Schizosaccharomyces pombe

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|19075206|ref|NP_587706.1| thioredoxin peroxidase [Schizosaccharomyces pombe 972h-]
    MVAVGSTLPKVTLWENKPEEVVEFPSQGKFIIVGVPGAFTPPCSSQVPGYIANEKQFAAKGISGIYVVAVNDVFVTKAWK
    KSFDGGEQSGVHFVADWNGEFTKAFDAGFDASGLLGPLRSKRYAAVVENGKVVKVFIENEVTDVDISSADKVLSSL

    >gi|162312108|ref|XP_001713164.1| thiosulfate sulfurtransferase (predicted) [Schizosaccharomyces pombe 972h-]
    MFSVGKKISFILPIKGVLQKLKDNAQKTVLLDATWYLPTDTKNGKKEYLESRLPGAQYFDIDEAKDHKNPLPHMLPPADE
    FASYVGKLGIDRNTNVIIYDRKGFFSSPRVFWTFKVFGHEHVFLFPNAFNAWKTEGLELETGEPRTPKPVVYEGAKLNKD
    LVASFDDIVKVIESPDAAGVHIVDARAHERFLGNVPESRPGLASGHIPTSINIPFTETTAAGITAPKPEEDLEKVFSSHG
    LTDKSVPIITS
    CGSGVTASVLFAALKECGFKDVRVYDESWSGYGKRANEDSSLLATGP

    >gi|19075612|ref|NP_588112.1| iron-sulfur protein Isa1 [Schizosaccharomyces pombe 972h-]
    MLSCLSKPALRCRSVNRLQFLRKLSLQEIQTLKTQHQYLGRTRLDVETPSLKPSAAGSGSTAPKPVTEREIASTRFMPRK
    NVIKLTPLAVEHLKKMQSSASMKGKMLRIGVKQKG
    CAGQAYSLEYIEKPDKFDEIVKQDGISIIVARRALLQIIGSVMDY
    RDDDLQSRFIFSNPNVKSTCGCGESFSTLK

    >gi|19075805|ref|NP_588305.1| monothiol glutaredoxin Grx3 [Schizosaccharomyces pombe 972h-]
    MANRKIFLITSLIISLLLIHIFIFSPLNEPEKNAKAGPLGLSDVSVPSAPKLPAKDSTDFEVFLENPVIIFSRPGCPYSA
    AAKKLLTETLRLDPPAVVVEVTDYEHTQELRDWLSSISDISTMPNIFVGGHSIGGSDSVRALYQEEKLQSTLDEWTHNKV
    LILPTD

    >gi|295442781|ref|NP_588313.2| ER oxidoreductin Ero1b [Schizosaccharomyces pombe 972h-]
    MKIAKGLVGLLILYKNVCQVLCKSGSSVKSGSPWSIKNDGKSIIHDTLNSSYSDIENLNSRVSPLLFDLTEKSDYMRFYR
    LNLFNKECRYNLDDNVA
    CGSSACNVLVTDEQDVPEVWSSKSLGKLEGFMPELSRQIVETDRSVMEHVDKISQSCLLERLD
    DEAHQYCYVDNELDSGCVYVSLLENPERFTGYSGPHSTRIWEMIYNQCLPDSSAPTIDFPALFMQGPLAPPPKPQEQLLK
    ERMDAWTLEQRVFYRVLSGMHSSISTHLCHGYLNQRNGVWGPNLQCFQEKVLNYPERLENLYFAYALMQRAIDKLYGHLD
    SLTFCHDSVLQDSEVRQKIAGLVSLIHNSPKMFDETMLFAGDPSISTALKEDFREHFKTVSALMDCVGCERCRLWGKIQT
    NGFGTALKILFEVSNIEDEVTNFDSRSFSLRLRRSEIVALINTFDRLSRSINFVDDFKQIYSEQHKPASFKRRVLRRIKQ
    LLFSVTPVALHPFLQKTSSILVDLYFDFKAEWDNVMLGFRYVFASYLRFPRLFKFVLFSQESPFLNWTSHHLQRYIPKNW
    FPEVASV

    >gi|19075930|ref|NP_588430.1| thioredoxin peroxidase Tpx1 [Schizosaccharomyces pombe 972h-]
    MSLQIGKPAPDFKGTAVVNGAFEEIKLADYKGKWVFLGFYPLDFTFVCPTEIVAFSEAASKFAERNAQVILTSTDSEYSH
    LAFINTPRKEGGLGGINIPLLADPSHKVSRDYGVLIEDAGVAFRGLFLIDPKGVLRQITINDLPVGRSVDEALRLLDAFQ
    FVEEHGEVCPANWHKGSDTIDTKNPEKYFSKH

