Saccoglossus kowalevskii

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|291220759|ref|XP_002730393.1| PREDICTED: thiosulfate sulfurtransferase-like [Saccoglossus kowalevskii]
    MTNKASDVPVFVSTEWLSEKMKDGGGGVCIVDVSWHMPQANRDPEAEYKDKHILGAHFLNLSDCKDKSSNLEMMLPSPDD
    FAKCVGALGIGNDSHVVVYDNNAKLGMFSAPRAWYMFRVFGHDKISILNGGFPKWVAEDRPTTSEVPDVDAVTYSPCFRA
    NLVKDRADVESNMSENRYTLLDARPPGRFNGEDPEPVPNIKSGHVKGSVNIPFPKTLDGDSKLFKEPNQLKDIFSDAGID
    LSQPLTVL
    CGTGLTASFLVLAAFSCGKLDVPIYDGAWMEWFLKSDPDTMEGVPE

    >gi|291221895|ref|XP_002730955.1| PREDICTED: glutaredoxin 2-like [Saccoglossus kowalevskii]
    MGQTSSSSVDMNSKEAKYIGEMIHDHCVVVFSKQYCPYCKMAKDVFNDLQAKYEVVELDQRDDGAQLQNILSHMTGARTV
    PRVFVRGKCIGGGTETKSLQKSGKLEPMLRECGAL

    >gi|291223082|ref|XP_002731542.1| PREDICTED: thioredoxin domain containing 11-like [Saccoglossus kowalevskii]
    MLVDAMPFSEQFIFLSRGCVNLNNYYNPQVHFSVCCNLSDSSHRNLNNNDARFRYVESENERICLDNAEEPSCSSHDNSD
    NRGAFHLPSSDVSPPKYNASYIAAIEEMKSAMQFTGLGCHTNRSVNFFALNWDEYGIIAKRLGIEPESKRPTLALLDLEN
    EVEYIMESTYNVSNMVNFLKSYTVSDLIRQLKSTPVTSKEQVCKDNNVVCVTEVTSATFHEIVLNVEKDVLLLYYTPW
    CG
    F
    CNSLYQTYLDITKVFQSSQNLTIARINADANDLPWEYTVPTYPSLLFYPAGHKSWNAKFPDDEDISLENLVLFILDNAV
    RPLEF

    >gi|291223310|ref|XP_002731648.1| PREDICTED: prolyl 4-hydroxylase, beta subunit-like [Saccoglossus kowalevskii]
    MKYLLAFLVVACVAVVYDAADVAEEGDVLILTTDNFQEVIDGNDYVLVEFYAPWCGHCKALAPEYSKAAKQLKDDGSDIK
    LGKVDATIESDLAQKFGVRGYPTLKFFKKGKESDYQGGREADGIVNWLNKKTGPPAKTLESVEDAEKLAEKEVCVIGFFK
    SADSDNAKIFLEVASANDDISFGITSSDDVFKKYEVKDGAIVLLKKFDEGRNDYDGDLTADALATFVAANSLPLVIEFSE
    QTAQKIFGGDIKKHNLMFLDKEVENFQSIYDGFTEAAKDFKGKVLFVMIDAGSEDNGRILEFFGLKKEDTPAVRLINLEA
    DMAKFKPESDEIKAETMKTFVNAVLDGKLKPHLMSADVPEDWDKEAVKVLVGKNFEEVALDKTKDVLVEFYAPW
    CGHCKQ
    LAPIYDELAENFKDREDIVIAKMDATANEIEVVKVQSFPTLKFFPKDSSDIIDYNGERTLEGFTKFLESGGKHGAGPSDE
    DEDLDEEEEEEQEEQKKDEL

    >gi|291223312|ref|XP_002731654.1| PREDICTED: Protein Disulfide Isomerase family member (pdi-2)-like, partial [Saccoglossus kowalevskii]
    MKYFFAFLACVAIVYGEADIAEEDDVLILTTDNFQEVIDGNDYVLVEFYAPWCGHCKALAPEYSKAAKQLKDDGSDIKLG
    KVDATIESDLADIFGIRSYPTLKFFKKGNVREYV

    >gi|291223427|ref|XP_002731711.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MATIDRGATPSEGLTSVDMYVPAPEPSTPHIDYEIIAKMPVWDSNGIMIPLDHLYRNQKVIIVFIRNFLCYTAKEYVEDL
    AKIPPNYLWDANVRLVVIGCSEWKYIKAFKNETGFPYELYVDQEKNIFSALKLKNHSSVQGSIHSPHVKSSIFGGLIKST
    WRAMLHGDYHGDIKQLGGQLIVGPGPQEHFFHIDNNMMDHTPINRLLAVAGVDQVSYEKHARVIQL

    >gi|291225077|ref|XP_002732528.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Saccoglossus kowalevskii]
    MSRRKRMAVDSNRVDIEWPGRWNHIRKFLERTGPFAHPDFEPNPEMLTFLLETCRILVVGAGGLGCELLKNLALSGFRQI
    DVIDMDTIDVSNLNRQFLFRSKDVGKSKAEVAAKFINNRVPGCNVTPHFQKIQDCDGSYYRQFHIVICGLDSIVARRWLN
    GMLLSLVNYEDGILDQSSIIPLIDGGTEGFKGSARVILPGLTACIECTLDLYPPQVVFPM
    CTIAHTPRLPEHCIEYAKVL
    VWPQEHPFGENIPIDGDDPAHIQWIFDKALERAKHYNIQGVTYRLTQGVVKHIIPAVASTNAVIAAACVTEAFKLATSCC
    MPLNNYMVFNDIDGLYTYTFEAERKEDCISCSQVPQTLTFDEDTTLQELLSYLIENSSIQLKAPGITTTIDGKHRTLYMQ
    TVESIEKRTKVNLTKKLKELGLIEGQELIVADPTTPSSLVVNLHYNQNSKMEG

    >gi|291225642|ref|XP_002732815.1| PREDICTED: protein disulfide isomerase A4-like [Saccoglossus kowalevskii]
    MKALKISAVIFGCILLFANVNTTDEEGGETAEIPDEEELESLEPDVQEENDVLVLTQKNFDDVVPDKDIILVEFYAPWCG
    H
    CKQLAPHYEKAAKRLKENDPPVLLAKVDATEESELGTRYDVSGYPTLKVFRKGEAFNYEGPREEEGIVKYMKEQADPNW
    KPPPEAVITLTEANFDEIVNEAELILVEFYAPWFVGCTGSTIQSKYEKVCKFGIISYMQKQAGDSSIMIDDKKALKLLIS
    NKESDISVVGFFESKDDELYQTYLDTGNSLRDDFDFMHTFDKESRDYYKAKPGNIVMFVPERFQSKYEEKRYVWDKSTAT
    TEELKEFYKEHQTPLVGERTTDNQEKRYSKKPLVVVYYTVDFSFDHRVATQIWRDKIVEVAKDFPSLTFAIANEEDFEKE
    LQELELADSGAEMNAGIFAEDGTKYKMKADDDEFDEEFREFVENFVAGKLKPVIKSQPVPKKNDGPVTIVVGKTFNKIVL
    DKKKDVLIELYAPW
    CGHCKNLEPIYKKLGKKYKKEKNLVIAKMDATANDVPPNYSASGFPTIYFAPANSKDSPLKFDNTR
    DLAGFTSFLEEKSTVLKKSRVKEEL

    >gi|291226151|ref|XP_002733057.1| PREDICTED: peroxiredoxin-like [Saccoglossus kowalevskii]
    MSAGKCQIGKEAPAFKGAAVVNGDFKDIKLSDYRGKYLVFFFYPLDFTFVCPTELIAFSDAVEKFRGIGCELIACSTDSQ
    FSHLAWTNVPRKKGGIGDMNMPLLADPTGTISKDYGVYIEDQGIAFRGLFIIDGKGILRQITINDLPVGRSVDETFRLVQ
    AFQFTDKHGEVCPAGWKPGDDTIKPDVAKSKEYFSKQK

