R norvegicus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218563682|ref|NP_037159.3| selenoprotein W [Rattus norvegicus]
    MRRAAMALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRK
    LVTAIKAALAQCQ

    >gi|261862293|ref|NP_001159868.1| selenoprotein V [Rattus norvegicus]
    MNNKARNPAPSSVRANTPSRTPTPVRTATPVRASTPAHNRSPVRTSIRVRTPANPVPIRFPTPAPAPAPTPTPAPTPAPV
    PAAAPVRTPAPVRASIQGRSFPTISPVRFLRNLALPAAQPLSSGGAGSLSKDLTLAQKQKPSIHSLAEAIQGPFPVLTPS
    ASSETHGSIPDPAPPTDSLASTAMASSTLDPIPGPKPTLEFLASPLKETPDLGKLSTISPAQNFVSTKEVPSTSEDVPTA
    NRILIRVMY
    CGLCSYGLRYILLKKTLEHQFPNLLEFEEERATQVTGEFEVFVDGKLIHSKKKGDGFVDETSLKKLVGAID
    EEIKKR

    >gi|197384571|ref|NP_001094049.1| SUMO-activating enzyme subunit 2 [Rattus norvegicus]
    MSLSRGLPRELAEAVSGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESV
    LQFHPQANIEAHHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYE
    CHPKPTQRTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
    KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEEANADQQSEPQLGLKDQQVLDVKSYASL
    FSKSIETLRVRLAEKGDGAELIWDKDDPPAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLE
    GLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNTNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQ
    IEDGKGTILISSEEGETEANNPKKLSDFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDTPEKVGPKQAED
    AAKSIANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSADGSRDDRTRKRKLEENEGASTKKSRLEQVEDQDDVIALD

    >gi|62078533|ref|NP_001013924.1| protein disulfide-isomerase-like protein of the testis precursor [Rattus norvegicus]
    MELLWTPLLLLAACLSEVLGSPEMDTGINISQPLHILEDHNLMVLTPAGLTQTLNETRFLMVIFHNPTLKQSRKLAKELG
    KAAEIFGKGKNGLGFGKVDITMETELKQEFDITHAPELKLFYEGNRLEPISCKDVVESTALVVWLRRQISKKALLFNNSN
    EVADFVKSRPLVIVGFFQDLEEEVAELFYDTIKDFPELTFGAIQIKNSFGRFHVILDSVLVFKKGRVVKRQELINDSTNK
    DYLNQVIKQQLTGFVIEFNPENKDLIYEMNILNHMLLFISKNSEPYSTIIRHYRQISKEFQNKILFVLVNSDEPKNKRIF
    EYFQISRVNVPSVQILNLSSDARYKMPTDNITFESLKKFCNSFLSRTAKKHKSSEEIPKYWDQEPVKKLVGKNFNVVVFD
    KEKDVFVMFYAPWSEK
    CRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFPTDSQEAVMYKGEHTMK
    GFCDFLESHVKVRIEEDDELLYIEQNEVAEEEVLAEPEMQHIDKLPEKPPLKVEDTSKQDRPAKESPALGSISQPEELER
    RKETAEKEKKVAQPKEQPKPERKLDIKEEL

    >gi|6981202|ref|NP_036993.1| methylated-DNA--protein-cysteine methyltransferase [Rattus norvegicus]
    MAEICKMKYTVLDSPLGKIELSGCERGLHGIRFLSGKTPNTDPTEAPACPEVLGGPEGVPEPLVQCTAWLEAYFHEPAAT
    EGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGEMVSYQQLAALAGNPKAARAVGGAMRSNPVPILIP
    CHRVIRSDGAIG
    NYSGGGQTVKEWLLAHEGIPTGQPASKGLGLIGSWLKPSFESSSPKPSG

    >gi|78187979|ref|NP_116003.2| glutaredoxin-3 [Rattus norvegicus]
    MAAGAAEAAEAAVAVVEVGSARQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSE
    KYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGSFPPSTNEHVKEDLNLRLKKLTHAAPCMLFMKGTPQEPR
    CGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEER
    LKVLTNKASVMLFMKGNKQEAK
    CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIV
    KELKDNGELLPILKGEN

    >gi|16758404|ref|NP_446062.1| peroxiredoxin-5, mitochondrial precursor [Rattus norvegicus]
    MVQLRFCVLGSIAGSVLRASATWTCVAGRAGRKGAGWECGGARSFSSAAVTMAPIKVGDTIPSVEVFEGEPGKKVNLAEL
    FKDKKGVLFGVPGAFTPG
    CSKTHLPGFVEQAGALKAKGAQVVACLSVNDAFVTAEWGRAHQAEGKVQLLADPTGAFGKET
    DLLLDDSLVSLFGNRRLKRFSMVIDKGVVKALNVEPDGTGLTCSLAPNILSQL

    >gi|18376837|ref|NP_543166.1| arsenite methyltransferase [Rattus norvegicus]
    MAAPRDAEIHKDVQNYYGNVLKTSADLQTNACVTPAKGVPEYIRKSLQNVHEEVISRYYGCGLVVPEHLENCRILDLGSG
    SGRDCYVLSQLVGQKGHITGIDMTKVQVEVAKAYLEYHTEKFGFQTPNVTFLHGQIEMLAEAGIQKESYDIVISNCVINL
    VPDKQKVLREVYQVLKYGGELYFSDVYASLEVSEDIKSHKVLWGE
    CLGGALYWKDLAVIAKKIGFCPPRLVTANIITVGN
    KELERVLGDCRFVSATFRLFKLPKTEPAGRCQVVYNGGIMGHEKELIFDANFTFKEGEAVEVDEETAAILRNSRFAHDFL
    FTPVEASLLAPQTKVIIRDPFKLAEESDKMKPRCAPEGTGGCCGKRKSC

    >gi|56090550|ref|NP_001007603.1| glutathione S-transferase omega-1 [Rattus norvegicus]
    MSGASARSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEIININLKNKPEWFFEKNPFGLVPVLENTQG
    HLITESVITCEYLDEAYPEKKLFPDDPYEKACQKMTFELFSKVPSLVTSFIRAKRKEDHPGIKEELKKEFSKLEEAMAKK
    RTAFFGGNSLSMIDYLIWPWFQRLEALELNECIDHTPKLKLWMATMQEDPVASSHFIDAKTYRDYLSLYLQDSPEACDYG
    L

    >gi|58865708|ref|NP_001012071.1| glutathione S-transferase omega-2 [Rattus norvegicus]
    MSGDLTRCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNKPDWYYTKHPFGQVPVLENSQC
    QLIYESVIACEYLDDVFPGRKLFPYDPYERARQKMLLELFCKVPQLSKECLVALRCGRDCTDLKVALRQELCNLEEILEY
    QNTTFFGGDSISMIDYLVWPWFERLDVYGLADCVNHTPMLRLWISSMKQDPAVCALHIDKNIFLGFLNLYFQNNPCAFDF
    GLCGPIVR

