDY

    >gi|115609797|ref|XP_001176656.1| PREDICTED: similar to Methyltransferase like 2 [Strongylocentrotus purpuratus]
    MILGCHFLKHGLALGSKIIRHRKGFSTSVHAYQVRGDENLHVKELLEERNHQYPSSDSGKIMSAGEELPVTKDDAASVKR
    PQFGNRFLENPDNVFQHNAWDNVAWDPEQLEAAKKKVGENSSQQVETEKKELYEADADRYWNEFYSLHQHKFFKDRHWLF
    TEFPELSSDNAQASAKEILEVGCGVGNTIFPILQTNADPGLFVYGCDFSSVAVDIVRQHAEYNPSRCHAFVCDVSDPAAS
    FPVPDNSLDLVVLIFVMSAINPDRFLSTIQTLTRLLKPGGRILFRDYGRYDLAQLRFKKGR
    CLSENFYVRGDGTRVYFFT
    QDELRELFISAGLVEEQNTIDKRLQVNRGRQLTMYRVWIQCKYRKP

    >gi|115615258|ref|XP_796774.2| PREDICTED: similar to Wilsons disease protein [Strongylocentrotus purpuratus]
    MASVAIIKVPNMNCELCRRTIEIELTKLQGVKLVKSSLPTRIVRVFYDNELIGHDVIAHVIDELGYIVGKVESFANPVSP
    DVGSKDENAPVVSESGKSDDDDSAVANVQTDFEEKEIGPPKCETFNLIIKVEGKIIRGSQLPACVLEKVRECPGVMRATV
    NHEGALTVVHDPGRKSMKSFVMDVIAKLGYQSESSTDCSQPADDAHLPKSTSDCIQSYHNPRGGGNDDHPSTSPAHPKEK
    PTSVDRAEIQALIASEGDTPPSTSRENGIKNGDVVLEMKPRVAMVKDDGKVEVGRCVITVTGMT
    CASCVNTIEKSLIKQR
    GIEAVTVSLIAQKTEVKYQVAVVTPAEIALMIEDMGFDAEVKEEQMAGEETLNLIINGME
    CSSCVNNIESLTKALEGVKD
    ASVALTTCKGVFRYDPGSIGPRTIMDSIEDAGFDCEISTEENQINLANQHMKTIKKWRTSFFISLIFGVPAITTMLYFMI
    SKNHIIVIPGLSLENLILFICATMVQFLGGRYFYVQAYKALKHRTANMDVLIMMATSTAYVYSLIIVLVAIGRQEDGSPM
    TFFDTPPMLLVFVSLGRWLEHMAKAKTSDALSKLMSLQPAEAILVELGPEYQVLKERQISIELVQRGDKLKVVPGSKLPV
    DGEVIYGISSVDEALITGESMPVSKKPGSKVIGGSINQTGVLMMEATHVGKDTALAQIVKLVEDAQTSKAPIQQIADKIS
    GRFVPTILFLSIITLGIWLTIGFVDIEIVPIYSPPAENATEDVIHQERMETIFSFAFELAIAVMAIACPCALGLATPTAV
    MVGTGIGARNGILIKGGEPLEMAHKVKTVVFDKTGTVTYGKPRVMRTKLFSAGLDSMTEEEFLAICGTAESGSEHPLGTA
    VLKHAKEVLNLCVRGADGDTMGAEQVGRCSDFNAEPGYGLRCTVSHVGAMLDNFPTMQLLANESEKQEKCGEIKKAVDQK
    NEFTVLIGNREWMKKNDLTVTADMNEALGHNEAQGQTAVLVAVDDQIVGMIAIADTVKPEAKQSIKWIIINVSWQVGISQ
    VFAEVLPHNKVEKITELQAKGQRVAMVGDGVNDSPALVKADVGIAIGTGTDVAVEAGDIVLIKSDLMDVAGAIDLSKHTV
    RRIYINFFFACIYNSVGIPIAAGVLAPVNIFLRPWMASAAMAMSSVSVVSSSLMLKL

    >gi|115930012|ref|XP_001195539.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MYPKREVFILLFLICVFRYGESGKTNVVKITDKDWSRTLEGEWLIKFYAPWCPACKSIMPVWKELSDWSQELNTNIAEVD
    VTEEPGLSGRFAVTSLPSIFHAKDGIFRRYLGPRTKDDLISLVEERKYEEIEPVAGWQSPNSIA