    >gi|19111909|ref|NP_595117.1| thioredoxin peroxidase [Schizosaccharomyces pombe 972h-]
    MDAPRRSSRLAAKIANVLDSKGTIIPEAAPVMLKKPAKDESVDSTIQVGDVIPDITLPDEDGTSIRLRDITANKGLVIFA
    YPKASTPG
    CTKQGCGFRDNYPKIQASDYEVLGLSFDTSKAQKAFKDKQNFPYHLLSDPKGELIKKLGAEKPGGGKLFRSH
    WIFEKGTGKCIVKEIDISPLVSVDKAFAVITDSEP

    >gi|19112098|ref|NP_595306.1| thioredoxin-like I protein Txl1 [Schizosaccharomyces pombe 972h-]
    MSVIEIRSYQHWISTIPKSGYLAVDCYADWCGPCKAISPLFSQLASKYASPKFVFAKVNVDEQRQIASGLGVKAMPTFVF
    FENGKQIDMLTGANPQALKEKVALISSKATGTGALASSSSAPVKGFASLQGCIENPQLECLNQQDDHDLKSAFNSNPSSF
    LESDVDEQLMIYIPFLEVVKVHSIAITPVKGETSSAPKTIKLYINQPNNLSFEDAESFTPTQVIEDIVYEQDDQPTIIPL
    RFVKFQRVNSLVIFIYSNVGEEETTKISRLELFGEPVGDSSKGKLQKVEA

    >gi|19112148|ref|NP_595356.1| methionine sulfoxide (predicted) [Schizosaccharomyces pombe 972h-]
    MGFPLEKSEDEWKKELGPEKYRIMRQKGTEHPGAGRFTHQFPKQGVFVCAACKELLYKASTKFESHCGWPAFFDNLPGKV
    KRIEDNSYGMHRVEAVCANCGGHLGHIFKGEGYSNPTDERH
    CINSASLEFHNEATNDN

    >gi|19112185|ref|NP_595393.1| sulfhydryl oxidase (predicted) [Schizosaccharomyces pombe 972h-]
    MILNRRIQVILPTLLILSFIIWIFHSVMVDKDWRLFMPEIKSLPDREGQGRKPIEMMSTKHDNNTNNLMVNAYWKLIHTV
    VSNYPNRPTLDERDILRHYLFSSAITMP
    CGEYSVELQKILDVHPPQTSSRKAATTWACKVHNQLNEKMNQPKTSCDGFNE
    RYVIGSPTYRESEAENVPERVQVINEDHDYSG

    >gi|19112317|ref|NP_595525.1| ER associated protein disulfide isomerase (predicted) [Schizosaccharomyces pombe 972h-]
    MRSNTFGSVMRISWVVAFITMVQTLVSGVPLTDNDLESEVSKGTWFIKYYLPSCGACKRLGPMWDNMVEKAKEQVEGSNF
    HFGEVDCSKELSSCANIRAVPTLYLYQNGEIVEEVPFGASTSEASLLDFVETHLNPDTDPDIPSDEDVLTDEDTEEVASI
    QPALSTSVSSLSLASTAMSKSASASEFSGSSVTKASKKLTSSPTSVASKKATLSSVSKVASTSSLPVTSVSASVDPKSAA
    SKVQDAEFSIQTAPSFPKEKEEKENTEETEESKKSINPTGTSKALALDADIDAALTDKEGWFIQFYSSE
    CDDCDDVSTAW
    YAMANRMRGKLNVAHINCAVSKRACKQYSIQYFPTFLFFKEEAFVEYVGLPNEGDLVSFAEEAANFEIREVELLDTVNAE
    KNGDVFFLYFYDDDSAEYLNIIRKTGIQLLGHANLYLTTSQQIAKKYRVVSFPKLIVVRDGIASYYPAKMAQDNKDYRRI
    LGWMKNNWLPVLPELRTSNSKEIFNDESVVLFLLNPELDDFDETKRTAQKIATEFLDEEGRTYQSNWQKETDKKNSLVNE
    AEEKNDLEAIEAAKNFHVNGKPSPTRFAWVNGKFWAQWLRKFDIDIEATGPRVIVYNAAQDIYWDETAKGTPISIEKDTV
    FDIIKQVETDPDHLKFKILKKNLGVEYLESYGLNIRVLYMVLGIVTVGILVWYFSGRRARTLQRRRHSTPILPVSMRSTG
    NSGKFD