    >gi|291226196|ref|XP_002733080.1| PREDICTED: putative tumor suppressor candidate 3-like [Saccoglossus kowalevskii]
    MAESTSTGIWFFLLLFVIVNIIASNTPLVDAKKKEQVLGDRVKQLMDWNMKRSVIRLNGDKFRQYVKATPRNYSMLVMFT
    AMQPQRQ
    CTVCRQVNDEFQILANSWRYSQAYSNKLFFASVDYDEAHDVFQSLKLNSAPALMHFPPKGKAKKGDTFDIQRL
    GFAAEAITKWVGERTDIVIRVFRPPNYSGTIALALLFSLIGGLLYLRRNNLEFLYNKTMWGILSLCIVFAMTSGQMWNHI
    RGPPYAHKNPQTGQMSYIHGSRSGQFVAETHIVLLLKNTKYKARTLLLNLYEEIPIGETLHKERHDLSDGSAVEKDTSEK
    IDEQRDEYSSDENSGSETEEVDNTKEVTFHELLNKEKQCVQDRLALKQKETA

    >gi|291226599|ref|XP_002733251.1| PREDICTED: thioredoxin 2-like isoform 1 [Saccoglossus kowalevskii]
    MMLLSLRRIASPSILQSIRNLQSSYLIQRNVPAASRCAFIHTGNPHRTSFNVQDSDDFMERVIKSNKPTVVDFHATWCGP
    CKILGPRLEKVIAAQNGKVQLAKVDVDTNTDLAMEYGVSAVPMVIAVKQGEKVDEFIGLQEEDQLNSFVEKLL

    >gi|291226601|ref|XP_002733252.1| PREDICTED: thioredoxin 2-like isoform 2 [Saccoglossus kowalevskii]
    MMLLSLRRIASPSILQSIRNLQSSYLIQRNVPAASRCAFIHTGNPHRTSFNVQDSDDFMERVIKSNKPTVVDFHATWCGP
    CKILGPRLEKVIAAQNGKVQLAKVDVDTNTDLAMEYGVSAVPMVIAVKQGEKVDEFIGLQEEDQLNSFVEKLL

    >gi|291226972|ref|XP_002733461.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii]
    MASHVSVFVVVFSCFAVSALTDESCPLFATLHPYPSGGAKESEHALHYSKAQVSKPAPDWTGTGVENGEIKELKLSDYRG
    KYVVLLFYPLDFTFV
    CPTEIIAFSDHADTFRKINTEVIGVSVDSQFTHLAWINTPRKDGGLGNIKIPLLSDITHQISKDY
    GVLMEDLGHTLRGLFIIDDKGILRQITMNDLPVGRSVEETLRLVQAFQYTDSHGEVCPCEWKPGSDTIIPDPEKKKEYFE
    KHGDEL

    >gi|291227471|ref|XP_002733706.1| PREDICTED: peroxiredoxin 6-like [Saccoglossus kowalevskii]
    MVNLGDEFPNFKADTTTGEIKFHDWLDGSWAILFSHPADYTPVCTTELSRVEKLVPEFKKRNVKLIALSCDSVADHKGWI
    EDIKAYSGVAGVSYPIIADEKRDLAVKLGMVDPDEKTAAGLPLTCRAVFIIGPDKKLKLSFLYPATTGRNFDEILRVVDS
    LQLTATKKVATPVDWKPGEKCMVVPTVKPEDVAKLFPKGVEIKPVPSGKQYLRMTPQP

    >gi|291227954|ref|XP_002733947.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MALSRTVITRKLVIFAAILNCTCISTETNGDFSQCEADVEIEEKKCSRNQIWYSAFHRHDLIASLDSWGFSDSRLLDNFE
    VELEERNYVRQVKNVLFSKVLPTPLQTTVKLVAVSSDLLENVLDLDKSISETEHFLTFVSGNTILPGSIPISHRYGGHQF
    GEWSDQLGDGRAHLLGEYVNRNGDRWELQLKGSGLTPYSRRGDGRAVLRSSIREFLCSEAMYHLGIPTSRALSVIVSGDP
    VWRDQFYDGHAKTEKAAVVLRLAKSWFRIGSLEILAMKREIKLLRRLTDFVIENYFPSIDISDENKYLSLFSEIVSQTAD
    LMARWMSVGFAHGVMNTDNFSLLSITIDYGPFGFLDDYNPSFIPNTSDDEGMYSYENQPDIGHFNMNRLRAALWPLWNNK
    QKQLSEMILQGYIDIYKTRFMEIFRGKLGFLSTDDKDEYIIGLLLKMMEDTRTDFTMTFRQLGNLTFQHIQNNNVSDALW
    ALKTLQLHEKWNNWLQLYYARITSEDDTDVKRMNRMNNVNPKYILRYWMAESAIRKAEDNDFSEVQKLLEILQAPYTEQL
    DMEPTGYADRPPEWSKKLKVS
    CSS

    >gi|291228076|ref|XP_002733995.1| PREDICTED: thioredoxin-dependent peroxide reductase-like [Saccoglossus kowalevskii]
    MASLVRGIRSGVQTLTRVGVSCSTRPSSFGCRQSRLFTTGSRALAVEIQKPAPDFSGTAVVDGAFKDIKLSDYKGKYLVL
    FFYPLDFTFV
    CPTEIIAFSDRAAEFKDINTEVVGVSVDSHFSHLAWINTPRKTGGLGEMKIPLLADFNKKVSQEYNVLLQ
    DAGIALRGLFIIDPEGIVRHLSVNDLPVGRSVDEVLRLVKAFQFVEKHGEVCPAGWTPGSDTIKPDPKGSKKYFEKAN

    >gi|291228238|ref|XP_002734086.1| PREDICTED: thioredoxin reductase 1-like [Saccoglossus kowalevskii]
    MAPIDSKRLIQQYIADNKVMIFSKSTCPFCKRVKDLFSSLKVEYTAIELDQIANGKDLQDGLFEMTGQRTVPNVFINSNH
    IGGCDDTMKKNRDGSLMALVSQSKKQDDASMTESYDYDLIVIGGGSGGLAASKKAAEHGQKVAVFDFVKPTPKGTTWGLG
    GT
    CVNVGCIPKKLMHQAALLGHSLEDAKKYGWEFDDKASHNWTTMRDAIQNHIGSLNWGYRVDLRDKNVTYHNAYAEFTD
    PHTVKAVNKKGKETVMTAKRFIIAVGGRPRYPDIPGAKEY
    CITSDDLFSLPYNPGKTLVIGASYVALECAGFLAGIGYDT
    TVMVRSILLRGFDQDMANRIGDYMETHGVKFIKEHIPTMVEQLEEGSPGKLRVSYKATNGGEIKTIECNTVIIAVGRDAC
    TQTIGLDKAGVEYNVKNGKIPAQFEETNVSHIYALGDVLEGKPELTPVAIQAGTLLANRLYGGHVARCDYVNVPTTVFTP
    LEYGCCGLSEEDAINKYGDQLVEVFHTYFKPLEHTVAQREDNVCYGKIICHRVDSNRVVGFHVLGPNAGEITQGYGVAMK
    CGLSKGLLDLSIGIHPTCAEIFTTLSVTKGSDKAPLAAGC

    >gi|291229052|ref|XP_002734493.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MATSSKEETRDSFTEKLINHVNSGFISVGIAIGSTTGLIETMSNMKEPKTSEEIATTTGLKERYVREWLALMTTGKIVEL
    NEDNDTFYLPEHRAEALRVKEGEISMGMMAQALPLLCGPYEELVSCFKKDGPGGVPYSSFSGFCTYADELSRTRFLKLPR
    FFNETEKVKCLLDSGAKVVDIGCGSGIVLNRLGPQFPKSEFHGVDFSSEAVTKARDDAEKMGATNVLFHEYDAAKLPADW
    LNSFDYVIAMESIHDQAYPDVVLNEISRILKPEGYFSMVDVLASSKLADNISNPVSPMFYAWSLMH
    CMTVSLHFKNGAGL
    GAMWGKQTAMKMLTSAGLEYVLVEESPGDPEYYHYLYKKSASN