    >gi|115920214|ref|XP_784437.2| PREDICTED: similar to Thiosulfate sulfurtransferase [Strongylocentrotus purpuratus]
    MAASAPLVSTKWLSDALGEQTSPSSSLSSSTSCTLRVIDATWLGIMTEGRDAYQTEHVPGSVHFDLNQCRDKTSRLEFTL
    PSAENFAKYVGELGIDNETHVIVYENDPIFRMMSAPRTWWMFRLFGHDKVSVLDGGLKQWKEDGYAVESGDESVVDQRVF
    SAKPANPSLLKNFDEVLENQKTDNFTLIDCRQPEWFDGSMDSIWPNLPLGYILKSINVPFSSMVRSDSDRMVAREDILKL
    FQSAGIDLTQPLVSS
    CFVGISACTIALAAYVVGKEDVAIYDGSWDEFCKSAPKDSHVIIPAPKL

    >gi|115717717|ref|XP_001200144.1| PREDICTED: similar to rhodanese [Strongylocentrotus purpuratus]
    MVDQVPPLVTTSWLSQHLDSKMEPLVILDATWNPRGKSGNEEHQEQHIPGSLYFNLDECKDKESHFKVTLPRLNEFEDYV
    SKLGISNGTRVVVYENDPRYKAKTSARVWWMFRYFGHSKVSVLDGGLEQWVKDGFPVTSDKTEDPVKAMFKAEVQVQLRK
    TCDEVLEDMKEGSVQLVDTRPSHWFDGTKPSLWPDLRLGTIHGAKHVNFEECMDKHSTRLRPADELQDLFTSTGIDLSKP
    VTTT
    CNVGVTACIVAMAAFLLGKEDVAVFDGSWDEFSQKAPDNLVHINIYNKT

    >gi|115725117|ref|XP_797733.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MLVISCSSYDYDLAVIGGGSGGLACAKEAAGFDKKVIVLDYVDPSPQGTKWGLGGTCVNVGCIPKKLLHHASLLRESMHD
    AKHYGWQVPDDIGLSWSTLIGGIQGHVKSLNWGHRVQLQDKNVEYVNGKGSFIDEHTVKVKMKDGKETQFSAANIVLATG
    GRPKYPDKVPGAMEYGITSDDIFSLKTPPGRSLVIGGSYVALECAGFLHGLGFPTTVMVRSICLRGFDQQMSRLVADHME
    ASGIQFLWQQVPESVAKNQNGSLNVRWRSDQGQEGHGEFDTVMFAVGREPETAQLGLDNTGVQLSEGGKVMGSNEQSSVP
    HIHAIGDILESGIELTPVAIRTGKLLAQRLFGQGTEHMNYEQVATTVFTPLEYSCVGLSEETATERYGEDHIEVYHAFYK
    PLEYVVPNKPAEQCYIKAICLRDGDQRILGLHITGPGAGEIMQGFALAVKMGATYQHLSSTIGIHPTCAEEVVKIHITKR
    SGLDPMVTGC

    >gi|115752418|ref|XP_794749.2| PREDICTED: similar to NHL repeat containing 2, partial [Strongylocentrotus purpuratus]
    LEWFNTSGPLSFKSNLQGKLVVLDFFTYCCINCMHILPDLEALEEKYSVEDGVVVVGVHSAKFENEKVSANIKNAILRYN
    IHHPVVNDHDAVMWNDLNIQCWPTLLIVGPSGEPILSIIGEGHRDILFEVVQLSLDHFKSKLSPQSLPVVALKDSLVDSP
    LLYPGK