    >gi|19112381|ref|NP_595589.1| glutathione reductase [Schizosaccharomyces pombe 972h-]
    MAPISKVFDYLVIGGGSGGLASARRAAKHGAKVALIEASGRLGGTCVNYGCVPKKIMWNIADLVAKMKTAKQNGFPNSQL
    GSFDWGMIKRKRDAYIGRLNGIYERNVNKDGVAYISGHASFVSPTEVAVDMNDGSGTQVFSAKYILIAVGGHPIWPSHIP
    GAEYGIDSDGFFELESQPKRVAIVGAGYIAVELAGVFAALGTETHMFIRQSKFLRKFDPIISDGIMDHFQHIGINVHTNS
    LEFKKVEKLPSGELCIHQQDGSTFNVDTLLWAIGRAPKIQGLRLEKAGVKTLPNGIIIADTYQRTNVPTVLSLGDVCGKL
    ELTPVAIAAGRRLSDRLFGGIKDAHLDYEEVPSVVFAHPEAGTIGLTEQEAIDKYGESQIKVYNTKFNGLNYSMVEQEDK
    VPTTYKLVCAGPLQKVVGLHLVGDFSAEILQGFGVAIKMGATKSDFDSCVAIHPTSAEELVTLV

    >gi|19112737|ref|NP_595945.1| SUMO E1-like activator enzyme Fub2 [Schizosaccharomyces pombe 972h-]
    MPTLMQLSNDMKPLTFVEALRNFKSAKVLLVGAGGIGCELLKNLLMSGVKEVHIIDLDTIDLSNLNRQFLFRKKHVKQPK
    AIVAAKTASSFNPNVKLEAYHANIKEDRFNVAWFRQFDLVFNALDNLDARRHVNKQCLLASVPLIESGTTGFLGQVQVII
    HGKTECYDCNPKEPPKTYPV
    CTIRSTPSQPIHCVVWAKSYFFPQLFSNDQESDGIIDNVSANEMERREIAELARETTELN
    ELRSSIGQSDNGFEKIFTKMFTKDIVRLREVPDAWTYRSPPKELSYSELLENAEKATSPWLNEQNVWNVAESFAVLRDSI
    RRLALRSKSSKDDLSFDKDDKDTLDFVAAAANLRAHVFGIQQLSEFDIKQMAGNIIPAIATTNAVIAGLCITQAIKVLQG
    DLNDLKNIYLAKRPTRVLHCEKTCKPNPYCPTCSFVLLQLGVNDKNMTLRVLVDDILKSRLHYSEEVSVLNDKLIYDPDF
    DDNLDKTFDDLGINPAKNTILTVLGDSAVEKDDDGEEATRVPLLIEVTFIDSNSTEGLPYQILSNATSIPLKQQPPSNSP
    EDSQVLTDEINEVNDFSSSERIVINLDEYDIIVDSKTSSHNKQLKRRPSNDTLTQEAKSKKQAKIHTM

    >gi|19112746|ref|NP_595954.1| mitochondrial thioredoxin Trx2 [Schizosaccharomyces pombe 972h-]
    MRSFALRRSFTSSRILRKVNAVESFGDYNTRISADKVTVVDFYADWCGPCKYLKPFLEKLSEQNQKASFIAVNADKFSDI
    AQKNGVYALPTMVLFRKGQELDRIVGADVKTLSSLLAKYQE

    >gi|19112908|ref|NP_596116.1| ER oxidoreductin Ero1a [Schizosaccharomyces pombe 972h-]
    MIGITKLISIWNAIWNFLLLPEIIISQTDTSSTGIYQMQSKVRSLVPVLTERSDYFSYYRVNLYRSSCPLWENDNAMCSN
    QGCAVKSLNEIEIPKVWKKLSDFEPHSKKNDTKCNWKYNPDLDYCYLDNSTSPDEYVYVSLVQNPERFTGYAGDHSAAIW
    RSIYEQNCFVVDDDDNPSEQPKSNALFRPNQIPLNLFTENHDDTSLSPSVACLEKRMFNRIISGFHASISTHVCQNYYDV
    EEQRWTQNLDWWRAKVGSFPDRIENIFFNYALLHQALVQIATQMKNITSDSSFTFCPTDKDVDWRTHTAFEQLVYHAYQD
    RHVINREQFFADEEAKRFKDSFRKHFRDISRIMDCVGCDKCRLWGKVQITGYGTALKLLLEPETQLSDLRPEEVVALVNT
    FDRISHSVEATFWFSLKAKTNDTLDAIKALIYKTYRSPSKEILAFFIDQTWYLFYALFFICNVPRVI

