Saccharomyces cerevisiae

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|6319407|ref|NP_009489.1| Prx1p [Saccharomyces cerevisiae S288c]
    MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDADTTVGKINFYDYLGDSWGVL
    FSHPADFTPV
    CTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDA
    EGFKNINDGSLKTVRSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDE
    AKAKFGQFNEIKPYLRFTKSK

    >gi|6319488|ref|NP_009570.1| Grx7p [Saccharomyces cerevisiae S288c]
    MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFDNSGNAPGTHQSVHDTVNTQDKEAEEVDKNS
    GDAEFDAAAEYNKIMEQSPMIVFSKTG
    CPYSKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVII
    GGTSRGGYTEIAELHKNDELLDSFKKWSDGAFTVKANSQSESA

    >gi|6319721|ref|NP_009803.1| Gpx2p [Saccharomyces cerevisiae S288c]
    MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQIT
    EFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLL
    SK

    >gi|6319806|ref|NP_009887.1| Pdi1p [Saccharomyces cerevisiae S288c]
    MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVE
    KNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLPAYLANETFVT
    PVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDFKLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPY
    FGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGRHAGNLNMKEQFPLFAIHDMT
    EDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL
    YYAPW
    CGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFI
    KENGHFDVDGKALYEEAQEKAAEEADADAELADEEDAIHDEL

    >gi|6319814|ref|NP_009895.1| Grx1p [Saccharomyces cerevisiae S288c]
    MVSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYI
    NGKHIGGNDDLQELRETGELEELLEPILAN

    >gi|6319816|ref|NP_009897.1| Mxr2p [Saccharomyces cerevisiae S288c]
    MNKWSRLYVITVRRTFPGRRNIVLTQYWNKSKKMSDESNDVKWNDALTPLQLMVLRDKATERPNTGAYLHTNESGVYHCA
    NCDRPLYSSKAKFDARCGWPAFYEEVSPGAITYHRDNSLMPARVEICCARCGGHLGHVFEGEGWKQLLNLPKDTRH
    CVNS
    ASLNLKKD

    >gi|6319925|ref|NP_010006.1| Trx3p [Saccharomyces cerevisiae S288c]
    MLFYKPVMRMAVRPLKSIRFQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKC
    DVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL

    >gi|93117370|ref|NP_010081.2| Mgt1p [Saccharomyces cerevisiae S288c]
    MKELLYYTFIETEVTGAFLVFREKTQNLVFASLGNDKLFLLGKVEGFLKKHEKQDTMYDLQELKEAETYKKSIENYTICL
    ENKMPLPSGAIPFEFLFGTDFQRKVWNELLNVEHGHVVTYGDIAKRIGKPTAARSVGRACGSNNLALLVP
    CHRIVGSNRK
    LTGYKWSCKLKEQLLNNEKENSLSLSRL

    >gi|6320193|ref|NP_010274.1| Grx6p [Saccharomyces cerevisiae S288c]
    MIPSNKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYAAMPTSTTNKGSSEVDEEINE
    IKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYSLILDLSPIIIFSKST
    CSYSKGMKELLENEYQFIPNYYIIE
    LDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN

    >gi|6320303|ref|NP_010383.1| Grx3p [Saccharomyces cerevisiae S288c]
    MCSFQVPSAFSFNYTSYCYKRHQARYYTAAKLFQEMPVIEINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFE
    AISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCKNSVNSGSSQTHTMENA
    NVNEGSHNDEDDDDEEEEEETEEQINARLTKLVNAAPVMLFMKGSPSEPK
    CGFSRQLVGILREHQVRFGFFDILRDESVR
    QNLKKFSEWPTFPQLYINGEFQGGLDIIKESLEEDPDFLQHALQS

    >gi|6320389|ref|NP_010469.1| Plp1p [Saccharomyces cerevisiae S288c]
    MEDKLDRYYTNVLSNAEKDKHTTVDSDDKSSGEENLDELLNELDRELDEDHEFLSAYRSERLQQISDHLKQVKKNVEDDG
    YGRLQCIDNEADAIQICTKTTMVVIHFELETFGK
    CQYMNEKLENLAKRYLTTRFIKVNVQTCPFLVNKLNIKVLPFVVGY
    KNGLEKVRYVGFSKLGNDPNGFDIRRLEQSLAHSGVIEDTFEIRKHSSVNTERFASTNHDRSESDSDLDI