    >gi|115976322|ref|XP_001181827.1| PREDICTED: similar to intermediate chain 1 [Strongylocentrotus purpuratus]
    MPAKKETISLQKEILNQEMWDELLSLEGLTVIDVYQKWCGPCAAVLSLFKRLRNEVGDDLLRFAVAEADSIESLERYRGK
    CEPSFLMYGSGQLVNVVRGANAPKLLKDVERELKQEHKVLEEGVERVVIKDPLLAAFEAEEHQAAQAEEVEKKKQEEDAR
    IKEIKELGDEGEVSVRPVSQGTVDTLMHDRQDGSKTEPLPKEVTVVLIKPDAVASGHVDDIIAKIEEHGFEILATEDKTL
    TEEEAREFYKQHQEEDHFEELVTFMASGPSKILVLTRGNTGEGVVSDIRNLLGPKDIEVAKEQAPESLRAQFGTDKKMNA
    MHGADSSETAARELAFLLPNFSIPLVPGTGPPPIVEKTLALIRPSALKDHKDEMLQKIQEAGFEVCLQKMVQLTEEQAKD
    FYKEQEGTAHFEDLIREMTSGEVLALGLAKESAIQSWRDFIGPTIIDEAKEKAPESLRAQYSVPDTQVNVVHGSDSVDNA
    EKELGFFFPKQSTLAVIKPDAAGEHKEAIIEKIKEAGFNISLQRDVELNKELASKLYMEHEGKEFYENLIEHMSSGLSMV
    MVLSREDAVDGWRTLMGPTDPDYAREHAPESLRALLGKDVMQNAVHGSSNPEEAKTRIERLFPDVEVLPGGEVKDSLTSI
    SMEQSHVKGEEGEEGGEQQTEQPAGEGEEQQAEQPAGESGEQQAEGGEAATEGAEQQAEQPPAEGEEAAQQREEGGETEQ
    QAEVREGDGSETQQVEDGPKEDGPTEDGQTQEDGQTQEAQAEQQVEDGKTGEEAAEEEKAVDEEAPPTDAQEGQADGDQP
    QGGGEEKEQKEGGDEGEKPAEEGETQQTQEGEAPAAEQTEQTQEGEEEKPAEEAAPASEEAAAEQAPAAEETQEGEEKKE
    EQTQDAPAAEGGEAGAMEGEVPVTEGGEALAAAEGEGDAKPEETAS

    >gi|115931235|ref|XP_001175685.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MSLFTQIIRPSTRLFRSFQATGLPHCQLRLLSTELKERIDGLVQGKKVVVFMKGVPEEPQCGFSNAVVQIMRMHGVDNYE
    SHNVLEDKDLREGIKEYSEWPTIPQIYMEGEFVGGCDIVIQMHQTGDLIDELKKIGIRSALLDAPKEEEPSK

    >gi|115949723|ref|XP_001184273.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAATWTQVWTPVHEPGGSTEEEENLRGWVSNTDEAEDVKEQLQVAECITFVGDRKGKGFGNGILHLQNPDGKLIHMPRVR
    FSDIKDNVVSADSVPFAIVSRYSLRCMYGKDKNQAAKRKNEELAEKAMKTNDDSGMSKRAISDHIRADLRNGDKFNFERR
    IYIRLPSKTDHQSVHTLGKLTGFMNPMHKTVSTKLVDLVGHGVTNLNEMKRHLRAHLHTVLFPDVEKRPSITDTAFYPSD
    NTIRQRMYAARMQLRIMAEAGEKETHDQFEKRFSTLVIHGFVSLSTSLGIQSGLFDALIKLKDEERTVKEIADTAGLKER
    YVQEWLGVMVAADIVDINPETEKYSLPPHRIPFFQPGSSVSDLGVLLTELPTFGGLYKKLLDCLKKDGPQGLSYSEYTDF
    HAMMSNLSGRWVLHHLVQDFIPSMPQIEEQMKSGIRILDLGCGRGLASLVFAENYPNSTVVGLDFSEEAINYGKERAKEK
    GLTNVEFVCEDAACIPDDWNNTIDYIYTFDVIHDLAHADNVLLALNRILKPDGVFSMIDIDCKTKHSENSSNDYCSMLYS
    MSLFH
    CLPISLFFEGSVGLGTCWGREKATEFLKDAGFRVDSITKPLGSSQAHYMCSKKVK

    >gi|115652356|ref|XP_001183978.1| PREDICTED: similar to glutathione peroxidase, partial [Strongylocentrotus purpuratus]
    WGILFSHPADYTPVCTTELGRVATLTPEFEKRGVKLIALSCDGVESHRGWIK