    >gi|157818439|ref|NP_001100914.1| NHL repeat-containing protein 2 [Rattus norvegicus]
    MAVPGARGASLSGLLPAQTSLEYALLDAVTQQEKDDLVYQYLQKVDGWEQDLAVPEFPEGLEWLNTEEPLSIYRDLCGKV
    VILDFFTYC
    CINCIHVLPDLHALERTFSDTDGLLIVGVHSAKFPNEKVLDNIKSAVLRYNITHPVVNDTDASLWQELEVS
    CWPTLVILGPRGNLLFSLIGEGHKDKLFSYTSIALKYYKDRGQIRDGKIGIKLFKESLPPSPLLFPGKVAADPTTGRLVV
    ADTGHHRILVLQKNGQIQYSIGGPNPGRKDGVFSESSFHSPQGVAIADNVIYVADTENHLIRKIDLEAEKVSTVAGIGVQ
    GTDTEGGEEGDKQPISSPWDVALGTSGSKVQRNDILWIAMAGTHQIWAFLLDSGTLPKKSDLKKGTCLRFAGSGNEENRN
    NAYPHKAGFAQPSGLALAPEEPWSCLFVADSESSTVRTVSLRDGAVKHLVGGERDPMNLFAFGDVDGAGISAKLQHPLGV
    AWDEKRHLLYVADSYNHKIKVVDPNTKVCTTLAGTGDANDASSSFAESAFNEPGGLCIGERGRLLYVADTNNHQIKVMDL
    EARTVSVLPVFKSDSAVVDGSFPREKQKTVPKVPKSAPNISLPPVTVHPGQALQLGLRLELPPGAKLTEGAPSGWFLKAE
    GNEWLLQEQIPSGDIENISNQPAISLQIPTECLSLEAVVSVTVFLYYCSADSSACMMKGVVFRQPLQINSVQPACAAPVE
    LTYAF

    >gi|11968132|ref|NP_071985.1| thioredoxin-dependent peroxide reductase, mitochondrial precursor [Rattus norvegicus]
    MAAAAGRLLWSSVARPASTIFRSISASTVLRPVASRRTCLTDMLWSACPQAKFAFSTSSSFHTPAVTQHAPHFKGTAVVN
    GEFKELSLDDFKGKYLVLFFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIT
    LLSDLTKQISRDYGVLLESAGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEEPLRLVKAFQFVETHGEVCPPNWTPESPT
    IKPSPTASKEYFEKVHQ

    >gi|11560105|ref|NP_071614.1| glutaredoxin-1 [Rattus norvegicus]
    MAQEFVNCKIQSGKVVVFIKPTCPYCRKTQEILSQLPFKRGLLEFVDITATNNTNAIQDYLQQLTGARTVPRVFIGKDCI
    GGCSDLLSMQQNGELTARLKQIGALQL

    >gi|157823095|ref|NP_001099881.1| probable glutathione peroxidase 8 [Rattus norvegicus]
    MEPLGAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRINSFYSFEVKDAKGRMVSLEKFKGKASLVVNVASDCR
    FTDKSYETLRELHKEFGPYHFNVLAFPCNQFGESEPKSSKEVESFARKNYGVTFPIFHKIKILGPEAEPAFRFLVDSSKK
    EPRWNFWKYLVNPEGQVVKFWRPEEPLEAIRPHVSQMIGQIILKKKEDL

    >gi|293357503|ref|XP_002729147.1| PREDICTED: peroxiredoxin-1-like [Rattus norvegicus]
    MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPREIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK

    >gi|111494225|ref|NP_579831.2| 15 kDa selenoprotein precursor [Rattus norvegicus]
    MAAGQGGWLRPALGLRLLLATAFQAVSALGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETK
    KLYAGAILEVCG
    CKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLE
    RI

    >gi|164663841|ref|NP_001013098.2| chloride intracellular channel 3 [Rattus norvegicus]
    MAETTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFAPGSQLPILLYDGDVKTDTLQIE
    EFLEETLGPPDFPGLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDDALYQQLLRALTRLDRYLGTPLDHELAQEPHLSES
    RRRFLDGDQLTLADCSLLPKLHIVDTVCAHFRQRPIPAELSCVRRYLDSALQEKEFKYTCPHSAEILAAYQPAVHPR

    >gi|157821921|ref|NP_001102904.1| quiescin Q6 sulfhydryl oxidase 2 [Rattus norvegicus]
    MAVARVKGQRAGGTPNMAAARAVARGPGADARRPLSPQAARGPRLLLLLAVVAAVGPQEGGGARLYRVGEDAVWLLDSGS
    VRSATGNSSAAWLVQFHSSWCGHCIGYAPTWRALAADVRDWAAAIRVAALDCAEEKNQDVCRTYDIHFYPTFRYFRAFTK
    EFTTGENFKGPDRELRTVRQTMIDFLQNHTEGSRPPACPPLDPIQSSDILSFMDSHSGQYHAVVFESNGSYVGREVILDL
    IPYDNIMVSRALDTDKAFLGTLGISSVPSCYLIYPNGSHGLVNVAKPLRSFFSSYLKSLPDVRKKSLSLPEKPNKEENSE
    VVIWKEFDRAKLYTADLESGLHYLLRVELAAHRSLAGAQLKTFKDFVTVIAKLFPGRPPVKKLLETLHEWLANLPLDKIP
    YNAILDLVNNKMQISGLFLTSHITWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALVGTGFEGDPQAVLQTMRRYI
    RTFFG
    CKECGEHFEEMAKESMDSVKTADQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPWPTPDLCPVCHEEIKGLDSWD
    EEQVLVFLKQHYSRDNLVDTYSVDQGSPGEWEGMGRRQEEGKGLNPSGKAWGHQDTESLRPAHILGPRTDLSKSLHHRLD
    LRLQSPQGPQTLEEAKAVVPFLGVGFSSLDMSLCVVLYVASSLFLMIMYFFFRVRSKRWKVRLYHPAV

    >gi|157822395|ref|NP_001101302.1| prostaglandin E synthase 2 [Rattus norvegicus]
    MAQAARVAWVLGSSRCALSEGLLTRPWTQLSAQSRAGFTRAAAGNRGASIRKGSPRLLGVAALALGGALGLYHTVRWHLR
    SQDLHAERSAVQLSLSNRLQLTLYQYKT
    CPFCSKVRAFLDFHSLPYQVVEVNPVRRTEIKFSSYRKVPILVAQEGDSLQQ
    LNDSSVIISALKTYLVSGQPLEEIITYYPPMKAMNDQGKEVTEFGNKYWLMLDQKEAQQMYGGKEARTEEMKWRQWADDW
    LVHLISPNVYRTPAEALASFDYIVREGKFGAVEATMAKYVGAAAMYFISKRLKSRHHLQDDVRVDLYEAANKWVTAVGKD
    RPFMGGQKPNLADLAVYGVLRVMEGLEAFDDLMRHSHIQPWYLRMERAIKEASSMHCMHPNCKD