    >gi|291229151|ref|XP_002734537.1| PREDICTED: phosducin-like [Saccoglossus kowalevskii]
    MTTLDDKLLGEKTHYYCSSSEESGDEDDARPSGIRDGGLDLEPPNLDYKGYATHTGPKGVIEDWRQFKQLETENRKEQEK
    EKEQLANKLALTCRTSAEDDKEQEMLELLEDEFLQEYRLRRLQEMQEILHSIPMFGSVLHLNRATFLDAIDKEKPQVTVI
    IHIYKNHMDG
    CDAVNGCMQCLAVEYPRIKFCAIKSTETPVSTNFSEYGLPALLVYKSGGLIGNFVRITNQLGDDFFAGDL
    ENFLQEHGILTRKDEQLPAVIRGSTNTEDNDSDLDLD

    >gi|291229500|ref|XP_002734709.1| PREDICTED: ganglioside-induced differentiation-associated-protein 1-like [Saccoglossus kowalevskii]
    MADAGPPLLLYQETVSYFSFCVRMGLAEKNLKYKKCPVNFFNLENLEPWYMRLNPFGLVPTLQHGETVVCDSDKILRYLD
    EAFPETTCLCPDESTDEGHMCGYYRRLNDKIDIRMITLIAPMFPRTTQVTPRNPRFSETNAKHMKAKRDHAATLCERYAN
    IFPDLAEVYLEKKNSELKELPGEEEVQMVLRVCEDVLTKFQEELARKSENTQDVKEQWLCGKRFTSADIYWAATLHRLEE
    LGYDKRFWADGQRPHIESYYEHMRSRVCFKKSEPSTCISWIGEMKQKLPWELAIGATVVAVRMALAEKGLPYTKKTVSIA
    KGHGISPWYMKLNKKGQVPTLGHGDKIIVESEKIVEYLDETFPDKGERCEYFKRLADQFDNWTVHICVPFYPSVAGASSR
    KVTFRKPMLQRIWKSRREVLPGKCEQYAAQYPELKDAYYKKKAEFDIMPEQPEVEKMKEVLTTTEDIMTKMEQELGQIEE
    KHGKDFWLCGERFTVADIYWAVVFYRLEDDALAERFWGKGKRPRIAAYFQRLKARDSYYQSLPSRLVIIAGVLKDKLPVL
    LGIIVLFIGVVVALSLAM

    >gi|291229663|ref|XP_002734792.1| PREDICTED: Thioredoxin domain-containing protein 9-like [Saccoglossus kowalevskii]
    MAGINQQMVEQQLLKATEMIESQVDAEIGRLDTIDDDELEILRKRRMEAMKKAHDQKQEWLQIGHGQYSELQGEKEFFAE
    CKKSKHVVCHFYRDSTFR
    CKIIDKHMGILAPKHVETRFLKINAEKCPFLAERLRIKVIPTLALIKDAKTTDYIVGFDDLG
    ATDDFPTEMLEWRLGCASVINYSGNLMDPPLSDSQSKPFMKNKPKKIIRSQDDDSDSDGY

    >gi|291229998|ref|XP_002734957.1| PREDICTED: C. briggsae CBR-GLRX-10 protein-like [Saccoglossus kowalevskii]
    MCSLISLSLRRLALPWKAISSQSVIPFMSSQRCSAIPAFHYRKPIMSSYPRHYSNYTLDLTEVKKFVDAKIQEHKVVVFS
    KSY
    CPYCTMAKTTLDKYPISMEVIEIEDRPDAEEIQDHLNALTGGRSVPRVFINGKYIGGGSETTQFDRQGKLELMLKEA
    GAL

    >gi|291230000|ref|XP_002734958.1| PREDICTED: GLutaRedoXin family member (glrx-10)-like [Saccoglossus kowalevskii]
    MPSAEVKSFVDAKIKDNKVVVFSKSYCPYCKMAKTALNKYKIALEVIEIEDRPDSEEIQDYLNTLTGARSVPRVFINGKC
    IGGGSETTQFDRQGKLEPMLKEAGAL

    >gi|291231082|ref|XP_002735498.1| PREDICTED: chloride intracellular channel protein 5-like [Saccoglossus kowalevskii]
    MELYVKAGRDGNTLGDCPFCHRIQMVLQLKGLDYQLVPINMQIKPREFLDMNPSGKVPVLYHNGVLMDDSAVIADYLERT
    FPEPSLAASTKVAENAGSNIFQRFTAYLKNKDPKKQDQMRDLLRDELQKLNSVLANSSGDYLDGDILKLPDCNILPKLYH
    VKIAARHYKKFEMPDEFPSLKKYFDLGFENEAFLKTKCEDEEIIFGWSKHIR

    >gi|291231084|ref|XP_002735493.1| PREDICTED: chloride intracellular channel protein 5-like [Saccoglossus kowalevskii]
    MDIELFVKAGTDGKSLGDCPFSHRIQMILQLKGLEYKLIPVNMKIKPRGFLDISPAGKVPVLTHDGGRMDDSTAIAEYLE
    TTFPEPKLRADNVAADNAGDRLFHKFAAVLKNRDASAEVHLKNALLTEVRKLNNFLSNSPGVYLDGDTLKLPDCNILPKL
    YHLKVAAKHFKDFEIPDEMDVLKTYMATAFQTEVFKTTAYPEEEIINGWADHLGVPVKRR

    >gi|291231186|ref|XP_002735550.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MSFRRLSQVIILNLKKKCFLSPNISSSYSGNRQNLCSYPISRYPVPDKKDLPDDIVQQMNEVEEKSGFLPNVFRALSHRP
    AEYRAFFAYYDVLMYKEHGNLSKADKEMIVVATSAHNNCVY
    CVIAHGALMRVFSKKKITADQVAINWKCADLDARQKAIL
    EFAMRVCKSEAIHEEHFVDLEKHGLDREDAWDIGAIVGFFALSNRMAHLVSMRPNDEFYTFGRIPKDKKDK

    >gi|291231405|ref|XP_002735664.1| PREDICTED: prolyl 4-hydroxylase, beta polypeptide-like, partial [Saccoglossus kowalevskii]
    ARDADGIVKWLNKKTGPPAKTLESVEDAEKLAENEVCVIGFFKSADSDNAKIFLEVASANDDISFGITSSDDVFKKYKVK
    DGAIVLLKKFDEGRNDYDGDFTVDAIAAFVAANSLPLVIEYSEQTSSILFGGDIKKHNMIFVDKEVENFQAISDNFTEAA
    KDFKGKVQFVLIDVNTDAGAFILNFFGLKNIPAVLFIDLEADAAKFKPESDEIKAETMKIFVNAVLDGKMKPYLMSADIP
    EDSNEEAVKVLVGKNFEEVALDKTKHVLVEFYAPW
    CEHCKKLAPIYDELAENFKGREDIVIAKMDATANEVEFVKVIRFP
    TLKLFPKDSSDIIDYNGNRTIEGLTKFLESGGKEGAGPSDEDEDLDEEEEEEKAEQKKDEL

    >gi|291231703|ref|XP_002735802.1| PREDICTED: protein disulfide isomerase A6-like, partial [Saccoglossus kowalevskii]
    ARTADGLTSEALKQAKDMVNKRLGKKAGGGGGGGGGGGSRSGGSGGGGGSGNSDDVVTLTDQNFEDLVLNSEDGWLVEFY
    APW
    CGHCKNLAPEWASAATQLKGKFKLGALDATVETITANQYGITEEKVLTDSCEGHQLCVISILPHILDTGAVGRNKYL
    NLLLDMADKYKKKQWGWVWAEAGSQFDVEESLGIGGFGYPAMAALNSRKMKYALLRGSFSEDGLNEFLRELSYGRGSTAP
    VKGAKLPKVAKIEAWDGKDGQMPVEEDYDLDDFDLDEDDTGKDEL

    >gi|291232142|ref|XP_002736004.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MFSKLFSWWGGGKSEAAAGESNVLDDEGSSTGTREGSTAMRLTISSFKKKFPTVKCVKTDVVQTWLQEGSASTKVGDIIE
    KRPLVVVDSRPDSEYQVSHIPGAIRIDYTTDHMDDVVQQIKKSVDEESKDLTKTVVLY
    CSLGYRSCVLAEKVMKACQDSD
    LDVYNMEGGLFKWANEGAPMENGSGRLTKYAHPYNYVFGKLLHHSLRKETPENMEK