    >gi|115949725|ref|XP_001184379.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAEAGEKETHEQFEKRFSTLVIHGFVSLSTSLGIQSGLFDALIKLKDEERTVKEIADTAGLKERYVKEWLGVMVSADIVD
    INPETEKYSLPPHRIPFFLSGSSVSNLAVTLTELPMYGAVYNKLLDCLKKDGPLGLPYSEYTDFHTVMSNHSSIWVLQHL
    VQDFIPSMPQIEERMKSGIRILDLGCGRGLASLVFAENYPNSTVVGLDFSEEAINYGKERAKEKGLTNVEFVCEDAACIP
    DDWNNTIDYIYTFDVIHDLAHADNVLLALNRILKPDGVFSMIDIDCKTKHSENSSNDYCSMLYSMSLFH
    CLPISLFFEGS
    VGLGTCWGREKATEFLKDAGFRVDSITKPLGSSQAHYMCSKKVK

    >gi|115748362|ref|XP_001199612.1| PREDICTED: similar to Thiosulfate sulfurtransferase [Strongylocentrotus purpuratus]
    MAASAPLVSTKWLSDALGEQTSPSSSLSSSTSCTLRVIDATWLGIMTEGRDAYQTEHVPGSVHFDLNQCRDKTSRLEFTL
    PSAENFAKYVGELGIDNETHVIVYENDPIFRMMSAPRTWWMFRLFGHDKVSVLDGGLKQWKEDGYAVESGDESVVDQRVF
    SAKPANPSLLKNFDEVLENQKTDNFTLIDCRQPEWFDGSMDSIWPNLPLGYILKSINVPFSSMVRSDSDRMVAREDILKL
    FQSAGIDLTQPLVSS
    CFVGISACTIALAAYVVGKEDVAIYDGSWDEFCKSAPKDSHVIIPAPKL

    >gi|115649205|ref|XP_001179929.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
    QDFDSILSTSGDKLVVIYFSATWCGPCRSISPEFETLSKDPEIASNVVFCKADVDEAS

    >gi|115929249|ref|XP_001187617.1| PREDICTED: similar to methionine sulfoxide reductase [Strongylocentrotus purpuratus]
    MATDGAGCGDPESFLRYRKIEPSTVPYSEPLVSTTKATFGMGCFWGVEASFGALPGVVRVKAGYTGGKLDNPNYRILILV
    RVVFDGELNTFDHETNLSRTLNWKIEPSTVPYSEPLVSTTKATFGMG
    CFWGVEASFGALPGVVRVKAGYTGGKLDNPNYR
    VLGDHTEAVEIEFNPTKTSYGALLKVFHQDHDPTELYKPQYMSAIFYHDDVQRHHAEASLQAEQKRRGEGSQLVTKILPA
    GQFYSAEDYHQKYFLRQQHALVESLHLKDADFLSSSRASRLLGYMSGPGTVEGFDAEVESLALSPSQADFMRVLIENKDG
    GTCH

    >gi|115959455|ref|XP_001182862.1| PREDICTED: similar to Thiosulfate sulfurtransferase [Strongylocentrotus purpuratus]
    MNHTTVSSYAQYPGLVSTEWLAEAMGTRKTPDGRPFRVLDATRIGMETGKAHIPGSHHIDIHYLTDEHSPYGFTAPTPEN
    FADYVGKTLGIDNDTHVVLYEGKVKVMTAPRMWWMFRLFNHDAVSVLDGGFQQWVGENRTVTEIPTPVPEPVEFKVTERR
    EDLFKSYEDVLQNVKDPKIQIMDARLVEWYDGSQPSVYEGINLGIMKMATNIPFTNLLVDDGSDKFRSPAELRALFKSNG
    IDLSRPLTAS
    CFVGITASILALGAFHAGKEDVAVYDGSWEEYSQKGPEDSMNLYTYEKEP

    >gi|115959457|ref|XP_001182903.1| PREDICTED: similar to Chain , Thiosulfate:cyanide Sulfurtran
    MLERAGHTTVSSHAQYPGLVSTEWLAEAMGTRKTPDGRPFRVLDATRIGMETGKAHIPGSHHIDIHQLSNKDSSYHFTAP
    TPANFAEYVGKTLGIDNDTHVVLYEGKVKVMTAPRMWWMFRLFNHDAVSVLDGGLQQWVAENRTVTEIPTPVPEAVEFKV
    TERREDLFKSYEDVLQNVKDPKFQIMDSRLVEWYDGSQPSVYEGINLGIMKMATNIPFPNVLVDDGSDKFRSPADLRALF
    KSNGIDLSRPLTSS
    CYVGITASILALGAFHAGKEDVGRVWRMQINALPKDISVAAGFKPSTM