    >gi|19112938|ref|NP_596146.1| glutathione peroxidase Gpx1 [Schizosaccharomyces pombe 972h-]
    MSHFYDLAPKDKDGNPFPFSNLKGKVVLVVNTASKCGFTPQYKGLEALYQKYKDRGFIILGFPCNQFGNQEPGSDEEIAQ
    FCQKNYGVTFPVLAKINVNGDNVDPVYQFLKSQKKQLGLERIKWNFEKFLVNRQGQVIERYSSISKPEHLENDIESVL

    >gi|19113011|ref|NP_596219.1| phosducin family protein [Schizosaccharomyces pombe 972h-]
    MNPDEDTEWNDILRSKGILPEKEPDVDDVLDDALVDAKQLAHENRLENKDLDELAELEDEEDDEFLQMYRNKRMQEWKDQ
    MSKAKFGSVYPISKPEYTAEVTDASKEVFVVVHMFQDSLPA
    CKLLAAILERLAPMYPQIKFVKIPGKQAVENYPEAMMPT
    LLIYGHGDLQQQILTLATLGGMNTSVVDVAEALVRAGALKDSDIAALKDPQNAEDELGKRDSSVNDDLDDDFD

    >gi|162312305|ref|XP_001713148.1| ubiquitin activating enzyme (E1) [Schizosaccharomyces pombe 972h-]
    MSNNMNIDQTDQNTIDEGLYSRQLYVLGHEAMKQMSQSNVLIIGCKGLGVEIAKNVCLAGVKSVTLYDPQPTRIEDLSSQ
    YFLTEDDIGVPRAKVTVSKLAELNQYVPVSVVDELSTEYLKNFKCVVVTETSLTKQLEINDFTHKNHIAYIAADSRGLFG
    SIFCDFGENFICTDTDGNEPLTGMIASITDDGVVTMLEETRHGLENGDFVKFTEVKGMPGLNDGTPRKVEVKGPYTFSIG
    SVKDLGSAGYNGVFTQVKVPTKISFKSLRESLKDPEYVYPDFGKMMRPPQYHIAFQALSAFADAHEGSLPRPRNDIDAAE
    FFEFCKKIASTLQFDVELDEKLIKEISYQARGDLVAMSAFLGGAVAQEVLKATTSKFYPLKQYFYFDSLESLPSSVTISE
    ETCKPRGCRYDGQIAVFGSEFQEKIASLSTFLVGAGAIGCEMLKNWAMMGVATGESGHISVTDMDSIEKSNLNRQFLFRP
    RDVGKLKSECASTAVSIMNPSLTGKITSYQERVGPESEGIFGDEFFEKLSLVTNALDNVEARMYVDRRCVFFEKPLLESG
    TLGTKGNTQVVVPHLTESYGSSQDPPEKSFPI
    CTLKNFPNRIEHTIAWARDLFEGLFKQPIDNVNMYLSSPNFLETSLKT
    SSNPREVLENIRDYLVTEKPLSFEECIMWARLQFDKFFNNNIQQLLFNFPKDSVTSTGQPFWSGPKRAPTPLSFDIHNRE
    HFDFIVAAASLYAFNYGLKSETDPAIYERVLAGYNPPPFAPKSGIKIQVNENEEAPETAANKDKQELKSIADSLPPPSSL
    VGFRLTPAEFEKDDDSNHHIDFITAASNLRAMNYDITPADRFKTKFVAGKIVPAMCTSTAVVSGLVCLELVKLVDGKKKI
    EEYKNGFFNLAIGLFTFSDPIASPKMKVNGKEIDKIWDRYNLPDCTLQELIDYFQKEEGLEVTMLSSGVSLLYANFQPPK
    KLAERLPLKISELVEQITKKKLEPFRKHLVLEICCDDANGEDVEVPFICIKL

    >gi|19113439|ref|NP_596647.1| glutaredoxin Grx4 [Schizosaccharomyces pombe 972h-]
    MSVEITFVEQFQEILQNGKEQIILLNFYAPWAAPCKQMNQVFDQFAKDTKNAVFLKIEAEKFSDIAESFDVNAVPLFVLI
    HGAKVLARISGANPQKLKAAIDEYIQPLISQISSTNASVETQVNSVQTTNTTSNTSKAPNGLDSELNERLSTLTNAHNVM
    LFLKGTPSEPA
    CGFSRKLVGLLREQNVQYGFFNILADDSVRQGLKVFSDWPTFPQLYIKGEFVGGLDIVSEMIENGELQE
    MLPN