    >gi|6320560|ref|NP_010640.1| Trr1p [Saccharomyces cerevisiae S288c]
    MVHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGT
    EIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISA
    CAVCDGAVPIFRNKPLAVI
    GGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLP
    VSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDAEKYLTSLE

    >gi|6320598|ref|NP_010678.1| Uba2p [Saccharomyces cerevisiae S288c]
    MPRETSLVTIIGEDSYKKLRSSRCLLVGAGGIGSELLKDIILMEFGEIHIVDLDTIDLSNLNRQFLFRQKDIKQPKSTTA
    VKAVQHFNNSKLVPYQGNVMDISTFPLHWFEQFDIIFNALDNLAARRYVNKISQFLSLPLIESGTAGFDGYMQPIIPGKT
    ECFECTKKETPKTFPV
    CTIRSTPSQPIHCIVWAKNFLFNQLFASETSGNEDDNNQDWGTDDAEEIKRIKQETNELYELQK
    IIISRDASRIPEILNKLFIQDINKLLAIENLWKTRTKPVPLSDSQINTPTKTAQSASNSVGTIQEQISNFINITQKLMDR
    YPKEQNHIEFDKDDADTLEFVATAANIRSHIFNIPMKSVFDIKQIAGNIIPAIATTNAIVAGASSLISLRVLNLLKYAPT
    TKYTDLNMAFTAKASNLSQNRYLSNPKLAPPNKNCPVCSKVCRGVIKLSSDCLNKMKLSDFVVLIREKYSYPQDISLLDA
    SNQRLLFDYDFEDLNDRTLSEINLGNGSIILFSDEEGDTMIRKAIELFLDVDDELPCNTCSLPDVEVPLIKANNSPSKNE
    EEEKNEKGADVVATTNSHGKDGIVILDDDEGEITIDAEPINGSKKRPVDTEISEAPSNKRTKLVNEPTNSDIVELD

    >gi|6320661|ref|NP_010741.1| Tsa2p [Saccharomyces cerevisiae S288c]
    MVAEVQKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVLFASTDSEYSL
    LAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEGIALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQ
    WTDKNGTVLPCNWTPGAATIKPDVKDSKEYFKNANN

    >gi|6320720|ref|NP_010801.1| Grx2p [Saccharomyces cerevisiae S288c]
    METNFSFDSNLIVIIIITLFATRIIAKRFLSTPKMVSQETVAHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKS
    KALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILKPVFQ

    >gi|6320726|ref|NP_010806.1| Eug1p [Saccharomyces cerevisiae S288c]
    MQVTTRFISAIVSFCLFASFTLAENSARATPGSDLLVLTEKKFKSFIESHPLVLVEFFAPWCLHSQILRPHLEEAASILK
    EHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGRIFDGQVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENA
    TLPVVINRGLTGLNETYQEVALDLAEDYVFLSLLDSEDKSLSIHLPNTTEPILFDGNVDSLVGNSVALTQWLKVVILPYF
    TDIEPDLFPKYISSNLPLAYFFYTSEEELEDYTDLFTQLGKENRGQINFIALNSTMFPHHVRFLNMREQFPLFAIHNMIN
    NLKYGLPQLPEEEYAKLEKPQPLDRDMIVQLVKDYREGTAKPIVKSEEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKY
    YATW
    CIHSKRFAPIYEEIANVLASDESVRDKILIAEVDSGANDILSFPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFE
    FIKESGTHHIDGQAIYDKLHQAKDSEVSTEDTVHDEL

    >gi|6320881|ref|NP_010960.1| Mxr1p [Saccharomyces cerevisiae S288c]
    MSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYLNDRIVDCKVGYANGEESKKDSPSSVSYKRVCGGDTDFAEVLQV
    SYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQPKWGNKIATVIEPIKNFYDAE
    EYHQLYLDKNPQGYACPTHYLREM