    >gi|115768184|ref|XP_001179256.1| PREDICTED: similar to GA20735-PA [Strongylocentrotus purpuratus]
    MTHFDDWSLQSMLGLASLVQGLIKGHRIMLFSKSYCPFCLMAKSVLQDVGANPVKVLEIEERSDEQEIQDVLLDLTGVRT
    VPSVFIDQDYLGGGSDLQRMMEEGHLQKLLREKGLLNAGNESSADR

    >gi|72061380|ref|XP_789080.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MFNSPLGIIFLVGLWYGGEGNAIEEPAQKLLHRGESGDQGSCPNHFAEFFYQISQRNRGTIYLADTTDIEQQAWLSTSFQ
    LFELSELLKGLNGTAGNKSQPDQKPSPKFKCGENGGIENGSGEVIMVNSSELVRLVSQRPNASAIANSSAEASTNTSDNS
    SQSSENVCVVVMFFATS
    CRFSAATAPHYNAFGRAMSAVDVLAFDINQSNGVNSRYGIVAVPSIVLFHNGKLAARFNESQR
    SLESMMDFVHNLTGLPVNKSVTVLEGDHEGPVPTTAVIGPDYFLWFSNTFLFLCALRLLQQKVGAAVRAKITAIQEYVVQ
    VWRTGEFYEQVGIADNDEVPMNNDAAEIR

    >gi|72175451|ref|XP_798637.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAEAGEKETHEQFEKRFSTLVIHGFVSLSTSLGIQSGLFDALIKLKDEERTVKEIADTAGLKERYVKEWLGVMVSADIVD
    INPETEKYSLPPHRIPFFLSGSSVSNLAVTLTELPMYGAVYNKLLDCLKKDGPLGLPYSEYTDFHTVMSNHSSIWVLQHL
    VQDFIPSMPQIEERMKSGIRILDLGCGRGLASLVFAENYPNSTVVGLDFSEEAINYGKERAKEKGLTNVEFVCEDAACIP
    DDWNNTIDYIYTFDVIHDLAHADNVLLALNRILKPDGVFSMIDIDCKTKHSENSSNDYCSMLYSMSLFH
    CLPISLFFEGS
    VGLGTCWGREKATEFLKDAGFRVDSITKPLGSSQAHYMCSKKVK

    >gi|115760358|ref|XP_001198852.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MAATWTQVWTPVHEPGGSTEEEENLRGWVSNTDEAEDVKEQLQVAECITFVGDRKGKGFGNGILHLQNPDGKLIHMPRVR
    FSDIKDNVVSADSVPFAIVSRYSLRCMYGKDKNQAAKRKNEELAEKAMKTNDDSGMSKRAISDHIRADLRNGDKFNFERR
    IYIRLPSKTDHQSVHTLGKLTGFMNPMHKTVSTKLVDLVGHGVTNLNEMKRHLRAHLHTVLFPDVEKRPSITDTAFYPSD
    NTIRQRMYAARMQLRIMAEAGEKETHDQFEKRFSTLVIHGFVSLSTSLGIQSGLFDALIKLKDEERTVKEIADTAGLKER
    YVQEWLGVMVAADIVDINPETEKYSLPPHRIPFFQPGSSVSDLGVLLTELPTFGGLYKKLLDCLKKDGPQGLSYSEYTDF
    HAMMSNLSGRWVLHHLVQDFIPSMPQIEEQMKSGIRILDLGCGRGLASLVFAENYPNSTVVGLDFSEEAINYGKERAKEK
    GLTNVEFVCEDAACIPDDWNNTIDYIYTFDVIHDLAHADNVLLALNRILKPDGVFSMIDIDCKTKHSENSSNDYCSMLYS
    MSLFH
    CLPISLFFEGSVGLGTCWGREKATEFLKDAGFRVDSITKPLGSSQAHYMCSKKVK