    >gi|291232174|ref|XP_002736033.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MATHKRVVVFCIAFNFSNLLLLLSTFSVILGDIQNNDNVEPVVIDHLGVDEDLLEDHDSQYPSSTVLENELTGDIVDDDT
    TKDVCHASDIISEVGLNDSEIIPSNNVTKEMEDDDNDEGVCFATNHTEENKPRFQCTKVELAENETAAVKIVNNTELFQT
    LNRLNTSEGPCAIVLFYAPW
    CRFSAAVAPHVNAVGRAYPMLHVLAVDAIQFSGLNARFGTVAVPNLILFHNGKPVARYNQ
    TERTFEQFKSFIKNHTGIDADATVEVTDEDYLGPLPSVPTVEPDYFLWFSTLFVIAFICYLFKQKFGDRIMERVRTWAEI
    HEHLD

    >gi|291232349|ref|XP_002736119.1| PREDICTED: FAD-dependent oxidoreductase domain containing 2-like [Saccoglossus kowalevskii]
    MASENKKMPGQYDYIIVGAGPGGCQMGYFLEKKKRSYAILEMNDLPGSSFAEHPRHRTLISINKRFNPFPEPEYNMRHDW
    NSLLSDDPELLFTKYSKELFPNADDLVRYMSDYATKFNLNIHYNTRVEKIKKLETQQKPSENFSLQTSKGEYRCKVLLVA
    TGAHDEKVPKKIKGHELMETY
    CSHSLDTEKYNGKKVFILGNGNSAFEVANHLAGAASIIHIFGDRKVKHAWDTHFVGDLR
    AVNDTVLDMYQLKSLHVYQAVNVIEVEKTDEGYVLTIDDIVPHWRESQGHVRVKLPPYDHVICCTGFNYVDLSIFDDNCK
    PVTKQDDKFPVISNTWESNIDNMYFMGTVMQCRDRKAASGFIHGFRYNVRTLHKFLEERYEEVPYPRELYPLDINTLSDK
    ILERVSVSDGIYQMNNVLCHVLAIPDFDPNIKGEIKAELYQDFPKPYVLETAIKGRFAKYKHVFVIVLAYGFEDFGKDGK
    HAMDFAHFPELNATDCQAFLHPVITYYKNGDLMDELKLPESLILRFDVPLTLNQNPDVGNNRMRNFINKQLNLKPGQHLY
    EGFFMEKVSDRVTPFTEDEKRRIPDLSVFKSCIPFSIDLNPKMA

    >gi|291232579|ref|XP_002736237.1| PREDICTED: thioredoxin-like 1-like [Saccoglossus kowalevskii]
    MADNSIRVVQEDAQFQVELANAGEKLVVVDFTASWCGPCQRIAPVFAQLSTKYPTAVFLKVDVDQCQNTAHGNGVRAMPT
    FMFFRNKTKLDELRGADPVGLEAKIKQWIGSEPEETEESGVPGHIDLMSMIEKGGSECLNQSDDCDYTDCFKKGGKYLES
    DCDEQLILHLAFNQPVKLHSIKIHGNPDEMDKAPKNVKLFINQPHTLDFDKAESYEPLQILSKKDIRTDDIKYRSRTCDI
    GYWCRTGDIKYRPRTGNIRYRFWTGDIRYRFRTGDMRYRFQTGDIRYWFRTGLVISDTGSGLVISDTGSGLVISDTGSGL
    VISDTGSGLVISDTGSGLVISDTNSGLVISDTGSGLVISDTGSGLVISDTGSGLVILVTGSGLVISDTGSGLVISDTSSG
    LVISDTGSGLVISDTGSGLVISDTGSGLVLSDTGSGLVISDTGSGLVILDTGSGLVISDTGSGLVISDTGSGLVISDTVS
    GLVISDTVSGLVISDTSLGLVISDTGSRLVISDTGSGLVILDTGSGLVILDTGSGLVILDTGSGLVILDTGSGLVISDTG
    SGLLFVADNQGGEDTTIIQHLSFIGSPVQAATNMSDFKRVAGKKGESH

    >gi|291232881|ref|XP_002736384.1| PREDICTED: glutathione peroxidase 7-like [Saccoglossus kowalevskii]
    MAELSGNGHIMSMENKRNRHYFTTTVVFLGIQTLIILFIYPIVIGIVVVSFQNDIMKLEISIDNLKTHKDLQHASDTEPE
    TEQRCTCSETVSENDVTTQVGSSTLRCCTTDEDSVRMLILRIIDEDRRQRNRKRRPDRTTLTVGAIERLVSNIIKQNKTE
    HAVDTGSNSNTMPSTSIITIAVHLTGRPSLNGFTDSKQLHRQKGYKKVGPWEYNNGQSFARYVQVDDHHIIVPKTGIYYV
    YSQVTLFVNVASE
    CGYTDGHYLSMVKISSDPALSDHFTILAFPCNQFGNQEPKTNDLIEKFAKDNYAVNFPMFSKIDIVG
    DSAHPLFKYLSGVSKKEPTWNFWKFLVDHKGHVINSYGPWISVDSIYPEIIAAVRKARGISHGNEL

    >gi|291233075|ref|XP_002736479.1| PREDICTED: thioredoxin domain containing 4-like [Saccoglossus kowalevskii]
    MITLTMGSHWIAATIFLLTYSQTCSSGSYPNVVSLNKQNFDSIINHNSVVFVNFYADWCRFSQMLKPVFGDAAEVLRKEF
    PQPGEVLFAELDCDTNGEIAAKYHISKYPTLKLFRNGRVAKREYRGQRSRDAFQTYIRNQVKDPINRLSELSDITTKIDE
    KKRNVIAFFNSETSADYVTFKKVASSLRDDCVFYAGIGDAFRPEMTAGNNIMFRPPRTKDQDMLYLGSLTNFDLLLTWSY
    DKCVPLVREITFENGEELTEEGLPFVILFHKPDDVEIIQTFNQVVARELIHEKGSVNFLTADGSKFTHPLHHLGKTVKDL
    PLLSIDSFKHMYLFPDITQLGVSGKLKQFIADLHSGKLHREFHHGPDPTKSPVIQGGVGLPDKTTTKEVKKEEPSVPPES
    SFVKLKPSENRYTILRDEL

    >gi|291233169|ref|XP_002736526.1| PREDICTED: arsenic (+3 oxidation state) methyltransferase-like [Saccoglossus kowalevskii]
    MSCCASDKSSDLTATMDVQSEGEVLDSVKEYYGKVLKTDKDLKTNACTGGMRMPKHIRDALSKVHDEVVTKYYGCGLVIP
    DSLEGCSVLDLGSGSGRDCYTVAQLVGAKGSVTGIDMTDEQLDVANKYKEYHRELFGYSENNVHFVKGYIEKLGEAGLKD
    NTFDVIISNCVVNLSPDKRAVLSEAFRVLKPGGELYFSDVYASKPVPKEVQENKVLWGE
    CISGALYWDDLMKIAKEVGFT
    KPRLVTASHISIDNEKLQSIVGDIKFVSATYRLFKIPADVNYEATQGIYDGTITACEKGFVFDAQNEFKTGDVVKIDSDL
    ATILRSTRFADDFSFQPTTDTDQSKAGCCLPTKENNADPFKFMEISDSCTTGGKCQLGGSCGSGGSKSCGSGGSKSCASG
    GNKSCGSDKSCGTGACGKKEDSCCKSKSSGCC