    >gi|189163506|ref|NP_001099956.2| dnaJ homolog subfamily C member 10 precursor [Rattus norvegicus]
    MGVWLNRDEFIRDVKRISLCLLVLYVVIVVGTDQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPG
    CSH
    CHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVSFAMQHVRTTVTEL
    STGNFVNAIETAFAAGIGWLITFCFKGEDCLTPQTRLRLSGMLDGLVNVGWVDCDTQDSLCKSLDATASTTAYFPPGATL
    NNKEKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANKLEDRLAHHRWLVFFHFGKNENANDPELKKLKTLLKNEHIQVGR
    FDCSSAPGICSDLYVFQSCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPW
    C
    PPCRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSVHEYEGHHSAEQILEFIEDLRNPSVVS
    LTPTTFNELVKQRKHDEVWMVDFYSPW
    CHPCQVLMPEWKRMARTLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQK
    SSRAYQYHSYNGWNRDAYSLRSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVIDFYAPW
    CGPCQNFAPEFELLARMIKGK
    VKAGKVDCQAYPQTCQKAGIRAYPSVKLYLYERAKKSIWEEQINSRDAKTIAALIYGKLETFQSQVKRNKDEL

    >gi|169234953|ref|NP_001108411.1| selenoprotein H [Rattus norvegicus]
    MAPLGRKRKAGAAPIESADKREKLAEGAAVVIEHCTSCRVYGRHAAALSQALQLEAPEISVQVNRSKPRRGSFEVTLLRP
    DNSRVELWTGIKKGPPRKLKFPEPQEMVEELKKYLS

    >gi|8393322|ref|NP_059015.1| protein disulfide-isomerase A3 precursor [Rattus norvegicus]
    MRFSCLALLPGVALLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPL
    AKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEDEFKKFISDKDASVVGFF
    RDLFSDGHSEFLKAASNLRDNYRFAHTNVESLVKEYDDNGEGITIFRPLHLANKFEDKIVAYTEKKMTSGKIKKFIQESI
    FGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNTKGSNYWRNRVMMVAKTFLDAGHKLNFAVASRKTFSHELSDFGLESTT
    GEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQEYFDGNLKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIE
    FYAPW
    CGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDLISYL
    QREATNPPIIQEEKPKKKKKAQEDL

    >gi|209915579|ref|NP_001093999.1| thioredoxin domain containing 13 [Rattus norvegicus]
    MTGGFCVPVFLAAWLAAAAAEAEGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWETFAKNGE
    TLQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQNYILEKKWQSVEPLTGWKSPASLTMSGMAG
    LFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMGLILVVISECFYVPLPRASSERSEQEQRSEEAQGAEQLQ
    DAEEEKDDSNEEENKDSLVDDEEEKEDLGDDDEVEEDEEEDNLAGIMDEEKSDSNEQGVVKEGSVSPKDEEARSADTQDV
    VEDSLRQRKSQHAKGP

    >gi|157821745|ref|NP_001101274.1| adenylyltransferase and sulfurtransferase MOCS3 [Rattus norvegicus]
    MAAPEDVAALQDEIARREEELASLKQRLAAALAVEPEPERPIPVMPLPSRAALSRDEILRYSRQLLLPELGVRGQLRLAA
    ASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLARQVLHGEAQAGHAKAWSAAAALRRLNSAVEYVPYARALS
    EAWALDLVRGYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQMTVYHYDDGPCYRCVFPRPPPAETVTN
    CADG
    GVLGVVPGVLGCVQALEVLKIAAGLGTTYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTCLKNYEAFCGSSATD
    KCRSLKLLSPEERISVTDYKRLLDSGVPHVLLDVRPQVEVDICRLQHSLHIPLSLLERRDADSLKLLGAALQEEKRNSQE
    GAALAVYVICKLGNDSQKAVRVLQSLTAVPELDSLKVQDISGGLMAWAAKIDGTFPQY

    >gi|16758712|ref|NP_446301.1| protein disulfide-isomerase A4 precursor [Rattus norvegicus]
    MKLRKAWLLVLLLALTQLLAAASAEDAHEDASDSENPIEDDDEEEEDEEDEDDLEVKEENGVWVLNDENFDNFVADKDTV
    LLEFYAPW
    CGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVA
    KVREVSQPDWTPPPEVTLTLTKENFDDVVNNADIILVEFYAPW
    CGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTD
    LAKRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMVEQSGPPSKEILTLKQVQEFLKDGDDVVILGVFQGVGDPGYLQ
    YQDAANTLREDYKFHHTFSTEIAKFLKVSLGKLVLMQPEKFQSKYEPRMHVMDVQGSTEASAIKDYVVKHDLPLVGHRKT
    SNDAKRYSKRPLVVVYYSVDFSFDYRTATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDES
    GKKFAMEPEEFDSDALREFVMAFKKGKLKPVIKSQPVPKNNKGPVRVVVGKTFDAIVMDPKKDVLIEFYAPW
    CGHCKQLE
    PVYTSLGKKYKGQKDLVIAKMDATANDITNDRYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTK
    EEL

    >gi|261862315|ref|NP_001100079.2| thioredoxin reductase 3 isoform 2 [Rattus norvegicus]
    MSSPPGRRARLTSPGTSRPPAEVREEVRRRLRDLIEGNRVMIFSKSYCPHSSRVKELFSSLGVNYYILELDQVDDGANVQ
    EVLTEISNQKTVPNIFVNKVHVGGCDRIFQAHQNGLLQKLLQDDSTHDYDLIVIGGGSGGLSCAKEAANLGKKVMVLDFV
    VPSPQGTSWGLGGT
    CVNVGCIPKKLMHQAALLGHALQDARKYGWDYNQQVKHNWETMREAIQNHIGSLNWGYRVTLREKG
    VTYVNSFGEFVELHKIKATNKKGQETFYTASKFVIATGERPRYLGIQGDKEY
    CITSDDLFSLPYCPGNTLIVGASYVGLE
    CAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGRLKVVAKSTEGPETVEGTY
    NTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIGDVLEGKPELTPVAIQAGKLLARRLFGISLEK
    CDYINVPTTVFTPLEYGCCGLSEEKAIEMYTKENLEVYHTFFWPLEWTVAGRDNNTCYAKIICNKFDNDRVIGFHLLGPN
    AGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTMEITKSSGLDITQKGC
    CG

    >gi|17105358|ref|NP_476553.1| NEDD8-activating enzyme E1 catalytic subunit [Rattus norvegicus]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRMLQWPKEQPFGDGVPLDGDDPEHIQWIFQKSVERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSP
    AITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFT

    >gi|293359178|ref|XP_575783.3| PREDICTED: hypothetical protein LOC500420 [Rattus norvegicus]
    MLARLVLGTSCRAVLGSVEPALGGLKSRWGSSQHFCSTLSKDVTYRELKNLLNSKDIMLIDVRNTWEILEHGKIPGSVNI
    PLDEVGEALQMNPREFKEKYGEEKPSKSDRLVFS
    CLAGVRSKKAMDTAISLGFNSAQHYIGGWTEWVTYEISEKKQS

    >gi|56605938|ref|NP_001008318.1| endoplasmic reticulum resident protein 44 [Rattus norvegicus]
    MNPTVFLSLPDLRCSLLLLVTSIFAPITAEIASLDSENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEYP
    DKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSNPVHEIQSLDEVTNLDRSK
    RNIIGYFEQKDSDNYRVFERVASILHDDCAFLSAFGDLSKPERYSGDNLIYKPPGRSVPDMVYLGSMTNFDVTFNWIQDK
    CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPV
    IAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQDQDVASSPPESSFQKLAPSEYRYTLL
    RDRDEL

    >gi|16758644|ref|NP_446252.1| thioredoxin [Rattus norvegicus]
    MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCEVKCMPTFQFY
    KKGQKVGEFSGANKEKLEATITEFA

    >gi|51854245|ref|NP_001004092.1| thioredoxin domain-containing protein 8 [Rattus norvegicus]
    MVQKIKSMREFKELLGAAGNRLVVVEFSAQWCGPCKMIAPAFQAMSLQYRNVMFAQVDVDSSQELTEHCSIQVVPTFQMF
    KHSRKVTPFSRLKRILCCFRSGPGSKKIFEFQGADIEKLEEKIQELM

    >gi|157821095|ref|NP_001100143.1| glutathione peroxidase 7 [Rattus norvegicus]
    MVAAVATAWLLLWAAACTQSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPYHFNV
    LAFPCNQFGQQEPDSNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKVVGAWDP
    TVPVEEIKPRITEQVMKLILQKREDL

    >gi|209915577|ref|NP_001094310.1| thioredoxin domain-containing protein 12 precursor [Rattus norvegicus]
    MSLRFGATCLLSFSFLLLITSSDGRTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEI
    SELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQVRLTGDA
    FREKHFQDEL

    >gi|16923958|ref|NP_476455.1| peroxiredoxin-1 [Rattus norvegicus]
    MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK

    >gi|13929166|ref|NP_114006.1| chloride intracellular channel protein 4 [Rattus norvegicus]
    MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPAHLQNLAPGTHPPFITF
    NSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLP
    GEIDENSMEDIKSSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV
    EIAYSDVAKRLTK

    >gi|157822867|ref|NP_001102167.1| hypothetical protein LOC362676 [Rattus norvegicus]
    MSTLDLGRVGACVLKHAVTGEAVELRSLWQEKACVVAGLRRFGCMVCRWIAQDLSNLRGILDQNDVRLVGIGPEALGLQE
    FLDGGYFSGELYLDESKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDRVLL
    HFIQSSPGDYVPQENILQALGISAEVCSSKPPQCDEEVCGR

    >gi|207113155|ref|NP_001128226.2| ethanolaminephosphotransferase 1 [Rattus norvegicus]
    MAGYEYVSPEQLAGFDKYKYSALDTNPLSLYVMHPFWNTIVKVFPTWLAPNLITFSGFMLLVFNFLLLTYFDPDFYASAP
    GHKHVPDWVWIVVGILNFVAYTLDGVDGKQARRTNSSTPLGELFDHGLDSWACVYFVVTVYSIFGRGPTGVSVFVLYLLL
    WVVLFSFILSHWEKYNTGVLFLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIIGCALCVTLPMSLL
    NFYRSYKSNSLKHNSIYEAMVPFFSPCLLFTLSTVWILRSPSDILEMHPRIFYFMVGTAFANITCQLIVCQMSSTRCPTL
    NWLLLPLFLVVATVIVGTTTSRLESVLLYTLTAAFTLAHIHYGVQVVKQLSRHFQIYPFSLRKPNSD
    CLGLEEKSIGP

    >gi|40786469|ref|NP_955417.1| dihydrolipoyl dehydrogenase, mitochondrial precursor [Rattus norvegicus]
    MQSWSRVYCSLAKKGHFNRLSHGLQGASSVPLRTYSDQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTC
    LNVGCIPSKALLNNSHYYHLAHGKDFASRGIEIPEVRLNLEKMMEQKRSAVKALTGGIAHLFKQNKVVHVNGFGKITGKN
    QVTATTADGSTQVIGTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVT
    AVEFLGHVGGIGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSVEAASGGKAEVITCDVLLVCIGRRPFTQ
    NLGLEELGIELDPKGRIPVNTRFQTKIPNIFAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVA
    WVGKSEEQLKEEGVEFKVGKFPFAANSRAKTNADTDGMVKILGHKSTDRILGAHILGPGAGEMVNEAALALEYGASCEDV
    ARVCHAHPTLSEAFREANLAASFGKPINF

    >gi|157822099|ref|NP_001100194.1| anterior gradient protein 3 homolog [Rattus norvegicus]
    MLHSALALCLLLITVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHAHKSNKPLMVIHHLEDCQYCQALKKEF
    AKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLIDNMKKALRL
    IQSEL

    >gi|157822131|ref|NP_001100195.1| anterior gradient protein 2 homolog [Rattus norvegicus]
    MEKFSVSAILLLVAISGTLAKDTTVKSGSKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNRPLMVIHHLDE
    CPHSQALKKVFAENKEIQKLAEQFVLLNLIYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALL
    HDNMKKALKLLKTEL

    >gi|67078422|ref|NP_001019971.1| thioredoxin-related transmembrane protein 1 [Rattus norvegicus]
    MAHLGRLLVPLAALVLLLWAVPGAHGRRSNVRVLTDENWTSLLEGEWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVKV
    AKVDVTEQTGLSGRFIITALPSIYHCKDGEFRRYLGPRTKKDFINFISEKEWKNVEPVSSWFGPSSVLMTTMSALFQLSV
    YIRTSHSYFVHDLGIPAWGSYLVFAFATVLSGLLLGLCMIFVADCLCPSKRRRPQQQPTKKPSPEFSQPLKKVEEEQEAD
    EEDVSEEETENREGESKDTPQSGLRQRCVGPSSATDKS

    >gi|157817241|ref|NP_001102748.1| hypothetical protein LOC500694 [Rattus norvegicus]
    MAAARALSLTAEAFGAAIPRRQGRLLAAFPRLLTRWETTSSIPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCS
    GFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAYVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKI

    >gi|157823513|ref|NP_001102192.1| glutaredoxin-related protein 5, mitochondrial [Rattus norvegicus]
    MSASLSRAAAALLRWGRGAGGGVLPRAGVRAASSGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRD
    YAAYNVLEDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALIDEKDQDSK

    >gi|52345385|ref|NP_001004442.1| protein disulfide-isomerase A6 [Rattus norvegicus]
    MRVISMARLVLGLVSCTFFLAVSALYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAASALKDV
    VKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGD
    SSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIK
    GFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGATGRNS
    YLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGST
    APVGGGSFPNITPREPWDGKDGELPVEDDIDLSDVELDDLEKDEL

    >gi|66730429|ref|NP_001019447.1| methyltransferase-like protein 7B precursor [Rattus norvegicus]
    MDVLVPLLQLLVLLLTLPLHLLALLGCWQPICKTYFPYLMATLTARSYKKMESKKRELFSQIKDLKGTSNEVTLLELGCG
    TGANFQFYPPGCKVTCVDPNPNFEKFLTKSMAENRHLQYERFIVAYGENMKQLADSSMDVVVCTLVLCSVQSPRKVLQEV
    QRVLKPGGLLFFWEHVSEPQGSQALLWQRVLEPTWKHIGDG
    CHLTRETWKDIEKAQFSEVQLEWQPPPFKWLPVGPHIMG
    KAVK

    >gi|78191795|ref|NP_113802.2| thioredoxin reductase 1, cytoplasmic [Rattus norvegicus]
    MNDSKDAPKSYDFDLIIIGGGSGGLAAAKEAAKFDKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQAL
    KDSRNYGWKLEDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIA
    TGERPRYLGIPGDKEY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
    EEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTD
    EEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIE
    VYHSFFWPLEWTVPSRDNNKCYAKVVCNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFT
    TLSVTKRSGGDILQSGC
    CG

    >gi|16758038|ref|NP_445783.1| thioredoxin, mitochondrial precursor [Rattus norvegicus]
    MAQRLLLRRFLTSVISRKPPQGVWASLTSTSLQTPPYNAGGLTGTPSPARTFHTTRVCSTTFNVQDGPDFQDRVVNSETP
    VVVDFHAQW
    CGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAF
    LKKLIG

    >gi|57528682|ref|NP_036940.1| thiosulfate sulfurtransferase [Rattus norvegicus]
    MVHQVLYRALVSTKWLAESIRSGKVGPSLRVLDASWYSPGTRQARKEYQERHVPGASFFDIEECRDTTSPYEMMLPSEAH
    FGDYVGNLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLNRS
    LLKTYEQVLENLQSKRFQLVDSRAQGRYLGTQPEPDAVGLDSGHIRGSVNVPFMNFLTEDGFEKSPEELRAIFQDKKVDL
    SQPLIAT
    CRKGVTACHIALAAYLCGKPDVAVYDGSWSEWFRRAPPETRVSQGKSGKA

    >gi|20304123|ref|NP_620198.1| 3-mercaptopyruvate sulfurtransferase [Rattus norvegicus]
    MAAPQLFRALVSAQWVAEALKSPRASQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPSAT
    HFADYAGSLGVSAATHVVIYDGSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRYWLSQNLPISSGKSPSEPAEFCAQLDP
    SFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTSEGLEKSPEEIQRLFQEKKVDL
    SKPLVAT
    CGSGVTACHVVLGAFLCGKPDVPVYDGSWVEWYMRAQPEHVISQGRGKTL

    >gi|148283739|ref|NP_001078954.1| selenoprotein O [Rattus norvegicus]
    MASFRAAFGASLAVARTRPQCVGLELQSSAPWSAWAAAMEPTPRWLARLRFDNRALRALPVETPPPGPEDSLSTPRPVPG
    ACFSRARPAPLRQPRLVALSEPALALLGLEVSEEAEVEAEAALFFSGNALLPGTEPAAHCYCGHQFGQFAGQLGDGAAMY
    LGEVCTAAGERWELQLKGAGPTAFSRQADGRKVLRSSIREFLCSEAMFHLGIPTTRAGACVTSESTVMRDVFYDGNPKYE
    KCTVVLRIAPTFIRFGSFEIFKPPDELTGRAGPSVGRNDIRVQMLDYVISSFYPEIQAAHTCDTDNIQRNAAFFREVTRR
    TARMVAEWQCVGFCHGVLNTDNMSIVGLTIDYGPFGFLDRYDPDHVCNASDNAGRYTYSKQPQVCRWNLQKLAEALEPEL
    PLVLAEAILKEEFDTEFQRHYLQKMRKKLGLVRVEKEDETLVAKLLETMHQTGADFTNTFCVLSSFPAEPSDTAEFLTQL
    TSQCASLEELKLAFRPQMDPRQLSMMLMLAQSNPQLFALIGTQANVTKELERVEHQSRLEQLSPSELQSKNRDHWETWLQ
    EYRERLDKEKEGVGDIAAWQAERVRIMHANNPKYVLRNYIAQKAIEAAENGDFSEVRRVLKLLESPYHSEEEATGPEAVA
    RTTDEQSSYSSRPPLWAAELCVT
    CSS

    >gi|293361314|ref|XP_236597.5| PREDICTED: similar to Thioredoxin domain containing protein 6 (Thioredoxin-like protein 2) [Rattus norvegicus]
    MGNRKKEIALQVNIKTQERWEEMLASKGLTVVDVYQGWCGPCKAMVSLFQKMKIEVGLDLLHFASAEADCLDVLGKYRGK
    CEPTFLFYARGELVAVVKGANPILLQKTILQKLEVEKKALAEGREWNVVTDENHLGAAKWPPRKKDGGKDGDIAAVSHKS
    HKHCAVSLPEPYSEKSGQATSEDQGVRQVAAGKMSCINSQDARDPGLPTAASSGKACTLGLIKPDAVAHGRADEIIMKEA
    FEKLVHHMCSGPSHHLILTKTEGTEDVVTAWQNFLGPCDPDVARREQPESETIVSFTSY

    >gi|16758390|ref|NP_446055.1| chloride intracellular channel protein 5 [Rattus norvegicus]
    MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGD
    VKTDVNKIEEFLEETLTPEKYPKLAARHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNTPLPEEI
    DTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELA
    YADVARRLSRS

    >gi|70778871|ref|NP_742029.3| thioredoxin domain-containing protein 9 [Rattus norvegicus]
    MEGNGSIDMFSEVLENQFLQAAKLVENHLDSEIQKLDQIGEDELELLKEKRLAALRKAQQQKQEWLSKGHGEYREIGSER
    DFFQEVKESEKVVCHFYRDTTFR
    CKILDRHLAILAKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALLRDGKTQDYIVG
    FTDLGNTDDFTTETLEWRLGCSDVINYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

    >gi|71043634|ref|NP_001020880.1| phosducin-like protein 3 [Rattus norvegicus]
    MQDPNADTEWNDILRKKGILPPKESLKELEEEEEGKEEQRLQQSVVKTYEDMTLEELQENEDEFSEEDERAIEMYRQQRL
    AEWKATQLRNKFGEVLEISGKDYVQEVTKAGEGLWVVLHLYKQGIPL
    CSLINHHLSGLARKFPDVKFIKAISTTCIPNYP
    DRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTELEENPKKAIKDVLLSSVRDPVPMRRDSDSEDD