    >gi|6321022|ref|NP_011101.1| Grx4p [Saccharomyces cerevisiae S288c]
    MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLSIDADEHPEISDLFEIAAVPY
    FVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAKGPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVML
    FMKGSPSEPK
    CGFSRQLVGILREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQ
    HALQ

    >gi|14318501|ref|NP_116635.1| Lpd1p [Saccharomyces cerevisiae S288c]
    MLRIRSLLNNKRAFSSTVRTLTINKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNS
    HLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVK
    EDHILDVKNIIVATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIG
    ASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIGL
    EVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEMLKTGHGHVNYNNIPSVMYSHPEVAWVGKTEEQL
    KEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPT
    LSEAFKEANMAAYDKAIHC

    >gi|6681846|ref|NP_011543.2| Erv1p [Saccharomyces cerevisiae S288c]
    MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLAGTGALTGEASELMPGSRTYR
    KVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYP
    CNWCAKDFEKYIRENAPQVESREELGRWMCE
    AHNKVNKKLRKPKFDCNFWEKRWKDGWDE

    >gi|6321648|ref|NP_011725.1| Trx2p [Saccharomyces cerevisiae S288c]
    MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYK
    GGKEVTRVVGANPAAIKQAIASNV

    >gi|6321898|ref|NP_011974.1| Trr2p [Saccharomyces cerevisiae S288c]
    MIKHIVSPFRTNFVGISKSVLSRMIHHKVTIIGSGPAAHTAAIYLARAEMKPTLYEGMMANGIAAGGQLTTTTDIENFPG
    FPESLSGSELMERMRKQSAKFGTNIITETVSKVDLSSKPFRLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQQ
    GISA
    CAVCDGAVPIFRNKPLAVIGGGDSACEEAEFLTKYASKVYILVRKDHFRASVIMQRRIEKNPNIIVLFNTVALEAK
    GDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDIVKGQVDEEETGYIKTVPGSSLTSVPGFFAAGDVQDSRYRQA
    VTSAGSGCIAALDAERYLSAQE

    >gi|6321903|ref|NP_011979.1| Uba4p [Saccharomyces cerevisiae S288c]
    MNDYHLEDTTSELEALRLENAQLREQLAKREDSSRDYPLSLEEYQRYGRQMIVEETGGVAGQVKLKNTKVLVVGAGGLGC
    PALPYLAGAGVGQIGIVDNDVVETSNLHRQVLHDSSRVGMLKCESARQYITKLNPHINVVTYPVRLNSSNAFDIFKGYNY
    ILDCTDSPLTRYLVSDVAVNLGITVVSASGLGTEGQLTILNFNNIGPCYRCFYPTPPPPNAVTS
    CQEGGVIGPCIGLVGT
    MMAVETLKLILGIYTNENFSPFLMLYSGFPQQSLRTFKMRGRQEKCLCCGKNRTITKEAIEKGEINYELFCGARNYNVCE
    PDERISVDAFQRIYKDDEFLAKHIFLDVRPSHHYEISHFPEAVNIPIKNLRDMNGDLKKLQEKLPSVEKDSNIVIL
    CRYG
    NDSQLATRLLKDKFGFSNVRDVRGGYFKYIDDIDQTIPKY

    >gi|6322180|ref|NP_012255.1| Dot5p [Saccharomyces cerevisiae S288c]
    MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDVNELEIGDPIPDLSLLNEDND
    SISLKKITENNRVVVFFVYPRASTPG
    CTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFI
    GLLGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE

    >gi|6322186|ref|NP_012261.1| Eps1p [Saccharomyces cerevisiae S288c]
    MKMNLKRLVVTFFSCITFLLKFTIAAAEPPEGFPEPLNPTNFKEELSKGLHIIDFYSPYCPHCKHLAPVWMETWEEFKEE
    SKTLNITFSQVNCIESADLCGDENIEYFPEIRLYNPSGYIKSFTETPRTKESLIAFARRESMDPNNLDTDLDSAKSESQY
    LEGFDFLELIAGKATRPHLVSFWPTKDMKNSDDSLEFKNCDKCHEFQRTWKIISRQLAVDDINTGHVNCESNPTICEELG
    FGDLVKITNHRADREPKVALVLPNKTSNNLFDYPNGYSAKSDGYVDFARRTFTNSKFPNITEGELEKKANRDIDFLQERG
    RVTNNDIHLVFSYDPETVVIEDFDILEYLIEPLSKIPNIYLHQIDKNLINLSRNLFGRMYEKINYDASQTQKVFNKEYFT
    MNTVTQLPTFFMFKDGDPISYVFPGYSTTEMRNIDAIMDWVKKYSNPLVTEVDSSNLKKLISFQTKSYSDLAIQLISSTD
    HKHIKGSNKLIKNLLLASWEYEHIRMENNFEEINERRARKADGIKKIKEKKAPANKIVDKMREEIPHMDQKKLLLGYLDI
    SKEKNFFRKYGITGEYKIGDVIIIDKSNNYYYNKDNFGNSLTSNNPQLLREAFVSLNIPSKALYSSKLKGRLINSPFHNV
    LSFLDIIHGNGMPGYLIVIVLFIAILKGPSIYRRYKVRKHYRAKRNAVGILGNMEKKKNQD

    >gi|6322228|ref|NP_012303.1| Hyr1p [Saccharomyces cerevisiae S288c]
    MSEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTIIGFPCNQFGHQEPGSDEEIAQ
    FCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLRGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLK
    EVE

    >gi|6322639|ref|NP_012712.1| Uba1p [Saccharomyces cerevisiae S288c]
    MSSNNSGLSAAGEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQF
    FLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLF
    GNTFVDLGDEFTVLDPTGEEPRTGMVSDIEPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI
    GSVKEYGEYKKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDAN
    ELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDP
    KNFPRNEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLN
    RQFLFRPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYR
    KPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPL
    CTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNF
    VEQTLKQSGDVKGVLESISDSLSSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEF
    DIYNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQ
    LVSSLPDPSTLAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLE
    LYKLIDNKTDIEQYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG
    VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFITIHL

    >gi|6322826|ref|NP_012899.1| Gpx1p [Saccharomyces cerevisiae S288c]
    MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINK
    FCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLN
    QPPEEQI

    >gi|6323001|ref|NP_013073.1| Isa1p [Saccharomyces cerevisiae S288c]
    MINTGRSRNSVLLAHRFLSTGGFWRGGTNGTMSRTINNVNPFKLKFIPKTVPAAADSVSPDSQRPGKKPFKFIVSNQSKS
    SKASKSPKWSSYAFPSRETIKSHEEAIKKQNKAIDEQIAAAVSKNDCSCTEPPKKRKRKLRPRKALITLSPKAIKHLRAL
    LAQPEPKLIRVSARNRG
    CSGLTYDLQYITEPGKFDEVVEQDGVKIVIDSKALFSIIGSEMDWIDDKLASKFVFKNPNSKG
    TCGCGESFMV

    >gi|6323072|ref|NP_013144.1| Trx1p [Saccharomyces cerevisiae S288c]
    MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKN
    GKEVAKVVGANPAAIKQAIAANA

    >gi|6323138|ref|NP_013210.1| Ahp1p [Saccharomyces cerevisiae S288c]
    MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKE
    KEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNP
    GTDVTVSSVESVLAHL

    >gi|6323396|ref|NP_013468.1| Grx8p [Saccharomyces cerevisiae S288c]
    MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKWRIAFQKVVGSRNLPTIVVNG
    KFWGTESQLHRFEAKGTLEEELTKIGLLP

    >gi|6323505|ref|NP_013576.1| Ero1p [Saccharomyces cerevisiae S288c]
    MRLRTAIATLCLTAFTSATSNNSYIATDQTQNAFNDTHFCKVDRNDHVSPSCNVTFNELNAINENIRDDLSALLKSDFFK
    YFRLDLYKQCSFWDANDGL
    CLNRACSVDVVEDWDTLPEYWQPEILGSFNNDTMKEADDSDDECKFLDQLCQTSKKPVDIE
    DTINYCDVNDFNGKNAVLIDLTANPERFTGYGGKQAGQIWSTIYQDNCFTIGETGESLAKDAFYRLVSGFHASIGTHLSK
    EYLNTKTGKWEPNLDLFMARIGNFPDRVTNMYFNYAVVAKALWKIQPYLPEFSFCDLVNKEIKNKMDNVISQLDTKIFNE
    DLVFANDLSLTLKDEFRSRFKNVTKIMDCVQCDRCRLWGKIQTTGYATALKILFEINDADEFTKQHIVGKLTKYELIALL
    QTFGRLSESIESVNMFEKMYGKRLNGSENRLSSFFQNNFFNILKEAGKSIRYTIENINSTKEGKKKTNNSQSHVFDDLKM
    PKAEIVPRPSNGTVNKWKKAWNTEVNNVLEAFRFIYRSYLDLPRNIWELSLMKVYKFWNKFIGVADYVSEETREPISYKL
    DIQ