    >gi|115717737|ref|XP_796159.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MTTVHQVLLPGEADGGDSPRLSITDDTYHLLANTSRRHTLVGANNESAMPRTENIEERCVVTNEINTQKSEESSPREQTA
    ETSSQQAQSSPDGIIGTDRNANMHRTTTAGTKTRIPSETGSESFHNSGHNGIRLDIKSNCDEKPILAEADYKDSKTRKNS
    PLIGSNIARTVGKLAACFLCGIIFGIAAEKGRVFETATIRGQFIYQRWIMMKMFLSAAATSCFCLALLSVIPLTKNVFES
    SRTAYVAGLTHKGIISVTIGGAILGAAMVLSGSCPGMVLVQIGAWLSNGGGAMTFFGCMVGVYLYALVEPWTRKMMSPTK
    PYDKYLADSYTEKWKVPFFAIALAAGVLMGLAVVTIEILVPWTTDLVNPNVEGSWFFETLAWPPYVSGVMIGCLQIPLVL
    IVSDTIGGSSSFCTLGAQALVTERMESWSPYLAKFKRGAENWWQVFYVIGAIAGACISAAASGSLGSTPGVSLMSSFLGG
    VLLIFGSRLAGG
    CTSGHGLSGMGVLSVLSFVTVAAMFAGGTAFGFIFWAVSNASKWDYYTF

    >gi|72088764|ref|XP_795970.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
    MESSCNLSNNLVTNVQTGETITLSSIWEEGACVIQFLRRFGCPICRMGARDITHLKPRLDAANVRLVAIGQEETGAKEFI
    ESGFWTGDLFIDQQKKTYGDLKYKRYNFLTIMANLMCKMTREAVSKATSEGITGNMTGDALQMGGTLVIDKGGKVLLDFK
    QETPADSVPLDRVLHVLGIGRQSRTLSVESR

    >gi|115623529|ref|XP_780782.2| PREDICTED: similar to ubiquitin-activating enzyme E1-like 2 [Strongylocentrotus purpuratus]
    MATSDVTFDGEPGIWNGAPTVDLENHTHVQICANHTSWNATTTDTYWNTDMADTICQYFGFTGSMIIEVMDFAAPGFAMC
    KKEQNNTDSRLQLSCKFLEVCVGVPIISCLLPGYEGCYTQTATDPFFTNGSLADLGDQQVNIQTCAEACSDSPYLGLTNG
    SNCICGSGLGNRSLVGDCDLGCQGDDLQQCGGEEATSVYSASVIGQCESERVEIIPDQPHYITSPNFPDIYEANVSCSWI
    LDINVPLFHDLEIITTFDFEDDNIQHLDISSESNLVELTPAGTSGTTVLSRTPYSTLQDTITVSLTPSSGGNSTIFVMKF
    TLMSNTMYTPANDYTTAPPPESTTSKAGQNVNLGKLAMSAGLGVILAAILLLTKKETSPKHGLAPDNVPASKHTKMADNA
    DIDDSLYSRQRYVLGDHAMKQMATSNVFLSGLGGIGVEIAKNIVLAGIKSLTINDGKSCSVKDLGTQFFLREQDAKANKT
    RAQATYSRLAELNPYVSIKLSQQTLADNSDLTFLKQFQCVVLTETPLGLQLKINEFCRAQTPQIKFIAADVYGLYSYCFC
    DFGDEFTVQDVNGEEPMQVFIADVTKDNPGVVTCLDQQYHGLETGDYVTFKEVKGMTALNDARHKVKRISPYKFSIEDTS
    GDGFQPYETGGIAIEVKVPSIVKFLPLRDQLTNPSAILVDFTKDLMVSHLAMYALQQFREENGKLPSVRNDDDKDAFVKI
    AMRLNDTLADPIPSPSTKQLASLAYSAEGCFAPLCAALGGFVAQEVLKALTGKFTPLKQWVHLDSSEVLKGLENESADNF
    MPKGDRYDALRICIGDNLVQKIASQNLFMVGCGAIGCEMMKNFAMLGVGVQGGKITVTDNDIIEKSNLNRQFLFRPHHIQ
    KPKSETAAQSTRDINPDMKIEAHQNKICPQTETTIYTDAFFEGLDVVVNALDNVEARRYVDSRCVTNQKPLMESGTLGAK
    GHVQVIVPHLTESYGSKQDPPEQSIPY
    CTLKSFPAQIEHTIQWARDKFESLFAQKPSMYTKYWEVSGAPEDVVKKLESGE
    SLENTLPVTKYLNNRGTSWQDCVRIARIKFEKYFNHKANQLLHAFPLDAKTSDGGMFWQSPKRRIVTDESEGKEGEEDES
    TDMSSASKEITAAIRSGKAVPGLLRLTPAEFEKDDDSNGHIDFITAASNLRANMYSIENADRFKTKLIAGKIVPAIATTT
    AAVAGLSTIEMVKYIKGTAKMEDYHNCFLNLALPMVMFSEPARTVTTKLKQGLTYTEWDRWTVQGSKDFKLQDFNQYFKD
    TYQLDVSMVAIGAKLIYLPVLPGHPKRLKQK