    >gi|225579139|ref|NP_001005559.2| thioredoxin domain-containing protein 2 isoform 2 [Rattus norvegicus]
    MECCETPPPEFLDTAQSKEKVIASVVGNMLHMSTEESEPPQQVSSTSMFSENTIYPKHEGSPKSSTKNTQLKQEDISKTS
    SYSKQTNSSNIPKSLAITTYPKQGSTLKPAANGTHDREAEKPKSSEDLIQSKKGDIFKPSEDSIQSKKGDMPKSSEDPIQ
    SKKDDTAKSLEDTIQSKNGDMPKSSEDPIQSKKDDTARSLEDSIQSKKGDMPKSSDTIQSKESETPKFLQDTIQSKGGKI
    NKQVKDSMKSKESKIRKPLKDSIQSKENKIPKSSQDSAQPKEGKIHKPLKDSLPSKEGDISKPSEDTIQAKEEITVSPED
    TIQAKEEITMSPEDTIQAKEEITVSPEDTIQAKEEITVSPEDTMQSKEEITVSPEDTVQSQEGDIKSSEDVQPSENEIFP
    FEAEIETLEEGMVRVIKDKEEFEEVLKDAGEKLVAVDFSAPW
    CGPCRKMRPHFHSLSLKHEDVIFLEVDTEDCEQLVQDC
    EVFHLPTFQFYKNEEKVGEFSGALVEKLEKSIAELK

    >gi|225579141|ref|NP_001139476.1| thioredoxin domain-containing protein 2 isoform 1 [Rattus norvegicus]
    MFKKNQKLSKDKGLEVNSVQAGAPEESDVKLNNGGKANERGSNEFLDTAQSKEKVIASVVGNMLHMSTEESEPPQQVSST
    SMFSENTIYPKHEGSPKSSTKNTQLKQEDISKTSSYSKQTNSSNIPKSLAITTYPKQGSTLKPAANGTHDREAEKPKSSE
    DLIQSKKGDIFKPSEDSIQSKKGDMPKSSEDPIQSKKDDTAKSLEDTIQSKNGDMPKSSEDPIQSKKDDTARSLEDSIQS
    KKGDMPKSSDTIQSKESETPKFLQDTIQSKGGKINKQVKDSMKSKESKIRKPLKDSIQSKENKIPKSSQDSAQPKEGKIH
    KPLKDSLPSKEGDISKPSEDTIQAKEEITVSPEDTIQAKEEITMSPEDTIQAKEEITVSPEDTIQAKEEITVSPEDTMQS
    KEEITVSPEDTVQSQEGDIKSSEDVQPSENEIFPFEAEIETLEEGMVRVIKDKEEFEEVLKDAGEKLVAVDFSAPW
    CGPC
    RKMRPHFHSLSLKHEDVIFLEVDTEDCEQLVQDCEVFHLPTFQFYKNEEKVGEFSGALVEKLEKSIAELK

    >gi|293351319|ref|XP_002727752.1| PREDICTED: glutathione peroxidase 8-like [Rattus norvegicus]
    MQVNINCSLVRWAPHDWPSVPDAVSMGPGDTDSEKYPVVERKQSCGYSSYQTHSDSDSDTDSDTDTDSDTDSDTDTDSDT
    DTDSDTDTDSDSDTVSDSDTDSDTDTDSDTVSDSDTDTDSDTDTDSDTVSDSDTDSDTDIDTDSDRFFLIFCFSFRWGFF
    FFREASLVVNVASD
    CRFTDKSYETLRELHKEFGPYHFNVLAFPCNQFGESEPKSSKEVESFARKNYGVTFPIFHKIKILG
    PEAEPAFRFLVGKYLLCLNVVHSFSFHTLNISDIKKKKIIRTITHIFTGKFS

    >gi|7549740|ref|NP_037354.1| FAD-linked sulfhydryl oxidase ALR [Rattus norvegicus]
    MRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDT
    STRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

    >gi|146229350|ref|NP_001037750.2| methionine-R-sulfoxide reductase B1 [Rattus norvegicus]
    MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHEDSVAKCPEKNRPEALKVSCGKCGNGLGH
    EFLNDGPKRGQSRF
    CIFSSSLKFIPKGKEAPASQGD

    >gi|164663906|ref|NP_001099245.2| protein disulfide-isomerase A2 [Rattus norvegicus]
    MDDRFLPVLLLLLGVSGSWGQGEEPGGPPEVLSEESIGEEVPEEDGILVLNNQTLSLALQEHSALMVEFYAPWCGHCKAL
    APEYSKAAALLAAESAAVTLAKVDGPAEPELTKEFGVVGYPTLKFFQNGNRTNPEEYIGPKTAEGIAEWLRRRVGPSATR
    LEDEEGVQALMAKWDMVVIGFFQDLQEEDVATFLALARDALDMAFGFTDQPQLFEKFGLTKDTVVLFKKFDEGRADFPVD
    KEAGLDLGDLSRFLITHSMHLVTEFNSQTSPKIFAARILNHLLLFVNQTLAQHRELLTGFREAAPPFRGQVLFVMVDVAA
    DNSHVLNYFGLKAEEAPTLRLINVETTKKYAPAGVIPITAASVAAFCQAVLHGEVKHYLLSQEIPPDWDQRPVKTLVSKN
    FEQVAFDETKNVFVKFYAPW
    CSHCKEMAPAWEALAEKYRDREDIVIAEMDATANELEAFSVHGYPTLKFFPAGPDRKIIE
    YKSTRDLETFSKFLDRGGDLPEEESKEPAVSAPEAQPNSTLGPKEEL

    >gi|157818993|ref|NP_001101755.1| nucleoredoxin [Rattus norvegicus]
    MSVFLEELLGDKLVTGGGEEVDVHSLGARGIALLGLYFGCSLSAPCAQLSASLALKLWNKYRVSNIPSLIFLDATTGKVV
    CRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAG
    QKFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCREFP
    WHPKPVLELSDSNAVQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYT
    NLPEAAPLLTILDMSARAKYVMDVEEITPAIVETFVNDFLAEKLKPEPI