    >gi|291233899|ref|XP_002736884.1| PREDICTED: FAD-dependent oxidoreductase domain containing 2-like [Saccoglossus kowalevskii]
    MATDKKMPGYFDYIVVGAGPGGCQMGYFLEKKKRSYAILEMNDTPGSFFAVHPRHRTLISINKRFNPFPEPEYNMRHDWN
    SLLSDDPELRFTKYSKELFPHADDLVRYMDDYAKKFNLNIHYNTQVEKIKKLENQAKSGENFSLKTSKGEYRCKVLLVAT
    GARNEKIPEHIKGKELMETY
    CNHSLDTEKYNGKKVFILGNGNSAFEAANHLAGAASIIHIFGDRKLKHAWDTHFVGDLRA
    VNDTVLDMYQLKSLHVYQAVNLLEVAKTDEGYVLTCDDIVPHWREKQGRVRFKLPPYDHVICCTGFNYVDSSIFDDNCKP
    VTKQGGKFPVISNTWESNVDNMYFMGTVMQCSDRKAASGFIHGFRYNIRTLHKFLEERYEEVPYPRELYPLDINTISDKI
    LERVSVSDGIYQMNNVLCHVLAVPDFDPNMKGEVKAELYQDFPKPYVLEDAIKGRFANYKHVFVIVLAYGFEDFGNDGKY
    AMEFAHFPDLNATDCQAFLHPIITYYKNGDLVDELKLPESLVLRFDIPLTLDQNPDVGNNRMRNFINKQLNLKPGQHLYE
    GFFMEKVSERVTPFSEDEKRRVPDLSVFKTCIPFSIDLKPKMT

    >gi|291233901|ref|XP_002736885.1| PREDICTED: FAD-dependent oxidoreductase domain containing 2-like [Saccoglossus kowalevskii]
    MASANKKMPGYFDYIVVGAGPGGCQMGYFLEKKKRSYAILEMNDTPGSFFAVHPRHRTLISINKRFNPFPEPEYNMRHDW
    NSLLSDDPELRFTKYSKELFPHADDLVRYMDDYAKKFNLNIHYNTQVEKIKKLENQAKSGENFSLKTSKGEYRCKVLLVA
    TGARNEKIPKKIKGHELMETY
    CNHSLDTEKYNGKKVFILGNGNSAFEAANHLAGAASIIHIFGDRKIKHAWDTHFVGDLR
    AVNDTVLDMYQLKSLHVYQAVNLIEVEKTDEGFVLTIDDIVPHWRERQGHVRVKLPPYDHVICCTGFNYVDLSMFDDNCK
    PVTKQDNKFPVISNTWESNVDNMYFMGTVMQCSDRKAASGFIHGFRYNIRTLHKFLEERYEEVPYPRELYPLDINTISDK
    ILERVSVSDGIYQMNNVLCHVLAVPDFDPNMKGEVKAELYQDFPKPYVLEDAIKGRFANYKHVFVIVLAYGFEDFGNDGK
    HAMEFAHFPDLNATDCQAFLHPIVTYYKDGELVDELKLPESLVLRFDIPLTLNQNPDVGNNRMRNFINKQLNLKPGQHLY
    EGFFMEKVSERVTPFSEERKEEFQTLAYSSLVFHSAST

    >gi|291233939|ref|XP_002736905.1| PREDICTED: HESB like domain containing 2-like [Saccoglossus kowalevskii]
    MAAPVIRASVRAATGKRRLIPSRAALNLTESAATKIKTLMADKPQVLGVRIGVKTRGCNGLSYTLDYAYEKQKFDEEVIQ
    NGAKVYIDSKAQLTLLGTEMDFVENKLSSEFVFTNPNIKGTCGCGESFNV

    >gi|291234498|ref|XP_002737185.1| PREDICTED: FAD-dependent oxidoreductase domain containing 2-like [Saccoglossus kowalevskii]
    MASENKKMPGQYDYIIVGAGPGGCQMGYFLEKKKRSYAILEMNDLPGSSFAEHPRHRTLISINKRFNPFPEPEYNMRHDW
    NSLLSDDPELLFTKYSKELFPNADDLVRYMNDFAKKFNLNIHYNTRVQKIKKLESQPKSSENFSLQTSKGEYRCKVLLMA
    TGARDEKVPKKIKGHELMETY
    CNHSLDTEKYNGKKVLILGNGNSAFEVANHLAGAASIIHIFGDRKVKHAWDTHFVGDLR
    AVNDTVLDMYQLKSLHVYQAVNLIEVEKTDEGYVCTIDDIVPHWRESQGHVKVKLPPYDHVICCTGFNYVDLTMFDDNCK
    PVTKQDDKFPVISNTWESNIDNMYFMGTVMQCRDRKAASGFIHGFRYNVRTLHKFLEERYEEVPYPRELYPLEINTLSDK
    ILERVSVSDGIYQMNNELCHVIAIPEIDPNMKGEIKAELYQDFPKPYVLETAIKGRFAKYKHVFVIVLAYGFQDFGEDGK
    HAMEFAHFPELNATDCQAFLHPVITYYKDGDLKDELKLPESLMLRFDIPLTLNQNPDVGNNRLRNFINKQLNLKPGQHLY
    EGFFMEKVSDRVTPFTEDEKSRVPDLSVFKRCIPFSIDLKPKLAH

    >gi|291235854|ref|XP_002737866.1| PREDICTED: thiosulfate sulfurtransferase-like [Saccoglossus kowalevskii]
    MTKASTLVNVRWLAEKITSTTNKNLRVLDSSRYPYKNRNPRAEYQKEHIKGALFFDIAACSDVTSKYLNMLPSAQHFADC
    VGNLGISNDTHVVVYDTHKCGIFSAARAWWMFQHFGHDNVSVLNGGLQKWRNEGYPLTDEVTVVEPKKFRASPSNVSDVK
    TFEDIVQNIKDGGFQLVDSRSPELYAIDTPSGDIPGAVNIPFPSIIDENTGEVKSVKELKQLFQDKGIQLDQPITVT
    CRA
    GITACCLILAAKLGGKDDVSLYDGSWSEYSMRKFSTD

    >gi|291235856|ref|XP_002737867.1| PREDICTED: thiosulfate sulfurtransferase-like [Saccoglossus kowalevskii]
    MNRASSLVNVRWLADKIVSGTTKNLRVLDSSRYSSETRDALAEYKKEHIRGALFFDIGACSDVTSPYSNMLPNAQFFADY
    VGNLGISNDTHVVTYDTHECGIFSAARAWWMFQHFGHPNVSVLNGGLQRWIKEGYPLTDEPTVVEPEKFQASVSNMSEVK
    TFEDIVQNIKDGRFQMMDARSPTAFESEEDPKSHIPRSINIHFQNIMDAETGEVKSTELLKKLFQEKNIQLDRPLTAV
    CN
    TGVTACCLLLAAKLCGKDDACLYDGSWSEYSKRINPVGGNGRGKA

    >gi|291235858|ref|XP_002737858.1| PREDICTED: 3-mercaptopyruvate sulfurtransferase-like [Saccoglossus kowalevskii]
    MSKMSPMVGIKWLAEKLSSGATKNFRVLDSSWHLPNTNRIAAQEYPKKHIRGALFFDIDVCSDTTSKYVHMLPSAELFAN
    YVGNLGINNDTHVVVYDNNDNFGLFSAPRVWWMFRHFGHPHVSILDGGLPKWINEGHPVTDEIPTVEPAKFVATANSTEV
    VSFEEMVQNVTDGGFQVMDARAAGRFDGVDPEPRPDIKPGHIPKSISFPFPLILDGDTREVKSLEDIRKIFDEKNISLDK
    PLTAS
    CGSGVSACCLILAANLCGKDDVRLFDGAWVEYYLRADPKDIHVKGQV

    >gi|291235937|ref|XP_002737909.1| PREDICTED: thioredoxin domain containing 5-like [Saccoglossus kowalevskii]
    MAAMVQSGVFRRLVQIALCFLFISISLVKPDDEQKYVLDAEMFAKAVKDKAHFIMFFAPWCGHCKRLQPTWNELAEKYNN
    NEDSEVNLGKVDCTVETALCSEYGVTGYPTLKFFRPGEEAVKYQGKRDAETLEKFMKETLDPSTKEEPEVAATGPPEAKD
    GLYELNAGNFDKHVAKGSHFVKFYAPW
    CGHCKRLAPTWEELAKDSDGKVTINKIDCTSEKPVCDKFEVRGYPTLLFIKDG
    QKIEKYGGARDLDALKSYVEKMQASGKEAPKPEKVKKVEEKQEVKKDEDKPSKVVTLGEDSFETGIGTGLTFVKFFAPW
    C
    GH
    CKRLAPTWEELAEKVASKPNIKIAKVDCTVDKDVCKKAEVRGYPTLILYSNGKKVDDYNKARELDALYKYITERPHDE
    L