    >gi|19113467|ref|NP_596675.1| iron-sulfur protein Isa2 [Schizosaccharomyces pombe 972h-]
    MLMKSRVNLLFKGPFFFRERCFQTLLNPVIAIRQLSHGSLRNSRSCRIDAKSNTLTKEIFPKINNEFKIKNRFYSSKLAN
    DQFTLQEQCDEKGIPFILYVKDSAKKQLEKIAERKPEENSVLRVTVDGGG
    CHGYQVSFRMDNKIGNADTVFVRGKARVVA
    DNISLPLISGSEIEYTNELIGSSFQLLNNPRAKTSCGCNVSFDVE

    >gi|68013174|ref|NP_001018848.1| thioredoxin reductase Trr1 [Schizosaccharomyces pombe 972h-]
    MTHNKVVIIGSGPAGHTAAIYLARGELKPVMYEGMLANGIAAGGQLTTTTDVENFPGFPDGINGTTLTENFRAQSLRFGT
    EIITETVSKLDLSSRPFKYWLEGAEEEEPHTADSVILATGASARRLHITGEDTYWQAGISA
    CAVCDGAVPIYRNKPLAVV
    GGGDSAAEEAQFLTKYGSKVYVLVRRDKLRASPIMAKRLLANPKVEVLWNTVAEEAQGDGKLLNNLRIKNTNTNEVSDLQ
    VNGLFYAIGHIPATKLVAEQIELDEAGYIKTINGTPRTSIPGFFAAGDVQDKVFRQAITSAGSGCQAALLAMHYLEELED
    TD

    >gi|19113783|ref|NP_592871.1| protein disulfide isomerase (predicted) [Schizosaccharomyces pombe 972h-]
    MKISNLLAAFLAFSGGFFCASAEVPKVNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELEKDGISLVEVDC
    TEEGDLCSEYSIRGYPTLNVFKNGKQISQYSGPRKHDALVKYMRKQLLPTVKPISKDTLENFVEKADDLAVVAFFKDQKL
    NDTYTEVAEVMKDDFVFAASDDKELAKSLGSNFPGIVAFTKDAAQDSDKLVYTGDWDPASIADFIGVSSIPLLDELNQMT
    FGKYQQSGLPLGIIFYNSTESRDELYDVFQPLAKKYQDTLRFAFLDAVRYGAVAKQMNVESDWPAFVIANLKSMLKYPFP
    TTELTAKAMTKFVGDFVDGKLQPKIKSQPIPESQEDLVVLVADNFDDIVMDETKDVLVEFYAPW
    CGHCKNLAPTYEKLAE
    EYSDDSNVVVAKIDATENDISVSISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFIDKHASFEPIKKEKESVPAPDLED
    QVAVEDEMADEL

    >gi|19113852|ref|NP_592940.1| NEDD8 activating enzyme [Schizosaccharomyces pombe 972h-]
    MPSSDVCKAGSHRHSGWIQSLKKPGPFNLDAPENPEETLKSAFSSKILIIGAGGLGCEILKDLALSGFRDLSVIDMDTID
    ITNLNRQFLFNESNIDEPKANVAASMIMKRIPSTVVTPFYGKIQDKTIEFYKEFKLIICGLDSVEARRWINSTLVAIAKT
    GDLIPLVDGGSEGLKGQARVIIPTITSCYECSLDMLTPKISYPI
    CTLANTPRLPEHCVEWAYLLEWPRVFLNASVDSFSK
    QEVFEPLDGKNSNFEPDNIRHIDWLVKRSIERANKFQIPSSSINRFFVQGIVKRIIPAVASTNAIIAASCCNEALKILTE
    SNPFLDNYMMYVGEDGAYTYTFNLEKRSDCPVCGVLSEVYDISASSTVTLKDILNHYSKSYNLQNPSVSTAAGTPLYLAS
    PPALQVATSKNLSQPILSITSVDVNLVITDKNLSTSLSVQLREC