    >gi|40786501|ref|NP_955434.1| spermatogenesis-associated protein 20 [Rattus norvegicus]
    MSHHSPPPPKHKGEHKGHGLPRGSERGSSSRGKDRSASVSNSVPMPAGGKASRTNCPPPAPQKTANRLINEKSPYLLQHA
    HNPVDWYPWGQEAFDKAKKENKPIFLSVGYST
    CHWCHMMEEESFQNEEIGHLLNENFVSVMVDREERPDVDKVYMTFVQA
    TSSGGGWPMNVWLTPSLQPFVGGTYFPPEDGLTRVGFRTVLMRICDQWKQNKNTLLENSQRVTTALLARSEISVGDRQLP
    PSAATMNSRCFQQLDEGYDEEYGGFAEAPKFPTPVILNFLFSYWLSHRVTQDGSRAQQMALHTLKMMANGGIRDHVGQGF
    HRYSTDRQWHIPHFEKMLYDQAQLSVVYCQAFQISGDEFFSDVAKGILQYVTRNLSHRSGGFYSAEDADSPPERGVKPQE
    GALYLWTVKEVQQLLPEPVGGASEPLTSGQLLMKHYGLSEAGNINPTQDVNGEMHGQNVLTVRDSLELTGARYGLEVEAV
    RALLNTGLEKLFQARKHRPKAHLDNKMLAAWNGLMVSGFAVAGSVLGMEKLVTQATNGAKFLKRHMFDVSSGRLKRTCYA
    GAGGTVEQSNPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQDIQDKLFWDSHGGGYFCSEAELGTDLPLRLKDD
    QDGAEPSANSVSAHNLLRLHGLTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDPQAKDTKA
    LLQCVHSIYIPNKVLILADGDPSSFLSRQLPFLSNLRRVEDRATVYIFENQACSMPITDPCELRKLLHQ

    >gi|157819293|ref|NP_001101766.1| hypothetical protein LOC360617 [Rattus norvegicus]
    MSGEPGQVSVVPPPGEVEAGSGVHIVVEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLEN
    GGFPYEKDLMEAIRRASNGEPLEKITNSRPPCVIL

    >gi|157819297|ref|NP_001102309.1| methyltransferase like 2 [Rattus norvegicus]
    MAASLSEGVPETEDRKRPQFGNRFLSDPARVFHHNAWDNVKWSEEQAAAAERKVQENSSQLVCPEKQADYEVNAHKYWDD
    FYKVHENGFFKDRHWLFTEFPELAPSHDHLVNLHLEKQKNEVSKPRSSEDGPGLAAEQHKRPCTSHGCETRVPPVEEPVT
    QKLTHLEICADDFPGSSATYRILEVGCGVGNTVFPILQTNNNPDLFVYCCDFSATAIELVKTNSEYDPSRCFAFVHDLCD
    EDQSYPMPKDSLDVIVLIFVLSAIVPDKMQKAISKLSRLLKPGGVMLLRDYGRYDMAQLRFKKGQ
    CLSGNFYVRGDGTRV
    YFFTQDELDTLFTAAGLEKVQNVVDRRLQVNRGKQLTMYRVWIQCKYSKPLVPSASQHVPTPHTT

    >gi|6981324|ref|NP_037130.1| protein disulfide-isomerase [Rattus norvegicus]
    MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFAEPAAHNYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRL
    AKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIG
    FFKDAGSDSAKQFLLAAEAVDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVIE
    FTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAEGFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLIT
    LEEEMTKYKPESDELTAEKITQFCHHFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPW
    CGH
    CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAG
    DNDDLDLEEALEPDMEEDDDQKAVKDEL

    >gi|28570188|ref|NP_788267.1| chloride intracellular channel protein 6 [Rattus norvegicus]
    MAEATEPKEVSSGSQGQPEGAVIEGPGEPGAADLEGREASEGAAEAPRDLGEGAEAMASGKEEGGCGQDGEIGEVQAQDP
    RPGPGTETPGTSGAPGEAEAAECDSEGALIPQSGGGAKRQQVQGTSSGLDAQGEAPEVPEDARREPEDPKASEAGEEAES
    GQEALGGSAPESQINPEVQGPVGDNMDTEAPAGEPQGSEGEPQGGGESSPQPQDEAIEIAAAEVGGHEPGELAGASAADA
    KGEGETLRKDGFEEAAPEEARVDSGENGFEEAAPEEARVDSGENRDQGRLQEETGEEEARPESGLKGPCEEAIQEKAPDG
    SLDGEEAKSTGHEESQVELSNHLAEETSAQGGEELGRVNGRRENGPASEEGDLGQEHDITLFVKAGSDGESIGN
    CPFSQR
    LFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGND
    VFAKFSAFIKNTKKDANDIYEKNLLRALKKLDSYLNSPLPDEIDAYSTEDVTVSQRKFLDGDELTLADCNLLPKLHIIKI
    VAKKYRGFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDAAKRMK

    >gi|62078977|ref|NP_001014147.1| protein disulfide-isomerase A5 precursor [Rattus norvegicus]
    MARAWGLLLAIGVILPTWLSSTKVSSLIERISDPKDLKKLLRTRNNVLVLYSESEVAAESHLKLLSTVAQAVKGQGTICW
    VDCGDAESRKLCKKMKVDLSPKDKKIELFHYQDGAFHMQYDRAVTLKSIVAFLKDPKGPPLWEEDPGAKDVVHIDSEKDF
    RRLLKKEEKPLLMMFYAPW
    CSMCKRIMPHFQKAATQVRGHTVLAGMNVYPPEFENIKEEYNVRGYPTICYFEKGRFLFQY
    ENYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPW
    CGHCKKMKPEFESAAEVL
    HGDAESSGVLAAVDATINEALAERFHISAFPTLKYFKNGEQQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQQTSVLHL
    VGDNFRETLKKKKHTLVMFYAPW
    CPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQESVKAYPTFHYYHYG
    KLVEKYESDRTELGFTSFIRTLREGDLKRLEKRREDL

    >gi|12018236|ref|NP_072106.1| thioredoxin reductase 2, mitochondrial precursor [Rattus norvegicus]
    MAAIVAALRGSSGRFRPQTRVLTRGTRGAAGAASAAGGQQNFDLLVIGGGSGGLACAKEAAQLGRKVAVADYVEPSPRGT
    KWGLGGT
    CVNVGCIPKKLMHQAALLGGMIRDAQHYGWEVAQPVQHNWKAMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIK
    ASFVNEHTVHGVDKAGKVTQLSAKHIVIATGGRPKYPTQVKGALEHGITSDDIFWLKESPGKTLVVGASYVALECAGFLT
    GIGLDTTVMMRSVPLRGFDQQMASLVTEHMESHGTRFLKGCVPSLIRKLPTNQLQVTWEDLASGKEDVGTFDTVLWAIGR
    VPETRNLNLEKAGVNTNPKNQKIIVDAQEATSVPHIYAIGDVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMNYSNVPTT
    VFTPLEYGCVGLSEEEAVALHGQEHIEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAGEVTQGFA
    LGIQCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLDPTVTGC
    CG