    >gi|6323613|ref|NP_013684.1| Tsa1p [Saccharomyces cerevisiae S288c]
    MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSL
    LAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQ
    WTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK

    >gi|6323622|ref|NP_013693.1| Ost6p [Saccharomyces cerevisiae S288c]
    MKWCSTYIIIWLAIIFHKFQKSTATASHNIDDILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRGTNSNGMSCQL
    CHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENA
    ENTLQFGDFLAKILNISITVPQAFNVQEFVYYFVACMVVFIFIKKVILPKVTNKWKLFSMILSLGILLPSITGYKFVEMN
    AIPFIARDAKNRIMYFSGGSGWQFGIEIFSVSLMYIVMSALSVLLIYVPKISCVSEKMRGLLSSFLACVLFYFFSYFISC
    YLIKNPGYPIVF

    >gi|6324484|ref|NP_014553.1| Mpd2p [Saccharomyces cerevisiae S288c]
    MKLHGFLFSVLSTCVVILPALAYSEAVTMVKSIEQYFDICNRNDSYTMIKYYTSWCQHCKTLAPVYEELGELYAKKANKD
    DTPINFLEVNCEFFGPTLCTDLPGFPIIELVKPRTKPLVLPKLDWSSMKFHERLWQRIKTWFNNPKYQLDTSRVVRFEGS
    RNLKSLSNFIDTVRSKDTEERFIEHIFDDSRNCNEELRSQQLLCKAGKEYYSDTLSKLYGDVNGLEKERRRLEALIKQNG
    DDLSKEVKEKLKIIRLQLSLLSHIEDQLEDTSSHDEL

    >gi|6324659|ref|NP_014728.1| Ost3p [Saccharomyces cerevisiae S288c]
    MNWLFLVSLVFFCGVSTHPALAMSSNRLLKLANKSPKKIIPLKDSSFENILAPPHENAYIVALFTATAPEIGCSLCLELE
    SEYDTIVASWFDDHPDAKSSNSDTSIFFTKVNLEDPSKTIPKAFQFFQLNNVPRLFIFKPNSPSILDHSVISISTDTGSE
    RMKQIIQAIKQFSQVNDFSLHLPMDWTPIITSTIITFITVLLFKKQSKLMFSIISSRIIWATLSTFFIICMISAYMFNQI
    RNTQLAGVGPKGEVMYFLPNEFQHQFAIETQVMVLIYGTLAALVVVLVKGIQFLRSHLYPETKKAYFIDAILASFCALFI
    YVFFAALTTVFTIKSPAYPFPLLRLSAPFK

    >gi|6324825|ref|NP_014894.1| Tum1p [Saccharomyces cerevisiae S288c]
    MPLFDLISPKAFVKLVASEKVHRIVPVDATWYLPSWKLDNKVDFLTKPRIPNSIFFDIDAISDKKSPYPHMFPTKKVFDD
    AMSNLGVQKDDILVVYDRVGNFSSPRCAWTLGVMGHPKVYLLNNFNQYREFKYPLDSSKVAAFSPYPKSHYESSESFQDK
    EIVDYEEMFQLVKSGELAKKFNAFDARSLGRFEGTEPEPRSDIPSGHIPGTQPLPYGSLLDPETKTYPEAGEAIHATLEK
    ALKDFHCTLDPSKPTI
    CSCGTGVSGVIIKTALELAGVPNVRLYDGSWTEWVLKSGPEWIAENRD