    >gi|19114002|ref|NP_593090.1| URM1 activating enzyme (predicted) [Schizosaccharomyces pombe 972h-]
    MNPQEKIICSSNGLELSLDEYSRYGRQMLLSEIGLPGQLSLKRSSVLVIGAGGLGCPAMQYLVAAGIGTLGIMDGDVVDK
    SNLHRQIIHSTSKQGMHKAISAKQFLEDLNPNVIINTYLEFASASNLFSIIEQYDVVLDCTDNQYTRYLISDTCVLLGRP
    LVSASALKLEGQLCIYNYCNGPCYRCMFPNPTPVVAS
    CAKSGILGPVVGTMGTMQALETVKLILHINGIKKDQFDPYMLL
    FHAFKVPQWKHIRIRPRQQSCKACGPNKMLSREFMESSPKEYTTICDYVPTLSKQLAPIRRISALDLKNLIETSPHITFL
    DVREPVQFGICRLPLFKNIPLSEVDSLQNLSGKVCVICRSGNTSQTAVRKLQELNPQADIFDVVAGLKGWSTEVDPNFPL
    Y

    >gi|67993609|ref|NP_001018226.1| N-oligosaccharyltransferase gamma subunit (predicted) [Schizosaccharomyces pombe 972h-]
    MNFFKILSFFSLFVITCFAKLDLNSKTDADGVIQITGRLFHRIVNGKQDFTTVALFSADSSTMNCDVCRLIEPEFKALAN
    SYKLKYGLDSGIRFTYADFGKNKNLFQDFSIESVPNFWIFKPKSIQAIHVDLSHGVTASHLAAIVEKHTGKIADIVYKQD
    QAKRVGAFLSYIIVGAALFFTRKIIVKIFTSRKVWAALTIITVITLSSGYMFTRIRFSPYSQRGEHGENLWLAGSQQFQF
    GAEVQVVSLLYTALTMSSIFLAIVAPKVEGAKRQTLFVIIWLAFLWIGYSFLVDIFKRKVSMYPFKLLI

    >gi|19114408|ref|NP_593496.1| dihydrolipoamide dehydrogenase Dld1 [Schizosaccharomyces pombe 972h-]
    MLNSVIKRSALCRFKFTCLQVSECRPAQIEISKRLYSAKASGNGEYDLCVIGGGPGGYVAAIRGAQLGLKTICVEKRGTL
    GGT
    CLNVGCIPSKALLNNSHIYHTVKHDTKRRGIDVSGVSVNLSQMMKAKDDSVKSLTSGIEYLFKKNKVEYAKGTGSFI
    DPQTLSVKGIDGAADQTIKAKNFIIATGSEVKPFPGVTIDEKKIVSSTGALSLSEVPKKMTVLGGGIIGLEMGSVWSRLG
    AEVTVVEFLPAVGGPMDADISKALSRIISKQGIKFKTSTKLLSAKVNGDSVEVEIENMKNNKRETYQTDVLLVAIGRVPY
    TEGLGLDKLGISMDKSNRVIMDSEYRTNIPHIRVIGDATLGPMLAHKAEDEGIAAVEYIAKGQGHVNYNCIPAVMYTHPE
    VAWVGITEQKAKESGIKYRIGTFPFSANSRAKTNMDADGLVKVIVDAETDRLLGVHMIGPMAGELIGEATLALEYGASAE
    DVARVCHAHPTLSEATKEAMMAAWCGKSIHF

    >gi|19114496|ref|NP_593584.1| protein disulfide isomerase (predicted) [Schizosaccharomyces pombe 972h-]
    MRLPLLSFVIFALFALVFASGVVELQSLNELENTIRASKKGALIEFYATWCGHCKSLAPVYEELGALFEDHNDVLIGKID
    ADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIKKRKIVLPSNVVELDSLNFDKVVMDDKKD
    VLVEFYADW
    CGYCKRLAPTYETLGKVFKNEPNVEIVKINADVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLES
    LIEYINKKSGTQRSPDGTLLSTAGRIPTFDEFAAEFLDMSNAAKEVVLEKVKQLALEDSSRWTKYYKKVFEKILNDENWV
    HKEAKRLSKLLRQKSIALASADDFKTRLNILNSFLPGNH

    >gi|19114565|ref|NP_593653.1| thioredoxin family protein [Schizosaccharomyces pombe 972h-]
    MLFRIPTLFTLFLACFSLVSGVFGYSPMFGSNTIELNSKNFRKFVKAKGPSLVVFYAPWCGYCKKLVPTYQKLASNLHSL
    LPVTAVDCDADQNRAVCSQYQVQGFPTIKLVYPSSKGSSLSSTDYNGDRSYKSLQKFVSDSIPSKVKILTSEAKTQKFIQ
    DAQNSSKVILISQKMKPTLLYKSLSNEFSSLPFSFMPAKANVNDLFNISAYVDTSDLPILFIKHPNNGTSFFSNSLNRDS
    IVEFLQSSIKDNNFSEYLATFCSKKSCIITIQDKDSDSGIDESIRKKYPKLHFVRLGRNTTVAERLEDTLDLGYSDTFLL
    SLKKSHYNAKPYGKPLRRWLEDIQVQQAGPSVSLPNDLLSKIK