    >gi|115932090|ref|XP_001189450.1| PREDICTED: similar to mercaptopyruvate sulfurtransferase [Strongylocentrotus purpuratus]
    MQRVSALVSCEWLSRILSPQTQYLRVLDGTWYMPSSGMDPKAEFAKKHIPGAEQFSIDDCTLPHSPFSNTLPTPEFFAEY
    VGERGICNNTHVVVYDNHPQLGVFSAARVWWLFRVFGHNAVSVLDGGLPLWEKAGHPLCSSTAPSEVEKQEFKAELQPNL
    VKRFSDMTGNLNTNKFQVMDARSKARFLGKVPEPREGLTCGHMPGSANVPFSTLLNDDDSERARLMKSPEELVKIFADSG
    IDLSGPVTAT
    CGSGVTACILALAAHQTGKKDVGVYDGSWEEYAQKATEDQMVVCNPETASAG

    >gi|115932092|ref|XP_001204467.1| PREDICTED: similar to Thiosulfate sulfurtransferase [Strongylocentrotus purpuratus]
    MTSSEGKVPALVSTEWLAEALRTQKTPDGRPLRVLDATYRPGPASAGRDAHDKQHIPGSLHIDLDQLRDKDTTYYYTMPT
    PEFFAEFVGKTLGIDKDTHVVIYENELFYKIMSAPRIWWMFRYFDHGVVSVLDGGLQQWIAENRAVTDEATPSPKPATFK
    VTKTRAEIFKNYDDVLQNVKEPSFQLMDSRPVDWYDGSMPSAYPGLKLGIMKMALNIPFPNVLLEDSTKFKSADDLRALF
    QSNGIDLSRPLTST
    CFVGVTACILALGAFVVGKEDVAVFDGSWDEYSQRGPEDSMTIYEEKVKP

    >gi|115709808|ref|XP_799253.2| PREDICTED: similar to phosducin-like protein [Strongylocentrotus purpuratus]
    MTTLDDKLLGEKTQYYYSDSEDEREEDDDDKSSGDEQNKDCAASPEAEFIPEADLSASGYGASRTGPKGVLADWRRFKQL
    ETEKRGDQDREKRLLAEKLSMTCRSYLDDEKAKEDEELDQLQLESMLEDEFMRRYREERMNQMILNIQKNSPRFGKLLRL
    NKNNFVDAIDSERKEVTVIIHIEDQSLQA
    CESMNGCLHCLAQEYPFVKFCAANAADIQTSQLFTEKGLPALLVYKAGQLI
    GNFIRVSDVFGEDFFATEVESFLQEHGLLPNKDDAKVIPGHVEEDEDSDLELD

    >gi|115969940|ref|XP_001180061.1| PREDICTED: similar to phosducin-like protein [Strongylocentrotus purpuratus]
    MTTLDDKLLGEKTQYYYSDSEDEREEDDDDKSSGDEQNKDCAASPEAEFIPEADLSASGYGASRTGPKGVLADWRRFKQL
    ETEKRGDQDREKRLLAEKLSMTCRSYLDDEKAKEDEELDQLQLESMLEDEFMRRYREERMNQMILNIQKNSPRFGKLLRL
    NKNNFVDAIDSERKEVTVIIHIEDQSLQA
    CESMNGCLHCLAQEYPFVKFCAANAADIQTSQLFTEKGLPALLVYKAGQLI
    GNFIRVSDVFGEDFFATEVESFLQEHGLLPNKDDAKVIPGHVEEDEDSDLELD

    >gi|115720373|ref|XP_001182370.1| PREDICTED: similar to interferon, gamma-inducible protein 30, partial [Strongylocentrotus purpuratus]
    MSGRICITSIAVLLVIPSVVLGCGFHPNLWCSSPEISERCGVQKQCLLWQSEQKVADAPLVRYELYYESLCPGCKQLILT
    QLFPAWQKVKSIVNVTLVPYGNAQ