    >gi|291236432|ref|XP_002738144.1| PREDICTED: Nucleoredoxin-like protein 2-like [Saccoglossus kowalevskii]
    MDLFVGKTLSNKSQATISGEDALRNKVVGLYFSASWCPPCKMFTPILADVYSELKEKNAPFEIVFISSDRSPQDMKQYMV
    EEHGDWLCVPFGDALVGWAVSRPLFCNDESEQNNSCELIDPNLLSGYSYSPADTSAYFQNGDVITDQGRSEVQTRGPLAF
    KNWLQASNIVQNFSAE

    >gi|291236548|ref|XP_002738201.1| PREDICTED: FAD-dependent oxidoreductase domain containing 2-like [Saccoglossus kowalevskii]
    MASENKKMPGQYDYIIVGAGPGGCQMGYFLEKKKRSYAILEMNDLPGSFFAEHPRHRTLISINKRFNPFPEPEYNMRHDW
    NSLLSDDPELHFTKYSKELFPNADDLVRYMQDFATKFNLNIHYNTRVEKVKKLENQAKSSENFSLQTSKGEYRCRVLLIA
    TGARDEKVPKKIKGHELMETY
    CSHSLDTEKYNGKKVFILGNGNSAFEVANHLAGAASIIHIFGDRKVKHAWDTHFVGDLR
    AVNDTVLDMYQLKSLHVYQAVNVIEVEKTDEGYVLTIDDVVPHWRESQGHVRVKLPPYDHVICCTGFNYVDLSMFDDNCK
    PVTKQDDKFPVVSNTWESNIDNMYFMGTVMQCRDRKAASGFIHGFRYNVRTLHKFLEERYEEVPYPRELYPLEINTLSDK
    ILERVSVSDGIYQMNNELCHVIAIPDFDPNMKGEIKAELYQDFPKPYVLDTAIKGRFDKYKHVFVIVLAYGFQDFGEDGK
    HAMDFAHFPELNATDCQAFLHPVITYYKDGDLKDELKLPESLMLRFDIPLTLNQNPDVGNNRLRNFINKQLNLKPGQHLY
    DGFFMEKVTDRVTPFTEDEKRRVPDLSVFKTCIPFSIDLKPAH

    >gi|291236779|ref|XP_002738316.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MRYCPYAQRSRLALLAKGLEFETVNCNLKTKPDWLFEKNPNGLVPVLEHDGKIVYDSLLINDYLDEVFPGKRQLHPKDPY
    QKVLDRMTLANFMSKASSIRNYYKSKGEDKESLFIITTALERLEHDLKKKGSTYFAGAEPGMVDYNLWPFLEILKNLEIS
    YNENYLNEKIPFLNGYIRDMMTDEAVKSTYISPEIYMRYLNSMLSGNSQYDGLEL

    >gi|291236865|ref|XP_002738363.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MDKTDYEYLVIGGGPAGLQMAYFLEKANKDYIVLERDGGVGSFFVRYPRHRKLISINKKFNYFPEKEYNLRHDWNSLLSD
    EEDLLFTNYTSELFPNADLLVKYMRDYAKKFNLNIRLNTTVTNIHRDPILKGKYRSLYTITEQNGMKYTCKVLLMATGAA
    MPDKPKIEGAEL
    CDTYQKHSLDKKLYENKKVLILGGGNSAFEVADHISDSAALIHMCTRTPVIFSWDSHFVGDLRAVNNN
    ILDMYHLKSLHALRQCDTKQFVKEEDGRFTQTFEMELPHWNPPGTATFTSKGYDSVILATGWKFINIDMFDESCKPETHT
    DGKFIVLDEHWETTVPDMFFIGTAMQSRDHKAASGFIHGFRYNIRTLFHMMDMRYDGGDLAKKIFPSIDATELANFMTHH
    VSISSALYQLGQGFLCDVLVLKPEEAAKSDCSEQMAGVAEYYYELPQAWVLKNDYFMNQAHMIIITIEDSHHMFPSTSAT
    EFFKPGDMNPRDCKCTAFPQGVFYSYRCGKLEEVVHIGGSLVVRADKKIFVGDTNPDRFTNKLKNLFNRQIGIGSGDHYE
    RLFPPEEWEKVYRPWTEEEVEMRKMKEIAMKSRKFECKLGILD

    >gi|291237171|ref|XP_002738513.1| PREDICTED: omega class glutathione-s-transferase 1-like [Saccoglossus kowalevskii]
    MSEKHLSAGSELPPLKKDTLRIYSMRLCPFAYRAILALALKEIEHEVVNVNLKDKPSWFIERNPKGLVPILEINDQIVYE
    SIVCCEYLDEVYPGDQLVAETPYQRAQDKILIDFFSGKVSPLLKSGLEEEKKNDFFQQLDRMENELKKRKTTYFRGEKPG
    FVDIVIWPFFERVENMTVLGGDGLPANRFPLLRTWISQMMDIPAVKNRRESPVIF

    >gi|291237173|ref|XP_002738514.1| PREDICTED: glutathione-S-transferase omega 1-like [Saccoglossus kowalevskii]
    MSEKHLGPGSDLPPLKKDTLRLYGMRFCPCAQRIVLALNLKGIEHEVVNINTKNKPSWFIEKFPTGLVPVLEINDQIVWE
    SVICCVYLDEVYPGYKLVAETPYQRAQDKLLLDLFLTKIARSVHAHYRSYDGLDEEQKALLLESIDKLENELKKRKSPYF
    RGNKPGLLDIVLWPSFERIEGMDVLDGDCLPADRFPLLTSWMDAMMDVPAVKNSLLSADQHRRFYKNLHSAQPLFDELLG


    >gi|291237175|ref|XP_002738505.1| PREDICTED: glutathione-S-transferase omega 1-like [Saccoglossus kowalevskii]
    MSDKHLGADSELPPLKKDTLRIYSMRFCPMAQRTILALGVKGIEHEVVNVNLKKKPSWFIERNPKGLVPILEINDQIVYE
    SVVCCEYLDEVYPGDQLVAETPYQRAQDKILIDFFSGKIVPLMMSRKEVTGLEEEKKNDFFQHLDRMENELKERKSVYFR
    GEKPGLVDIIIWPFFERIEGMNVLGGDSLPGNRFPLLTSWMSQMMEVPAVKNHHVSPEQFRRFYKHYNSPNPLIDEILL

    >gi|291237418|ref|XP_002738635.1| PREDICTED: prostaglandin E synthase 2-like [Saccoglossus kowalevskii]
    MATSMVSRFAGTFHKPVAKYRCIRTQTVIGMCYTFRNSSTETNRPRNHRKTQTISLVAGASAVAFSSYVLLGRKLEAKEQ
    ISKDLQSVTHIQGPANMNDLKLTIFQYHT
    CPFCRKVRAFFDFYGFSYDVVEVNPVLRKEIKFSPYRKVPIVTAKNGDINA
    ENQLNDSSLIVSALHSYMIGENKQLTEILTYFPEMTSENAKGKKVKEYTNKYEIMLGQPQQNMASRKEEKEWRSWVDSVF
    VHTLSPNVYRTPSEAVKAFDYISETGKFSTVEKYIAKYVGAAAMYFISKLLKRKWNLKDDVRQSLYEEADKWMQAVGPDR
    DFMGGDLPNLADLAMYGVLSAIEGFDAFNDLLDNTSIKPWYKKTKQAVASHAGAN