    >gi|19114764|ref|NP_593852.1| cytosolic thioredoxin Trx1 [Schizosaccharomyces pombe 972h-]
    MVKQVSDSSEFKSIVCQDKLVVVDFFATWCGPCKAIAPKFEQFSNTYSDATFIKVDVDQLSEIAAEAGVHAMPSFFLYKN
    GEKIEEIVGANPAKLEASIKANL

    >gi|19114800|ref|NP_593888.1| monothiol glutaredoxin Grx5 [Schizosaccharomyces pombe 972h-]
    MNSMFRFWIPKTSISMQLRMLSTQTRQALEQAVKEDPIVLFMKGTPTRPMCGFSLKAIQILSLENVASDKLVTYNVLSND
    ELREGIKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILKEINALAPEQPKDSEEETTKKD

    >gi|19115222|ref|NP_594310.1| glutaredoxin Grx2 [Schizosaccharomyces pombe 972h-]
    MTSIAKAFVEKAISNNPVTVFSKSFCPFCKAAKNTLTKYSAPYKAYELDKIENGSDIQAYLHEKTKQSTVPSIFFRNQFI
    GGNSDLNKLRSSGTLTKMIAELKENKSSIL

    >gi|19115255|ref|NP_594343.1| protein phosphatase Fmp31 (predicted) [Schizosaccharomyces pombe 972h-]
    MFSKTLSVSRLLMTRSFYSSTVVKNVSIFDFEKVNQHRNTFAFICDVFWLKLSFTLRYSTLQVYNLSKRPTGDKSTVLID
    VREPDEFKQGAIETSYNLPVGKIEEAMKLSDEEFSKTYGFSKPVFEDNVVVY
    CRSGRRSTTASDILTKLGYKNIGNYTGS
    WLEWSDKIKSK

    >gi|68000538|ref|NP_001018268.1| thioredoxin fold protein, human TXNCD9 ortholog [Schizosaccharomyces pombe 972h-]
    MTSFPASHGFGPRKRGYQMDLTNVQPVENKPAWISMKSPLEKEIANEYEALKVTERKEDTQDYNEPELHNSNDPTVDLYA
    DTYATQAATESDSELEDALFSQLDEFDDTAYREQRLEMLKKEFARVEAAKEKGHMQFLTVENEREVMDFTLSSKKVVIHF
    YHPDFIR
    CKIIDSHLEKIAKVHWETKFIRIEAANAPFLVVKLGLKVLPAVLCYVNSQLVDKIIGFADLGNKDDFETSLLE
    FRLLKSSAIDRLKEESSSNKSIYHDELQNNQSDDSDFFE

    >gi|19115381|ref|NP_594469.1| trans-aconitate 3-methyltransferase (predicted) [Schizosaccharomyces pombe 972h-]
    MIGRTFKTDIADYETARPDYPPQITEWLNDEFSVNETSTILELGAGSGKLTPRIIASQPKEIIAVDTYVEMLDVLKKKFP
    NVDCRVGSAMAIPLEDESVDLVACGQCFHWFANEEALKEIYRVLKPNGKLALIWNIRDNSVPWVEKCSQLLEK
    CRGGPLN
    MFEKAAELFPGYGFTELKQSLFTSAKKYSIEDLHRLMNSFSSINRLPVEEKEKMHAELDEIIKTIPRAQNTDQVDFNILT
    VAYSSEKVPIN

    >gi|19115475|ref|NP_594563.1| peptide methionine sulfoxide reductase (predicted) [Schizosaccharomyces pombe 972h-]
    MQIAIIAAGCFWGVQEVYLRKFIPAAAILKTSVGYTGGITADPTYKEVCTNTTNHAEALKIEFDEKLTSYDKIIEFFFAM
    HDPTTSNQQGNDIGTQYRSAIFTTNPEQATIAKRVMNEVQAKHYPNKKIVTQILPAGKWWDAEDYHQLYLEKNPDGYRCS
    SHFLRWNVFE