    >gi|6324859|ref|NP_014928.1| Rdl1p [Saccharomyces cerevisiae S288c]
    MWKAVMNAWNGTESQSKNVSNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPASINVPYRSHPDAFALDPLEFE
    KQIGIPKPDSAKELIFY
    CASGKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL

    >gi|6324860|ref|NP_014929.1| Rdl2p [Saccharomyces cerevisiae S288c]
    MFKHSTGILSRTVSARSPTLVLRTFTTKAPKIYTFDQVRNLVEHPNDKKLLVDVREPKEVKDYKMPTTINIPVNSAPGAL
    GLPEKEFHKVFQFAKPPHDKELIFL
    CAKGVRAKTAEELARSYGYENTGIYPGSITEWLAKGGADVKPKK

    >gi|6324862|ref|NP_014931.1| Mpd1p [Saccharomyces cerevisiae S288c]
    MLFLNIIKLLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVV
    QVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVKKF
    VRIDTLGSLLRKSPKLSVVLFSKQDKISPVYKSIALDWLGKFDFYSISNKKLKQLTDMNPTYEKTPEIFKYLQKVIPEQR
    QSDKSKLVVFDADKDKFWEYEGNSINKNDISKFLRDTFSITPNEGPFSRRSEYIAYLKTGKKPIKKNHSSSGNKHDEL

    >gi|6325166|ref|NP_015234.1| Glr1p [Saccharomyces cerevisiae S288c]
    MLSATKQTFRSLQIRTMSTNTKHYDYLVIGGGSGGVASARRAASYGAKTLLVEAKALGGTCVNVGCVPKKVMWYASDLAT
    RVSHANEYGLYQNLPLDKEHLTFNWPEFKQKRDAYVHRLNGIYQKNLEKEKVDVVFGWARFNKDGNVEVQKRDNTTEVYS
    ANHILVATGGKAIFPENIPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECI
    QNTITDHYVKEGINVHKLSKIVKVEKNVETDKLKIHMNDSKSIDDVDELIWTIGRKSHLGMGSENVGIKLNSHDQIIADE
    YQNTNVPNIYSLGDVVGKVELTPVAIAAGRKLSNRLFGPEKFRNDKLDYENVPSVIFSHPEAGSIGISEKEAIEKYGKEN
    IKVYNSKFTAMYYAMLSEKSPTRYKIVCAGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEELV
    TMR

    >gi|6325198|ref|NP_015266.1| Grx5p [Saccharomyces cerevisiae S288c]
    MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKF
    AAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEEAQALVPEEEEETKDR

    >gi|6325296|ref|NP_015362.1| Erv2p [Saccharomyces cerevisiae S288c]
    MKQIVKRSHAIRIVAALGIIGLWMFFSSNELSIATPGLIKAKSGIDEVQGAAAEKNDARLKEIEKQTIMPLMGDDKVKKE
    VGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYP
    CGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYL
    KKDIYDCATILEDYDCGCSDSDGKRVSLEKEAKQHG

    >gi|6325323|ref|NP_015391.1| Uba3p [Saccharomyces cerevisiae S288c]
    MDCKILVLGAGGLGCEILKNLTMLSFVKQVHIVDIDTIELTNLNRQFLFCDKDIGKPKAQVAAQYVNTRFPQLEVVAHVQ
    DLTTLPPSFYKDFQFIISGLDAIEPRRFINETLVKLTLESNYEICIPFIDGGTEGLKGHVKTIIPGITACWECSIDTLPS
    QQDTVPM
    CTIANNPRCIEHVVEYVSTIQYPDLNIESTADMEFLLEKCCERAAQFSISTEKLSTSFILGIIKSIIPSVSTT
    NAMVAATCCTQMVKIYNDLIDLENGNNFTLINCSEGCFMYSFKFERLPDCTVCSNSNSN

    >gi|6320492|ref|NP_010572.1| Ydr286cp [Saccharomyces cerevisiae S288c]
    MLRAFRCSIHTSRVLLHDAGVKLTFFSKPNCGLCDQAKEVIDDVFERKEFHNKAVSLEIVNITDRRNAKWWKEYCFDIPV
    LHIEKVGDPKSCTKILHFLEEDDISDKIRRMQSR