    >gi|291238278|ref|XP_002739058.1| PREDICTED: AGAP010217-PA-like [Saccoglossus kowalevskii]
    MYGDVAAEVKGLGTLVAIDCGANKKLCKKLKVSTESYTLKHYKDGEYHKDYDRQESVKSMTNFMKDPVGDAPWDEDPLAG
    DVRHLGNDNDLRKLLQKEKKPVLLMFYAPW
    CGHCKQLKPEFAEAATELKGEAILAGMDVDKPENYGSRQTFNITGFPTIY
    YFEGGKMKYLYGGERNKAGILTWMRDPQPPKEPEKELGWSDEDNNVVHLLDETFDEFIQEHNSVMVMFYAPW
    CGHCKKMK
    PEYSEAATQLIDEEVDGVLAAVDATVATEVAKRYEVKGYPTVKYFKDGEFAWDFNERLKDKIIEHMRDPQEPPPPPPPEP
    AWSEQETDVHHLTEETFKPFLKKKKHTLVMFYAPW
    CGHCKKAKPEFTSAAETFKDNNKVAYAAVDCTAETEICSTYDVSG
    YPTLKYFNYGKNPQAYMGGRTEQDFIAFMNDPTNPSPAPKEPQEDFFEEIDGGENVYQLTESSFDTFVKERSSVLVMFYA
    PW
    CGHCKKSKPDFAAAATQLDEEGIDAALAAVDATVEKGLQNRFDVTGFPKFKYFRNGAFAFDYSSKRDTQSFVEFMKDP
    KVTPAPPPEPKWSEIPNNIHHLTTDNFDTFVTIKEHVLVMFYAPW
    CGHCKAAKPAYSTTADNFKDDPTKYLAAVDCTENT
    EICTSQEVSGYPTFKLFSNGKFNKDFSGARSVTDFTDFMMQLKSSHKREEL

    >gi|291239109|ref|XP_002739467.1| PREDICTED: thioredoxin domain containing like [Saccoglossus kowalevskii]
    MAAHLSVTLVVTISFVVITNFILESRAEGLGRGFGDDINWKSLDDGLKESKDLGKPLMLIIHKTWCGACKALKPKFAESK
    EIKDLSQKFVMVNVEDNEEPSESKYTPDGGYIPRILFLDSSGSVHTEIINENGNPKYKYYYPEANSVLNSMKKAAELLVE
    TRAGSDEL

    >gi|291239733|ref|XP_002739778.1| PREDICTED: Iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Saccoglossus kowalevskii]
    MTASSSGLGRILTKLCRYNNITGRSQLNKLWSEQLAYPGTSRIHSQNTRTLTTEAQPESASSNAGILLSDRCVKRLQKIG
    ASGEYLRIYVEGGG
    CSGFQYKFDIDTKVEEDDRLFERDGVGLVVDVESLEYLKGSTIDYQEELIRSAFQVVKNPKAEHGC
    SCGASFSLKV

    >gi|291239843|ref|XP_002739831.1| PREDICTED: ERO1-like [Saccoglossus kowalevskii]
    MARILFLISLVFTSICLTFPKNTTSSVNRCFCQLYGEVDDCSCKVDTVDYFNNYKIHPRLVELLEKNFFRFYKVNLHREC
    PFWPDDGQ
    CAFKDCSVHSCTPDELPKGFKPENKYSEEAQQSDSGACESKTNEEIQLGALDTSLSEESKEAFKSWKRHDDD
    QFSFCEMDDEFSTQMEYVDLLINPERYTGYKGASPRRVWNSIYNENCFKPDPDTREYEALLTTSNVKGMCLEKRVFYRMI
    SGLHASINIHLAAKYLIPDAWGGTKWGININEFQSRFDPKSTNGEGPQWLRNLYFTYLVELRAITKIAPLLEKENFYTGD
    KGADFEVKVMISELLSTMKEFPTPFNESKMFQGDKNQALQLKEEFRSHFRNISRIMDCVGCDKCKLWGKLQTQGMGTALK
    ILFSGNIYDTVTGEPAFSLRRTEIVSLFNAFGRLSNSIKLLEEIRNMTKR

    >gi|291239925|ref|XP_002739882.1| PREDICTED: chloride intracellular channel protein 5-like [Saccoglossus kowalevskii]
    MGFYPMANVGFYPMANMGFYPIANMGFYPMANMGFHPMANVGFHPIANVGFYPMANMGFHQWLTWVFTQWLTWGFHPMAN
    MGFHPMANMGFHPMANMGFYPMANMGFYPVANMGFYPVANMGFYPVANMGFHSMSYHLHFSSGFDHSNIAGRDGKSLGD
    C
    PFSQRIFLILCLKKVSFNITTVDMNKKPKRFMDISPGGKIPVLVDGDRVLTDVSEMADYLEQTIPEPSLRSTNKKAMLAG
    IDVFQKFSRFIKNEDPQKDEILRKGLIKELLSLDSFLKSDNSPGCFLDGDTMTQLDCNMLPKLHHIRVASKRFKEFDIPE
    DFEGLRTYLNAAYATEEFKDTLYPDDEVVHGWNKHLGRV

    >gi|291240569|ref|XP_002740183.1| PREDICTED: protein disulfide-isomerase A3-like [Saccoglossus kowalevskii]
    MQKFLSFALLVGLALASDVLELTDDDFEDTVAEQDIILVEFFAPWCGHCKKLAPEYEKAATDLKYSDPSVPLAKVDCTAE
    KDTCSRYGVSGYPTLKVFRDGEASDYNGPRSADGIIDYMKKQAGPTSREAKTVEDIDKLLSGKDLLVVGCFTDDSDAKKE
    FLKFAGSERDNYKFVHTGEQAVLDRLGTENGDIVIFRPTHLQSKFEDSKIKFDGTVKSGNLKKFVKENSLGLCGHMTPDN
    HSQFKKPLCVVYYDVDYRKNTKGTNYWRNRIMKVAKKLSDKKIFFAVANREEFSHEVEANGLTDKSVDLPVVAIVTDEGH
    KYPMQADFTRDGKALEEFVNDYLDGKIEPYLKSEPIPESDDGPVKVIVAKNFQDIVMSEEKDVLIEFYAPW
    CGHCKSLAP
    KYDELAEKLSADDNIVIAKMDATANDVPPPFEVRGFPTLYWVPMNNKPKKYEGGREVDDFMKYIKREATKGLNIPKKAKK
    DKEEL

    >gi|291240754|ref|XP_002740267.1| PREDICTED: CG7430-like [Saccoglossus kowalevskii]
    MSLASWCRVSAHLARAHRRHFLKGHLPLIGIANSRCFSEAKSEVDLCVIGSGPGGYVAAIKAAQLGMKTVCVEKNATLGG
    T
    CLNVGCIPSKALLNNSHFYHLVHSGDFKNRGIETGDLKLNLDKMMEQKAGAVTALTGGIAHLFKQNKVTRLSGYGRITG
    PNEVAVFDTTQHHVKEVVKAKNILIATGSEVTPFPGIEIDETQIISSTGALSLEKVPEKMIVIGAGVIGVELGSVWSRLG
    SQVTAVEFLGHVGGLGIDMEISKNFKRILEKQKMKFKLNTKVTAASKTPDGKVKVSVESVKDSSKKDELECDVLLVCIGR
    RPYTETLGLEEIGIETDNRGRIPVNGRFQTSVPSIFAIGDCIQGPMLAHKAEDEGILCVEGIGGAPVHIDYNCVPSVIYT
    HPEVAWVGKTEEQLKEEGVQYNVGKFPFMANSRAKTNADTDGLVKILSDKTSDRMLGAFIIGSVAGEMINEAALAMEYGA
    SCEDIARVCHAHPTCSEAFREANLAAWTGKAINF

    >gi|291240915|ref|XP_002740360.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MESWSPYLTKFKRGIGNWWQVIYVLGAVVGAFISALCSGALAIVPGISLVSSFFGGFIMLFGSRLGSGCTSGHGLSGMGL
    LALLSFVAVAMMFVGGSTLGFFFYALDVSAGVLDYSTF

    >gi|291241091|ref|XP_002740444.1| PREDICTED: glutaredoxin 5-like [Saccoglossus kowalevskii]
    MSIFVRMTQTLGRQRLLSHRFYCIAASGSKEHIEGLVKKDPIVVFMKGVPEKPMCGFSNAVVQILRMHGVDKYASYNVLE
    DEDLRQGIKDFSNWPTIPQVYMNSEFVGGCDILIQMHQEGELIEELKKLGIRSVLLDADNNKE