    >gi|19115652|ref|NP_594740.1| UPF0061 family protein [Schizosaccharomyces pombe 972h-]
    MSKKLKDLPVSSTFTSNLPPDPLVPTVQAMKKADDRILHVPRFVEGGGLFTYLTPSLKANSQLLAYSPSSVKSLGLEESE
    TQTEAFQQLVVGSNVDVNKCCPWAQCYGGYQFGDWAGQLGDGRVVSLCELTNPETGKRFEIQVKGAGRTPYSRFADGKAV
    LRSSIREYLCCEALYALGIPTTQALAISNLEGVVAQRETVEPCAVVCRMAPSWIRIGTFDLQGINNQIESLRKLADYCLN
    FVLKDGFHGGDTGNRYEKLLRDVAYRNAKTVAKWQAYGFMNGVLNTDNTSILGLSIDYGPFGFLDVYNPSFTPNHDDVFL
    RYSYRNQPDIIIWNLSKLASALVELIGACDKVDDLQYMEQLHNSTDLLKKAFAYTSEVFEKIVEEYKNIVQNDFYDLMFK
    RVGLPSDSSNKILITDLLQILEDYELDMPNCFSFLSRNSPSSMENEEYAAKLMQACICLNPNNERVRNESVKAFTNWVGR
    YSEATKTQEDSSRLASMKKVNPHFTLRNWVLEEVIKEAYIGKFELFKKVCKMAACPFEDTWGFSKEEEDYLCYNTTPSKS
    QIQCS
    CSS

    >gi|19115675|ref|NP_594763.1| glutaredoxin Grx1 [Schizosaccharomyces pombe 972h-]
    MSSVESFVDSAVADNDVVVFAKSYCPYCHATEKVIADKKIKAQVYQIDLMNNGDEIQSYLLKKTGQRTVPNIFIHQKHVG
    GNSDFQALFKKGELDSLFNTA

    >gi|19115886|ref|NP_594974.1| sulfhydryl oxidase (predicted) [Schizosaccharomyces pombe 972h-]
    MVFGKRYRDKETGIIYDENGRPCKTCNIFSSFRNVAQQPNSSTVPEVKSNTQLESKQSSIDCNTNAIPDSVSFPRLPDVA
    ELGRSTWTFLHAMAANFPKNPTPTQQNDMSSFLYNFSKFYP
    CWSCAEDLRIWMAKYGNSPRVDSRESLCEWICEAHNDVN
    ERLGKPLFNCQVWSKKASELAD

    >gi|295443016|ref|NP_594172.3| protein disulfide isomerase (predicted) [Schizosaccharomyces pombe 972h-]
    MGENIEISTKVIENQEIRFRCYKADSTKIAVLAHPYAFLGGSVDDINIIALSKKINSKGFTVYVLDATTRRSALLSGKHD
    TMIFTLFVKYITSLNHPEYLLLGGYSYGARISMHKSITLAIDKRISHVSYLFLAPYLGLGSSILSWSWGLGFESFSTDSK
    VLFVWPDNDEFTREGTFETTLAKLKNRCPETTPLKLTDCSHMLSPSSRKILLETVDKWLASALNAGFSSCEKKFFIITFT
    KTNLQKDKLLKRIIDCVKIAPFCLKMFVYVFICMLHILCMIYYAFSIKQEIIVSSHNASSILNTTAFWFVEFTESKYDKE
    EFSVIWNEVSMEFPDIRRAKVFCDLDLEFCAQQEIYDHPKVVVLKNGMWMRHVLEKNQITTKSARQFVKSHLGNCDLEQA
    ENETDCFSDDGEYNSDSSSTDPAFELKEDQSWKHSSILRPLETLNFKRFLFGNEIMSKTRAFVMFVSLKH
    CEDCFHWEAV
    WSSITRNTDERLKMAQVNCDEEKEMCNHFHIKKFPTFRVFQGFDSIQYNGPLKYQQLLSYSNQVASYQAIKIEEGDIESI
    ENSHPVFFLVLYDFATTSEDFSIIERLKLQLAGVAPLYICNSKALANKYGAQSQPSIIAVRNGMPIVYQAITPREFRDYK
    RITEWINIVSSPFITELTPTKCHSLLNRKLTVLTLLQPDSEQFFSSQEELLRLGKRWFRFQMQRQRNDIVWSRIKKYSAI
    AEAKKKGFARKVKRIKYSKISHPTYTESVSFLWLDSSLWLDWIVENLDHTVYVDSITPPVFVIDHSKGVIYVSDRNGNSL
    TLEEDSLFSTLRIILEHPNSSRLQKLRAPGLCPNGSPNYRNRYKLIVFNLLIALLILSILTIISASRLSRRRRQLLNKQP
    VFGFYHSLVIAKSD