    >gi|291241181|ref|XP_002740489.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii]
    MNHLHRVTHLLLFVVLFVNFVVCDDYYEILGIQRDANAKDIRRAFKKIALKEHPDKNPDDPLAHEKFLKINRAYEVLKDE
    ELRKKYDRFGEEGLNEQQGQWGQKYESWNFYKTEFGLYDEDPEVVTLSKSDFEHSVFGQDIWFVNFYSPR
    CHHCHDLAPT
    WRKFAKEMEGVIRIGAVNCWDDNPLCTAQGIMSYPTLKIYPRNEPYSGAKTLSSLVRHALRQVKAVVQDIWAGNFKQVLT
    SKDLKSHPLLMIYCGAAKGSSDDDTSELVFSECLTKDERLKVAAILDKTVTVAHVDCVASSTLCQAMGVAGNILKFYDKA
    VQCKKDRGTYVDIGEPKDIADEVLKMLPDIQYIDDMQLKAIRNSSESPWLVHFVANSDQVETEMRKLPYLLDEIKVRRMM
    SQDVAAFARESSNSAVHMLDPSYFPNHVINSGELWFVDFFSPH
    CPPCKQLIPEWRKAAKELLGKVKLGTVDCTAHSALCN
    EYNVRSYPTIMLYNQSTPHLYSGSNTAKDLVDFVQDILTPLVVALTPDGFDSLVKSKTKKDQMWLVDFYAPW
    CGPCQALA
    PEWRKLAKMLNGTAQLGSVDCVKWNDLCSRNGIGSYPTIKMYPHGKSGLAGSTQYTGWMRDAISIQGWVYSYLPSVATTL
    DQNNFVRNVIQDNEPWLVYFYAGPW
    CGPCTMFMPQFENAVRSLEDRVHAGKMNCDHNQGACMQSGVNSYPSIRLYMGARK
    KGGSQNYAGEFITHMQGVDFIINYVKGRIPENKLKKKIPRDEL

    >gi|291241944|ref|XP_002740869.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    METYCSHSLDTEKYNGKKVFILGNGNSAFEAANHLAGAASIIHIFGDRKVKHAWDTHFVGDLRAVKDTVLDMYQLKSLHV
    YQAVNVDRSGETMKVTFSPLTILSTMAGKSRPC

    >gi|291242043|ref|XP_002740918.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MQILNNGVISLGISIGSASGLFETMAELDEPRSSSEIAEAACLKERYVREWLGAMVTSNIVEVDPDRNTYFLPLHRAKSL
    SRKKGDGSVATFSDGVPLLTGVFQDILDCMKKDGPKGVSYSRYPTYTKYSDEMASLKLQKLPQGYLFTSEEVQSKLVPGA
    VACDVGCGSGIPVCTLAQLYPACKFYGVDLSEKAITAAQNRALEMKLTNVTFIQCDASSMAEDWIEKFDIVVTMAVVHDL
    PRPDLVHHEIMRILKDDGIYIMEDIDCHSNHSDNIGNPRAALYYTWSMFR
    CMATSLYFDNSFGLGAMWGKERAIEFLEKM
    GLECFSSYSLDNVSRIVYLSKKKMLAD

    >gi|291243065|ref|XP_002741427.1| PREDICTED: EIP28, putative-like [Saccoglossus kowalevskii]
    MKYSEVAVFALLLMVTMTTVAIDDEEGCDESESLLLKYTFEPSGLKYTEPDVKTKKATFAMGCFWGVESTFGAAPGVVRV
    KCGYTGGSKLKPTYTNLGDHTESVEIEYDPTKTTYRQLLDIFWKTHDPTEWNKSQYKSAVYAHDEEQEIWAQETLLEEQK
    NYGSKVVTDVLPAGTFYDAENYHQKYFLRFHDNLLQSLGMGDGELLTSYRASRLLGYITGNGSVEEFNKEVKNLALSNEQ
    ANYIRKIIRNKNSGSCAKKSP

    >gi|291243820|ref|XP_002741798.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii]
    MSKPLSDILGNRLINRANETVDPTSLAGVGKLIGLYFSAHWCPPCRGFTPKLVEFYNNFKKSENGDKLEIIFVSSDRDSA
    SFEEYYGEMPWLALPFDERQRKDKLSKKFKIQGIPTFVLMDSTSGRVVTDDGRNVVMDDPNGNNYPWKPKPFSEIIGTNF
    VNNKKEETSIECMKDKILCIYFSAHW
    CPPCKAFTPVLIELYKKLKDDHKAMEIIFVSSDRSQESFDQYFSTMPWLAVPYG
    DTRIEQLSKLFQVSGIPSLVVMDTNGEVITKDGRSSASSDPDGKDFPWRPKAVNNLTGYAAGILNEDACLILFTEGEEQD
    ILAATDIVQPVAEEILKKYKALEDEPPLQFFIGGDDEIVDSVRDFCSMDDKVPLLTILDIPEQFIYIYEAEDITPETVYK
    FVQDYIAGVLEGTPLRG

    >gi|291244574|ref|XP_002742170.1| PREDICTED: dihydropyrimidine dehydrogenase-like [Saccoglossus kowalevskii]
    MALSKDTADIESLLSLNPRTSQHAIVVPTAATKKNKKHWKRNDTSKKCGSCDTLKNNFDDIKHTTLSERGALREAARCLK
    CADAPCQKSCPTQLDIKAFISSIATKNYYGAAKAIFSDNPLGLTCGMVCPTSDLCVGGCNLFASEEGPINIGGLQQFATE
    MFQKMRIPQIRDPSLPALDDLPESYQSKISLIGCGPASISCATFLARLGYSNIVVYEKQEYVGGLSSSEIPQFRLPFDVV
    SFEVEQMKDLGVKVEFGKGLGINGMSLQSLKENGSKVVFIGIGMPQPKLIPIFHDLAMKHGFYTSKHFLPLVAAASKAGM
    CS
    CKSSLPEIHGNVIVLGAGDTAFDCATSALRCGARRVFVVFRKGFTTIRAVPEEMELAREEKCEFMPFVAPRKVLVKDG
    RITGLELCRTEQQDDGSWFEDEEQTVRLKADFIISAFGSSLTDDIVKSAMSPIKFNKWGLPDVNHDTMQTSEEWVFCGGD
    LAGVAQTTVESVNDGKQAAWYIHQYLQKLHSASVPSKPQLPKFYTPIDSVDISVEVCGLKFSNPFGLASAPPTTTSAMIR
    RGFEAGWSFALTKTFSLDKDIVTNVSPRIVRGTTSGHVYGPGQGSFLNIELISEKTAAYWCQTVTELKADFKDKIIISSI
    MCSYNKEDWTKLAKMAEDSGADALELNLSCPHGMGERGMGLACGQDAELVRNICRWVRAAVKIPFFAKLTPNVTDIVVIA
    KAAYEGKADGVTATNTVSGLMGLKSNGTAWPAVGKEKLTTYGGVSGNAIRPIALRAVSAIGRALPGFPILATGGIDSADA
    GLQFLQSGASLLQVGSAVQNQDFTVIEDYITGLKTLMYLKSIDELSDWDGQSPPTLRHQLGKPVPKLNEIIGKGIPNFGP
    YREKRAEIVAANKATIDLLAEDQKPSPQRPPYQPKKSIPTVKEMIGRALSKIGAYGDLDNTQQYVAIIDEEMCINCGKCY
    MTCNDSGYQAIVFDPETHLPRINADCTGCTLCVSVCPILDCITMIPRQIPHVINRGVPLSVSSVA

    >gi|291244608|ref|XP_002742188.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
    MVTSDIVEVYPERNTYFLPPHRVKSLSRKRGDGCVAIASDGVPLIAGVFQDILACMKKDGPAGVPYSRYPTHAKFSDEMA
    SLKVQKLPKGYLFSSEIIQAKLVAEAVVCEIGCGSGMHTCTLAQLYPACEFYGIDISEKTIAAAQTRALEMKLSNVTFLQ
    CDASNMADEWKSKFDIVFTMDVVHDLPRPDLVHYEIIRIMKDDGIYIMEDPDYHSNHADNIGIPLAALNYTWSLFR
    CLAT
    SLYFDNSFGLGVMWGRERVLEFLEKTGLECFSSYSLDKTENIIYLSRKKMSGD