    >gi|281332164|ref|NP_001013999.2| apoptosis-inducing factor, mitochondrion-associated 3 [Rattus norvegicus]
    MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRGYQGNGTARHFHAEERLPTPQPYPSPQDCVEATVCHVKDLEN
    GQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNIGTGDLEDFPGLDSLHKFQVKIEK
    EKVTVRASKQALQLQRRTKVMAKCISPSAGHSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRAKLSKS
    LDAQPEQLALRPKEFFRAYGIEMLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLTCKGKDIENVFTIRTPE
    DANRVLRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELR
    AQEGKLQEVVLKSSKVLRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNIPGVFAAGDAVTFPLAWRNNRKV
    NIPHWQMAHAQGRVAAQNMLAQEAEINTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASM
    NYDPIVSKVAEVLASGRAIRKREVELFMLHSKTGDMSWLTGKGS

    >gi|61556751|ref|NP_001013052.1| glutaredoxin-2, mitochondrial [Rattus norvegicus]
    MGNSTSSFWGKSATTPVNQIQETISNNCVVIFSKSSCSYCSMAKKIFHDMNVNYKVVELDMVEYGSQFQEALYKMTGERT
    VPRIFVNGIFIGGAADTHRLHKEGKLLPLVHQCYLNKSKRKDVE

    >gi|16758172|ref|NP_445883.1| sulfhydryl oxidase 1 isoform B [Rattus norvegicus]
    MRRCGRHSGPPSLLLLLLLLPPLLLSVPGAYAARLSVLYSSSDPLTLLDADTVRPAVLGSSSAWAVEFFASWCGHCIAFA
    PTWKELANDVKDWRPALNLAVLDCADETNSAVCREFNIAGFPTVRFFKAFSKNGTGTALPAAGANVQTLRMRLIDALESH
    RDTWPPACPPLEPAKLKDINEFFTRSKAEYLALIFEREDSYLGREVTLDLSQFHAVAVRRVLNSESDVVSKFAVTDFPSC
    YLLLRNGSVSRVPVLVESRPFYTSYLRGLPGLTREAPPTTAAPVTPDKIAPTVWKFADRSKIYMADLESALHYILRVEVG
    KFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSINDWLQKQQKKKIPYSYFKAALDSRKENAVLAEKVNWIGCQGSE
    PHFRGFPCSLWVLFHFLTVQAHRYSEAHPQEPADGQEVLQAMRSYVQSFFG
    CRDCANHFEQMAAASMHQVKSPSNAVLWL
    WTSHNRVNARLSGALSEDPQFPKVQWPPRELCSACHNEVNGQVPLWDLGATLNFLKAHFSPANIVRDPPAPGPASRRGTQ
    DPEASPNLLL

    >gi|158138547|ref|NP_001103368.1| sulfhydryl oxidase 1 isoform A [Rattus norvegicus]
    MRRCGRHSGPPSLLLLLLLLPPLLLSVPGAYAARLSVLYSSSDPLTLLDADTVRPAVLGSSSAWAVEFFASWCGHCIAFA
    PTWKELANDVKDWRPALNLAVLDCADETNSAVCREFNIAGFPTVRFFKAFSKNGTGTALPAAGANVQTLRMRLIDALESH
    RDTWPPACPPLEPAKLKDINEFFTRSKAEYLALIFEREDSYLGREVTLDLSQFHAVAVRRVLNSESDVVSKFAVTDFPSC
    YLLLRNGSVSRVPVLVESRPFYTSYLRGLPGLTREAPPTTAAPVTPDKIAPTVWKFADRSKIYMADLESALHYILRVEVG
    KFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSINDWLQKQQKKKIPYSYFKAALDSRKENAVLAEKVNWIGCQGSE
    PHFRGFPCSLWVLFHFLTVQAHRYSEAHPQEPADGQEVLQAMRSYVQSFFG
    CRDCANHFEQMAAASMHQVKSPSNAVLWL
    WTSHNRVNARLSGALSEDPQFPKVQWPPRELCSACHNEVNGQVPLWDLGATLNFLKAHFSPANIVRDPPAPGPASRRGTQ
    DPEASPNLVMDTLKLETGNSVLGHEQAASAASPGATALDVPAGKPEASGPQELNAGLSMGGASPGQGPPEHTEELLRDVQ
    ENAQGQQHLSKRDTEALLLPEVNHLQGPLAPRRGGHSPKQLASILEGEPEALAIQGRRQWLQVLGGGVSFLDISLCVGLY
    SVSFMGLLAMYTYFRARMRTPKGHVSYPTA

    >gi|16758348|ref|NP_446028.1| peroxiredoxin-6 [Rattus norvegicus]
    MPGGLLLGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHF
    AWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPAEKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEI
    LRVVDSLQLTASNPVATPVDWKKGESVMVLPTLPEEEAKQLFPKGVFTKELPSGKKYLRYTPQP

    >gi|293352851|ref|XP_002728074.1| PREDICTED: rCG20339-like [Rattus norvegicus]
    MLRVAVLRQSHTGAAAGTMTGVPTVSFSELRQLLASGRARLFDVRSREEAAAGTIPGALNIPVSELEMALNMDPAAFQTS
    Y
    CAEKPKLEDKNLIFFCQMGRRGLQATQLAQGLGYTGARNYAGAYKEWLEKEG

    >gi|157821599|ref|NP_001100683.1| ubiquitin-like modifier-activating enzyme 6 [Rattus norvegicus]
    MERSEPLAVLSCEEASCSSWGACGASKNLPTMTTESLEIDDGLYSRQRYVLGDTAMQKMAKSCVFLSGMGGLGVEIAKNL
    VLAGIKALTIHDTKKCQAWDLGTNFFLCEDDVVNERNRAEAVLHRVAELNPYVQVSSSSAPFDETTDLSFLEKYQCVVLT
    ETKLTLQKKINNFCHSHCPPIKFISTDVHGIWSRLFCDFGDEFEVSDTTGEEPKEIFISNITQANPGIVTCLENHPHKLE
    TGQFLTFREINGMAGLNGSVQQITVISPFSFSIGDTTELDPYLHGGIAVQVKTPKIFNFEPLESQIKHPKCLIADFSKPE
    APLQIHVAMLALDQFQENYSRKPNIRCQQDSDELLKLTICISETLEEKPEVNADIVHWLSWTAQGFLPPLAAAVGGVASQ
    EVLKAVTGKFSPLCQWLYLEAADTVESLGNLGHEEFLPRGDRYDAFRACIGNTLCQKLQNLNIFLVGCGAIGCEMLKNFA
    LLGVGTGREKGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAAEATLKINPQLKIDAHLNKVCPATESTYSDEFYNK
    QDIVITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHTEIIVPQLTESYNSHRDPPEEEIPF
    CTLKSFPAAVEHTIQW
    ARDKFESSFSHKPSLFNKFWQAYPSAEDVLQKIQNGQSLEGCFQVIKLLSRRPRMWSQCVELARLKFEKYFNHKALQLLH
    CFPLDTRLKDGSLFWQSPKRPPSPIKFDLNEPLHLSFLQNAAKLYATVYCIPFSEKDLSVDSLMDILSEVKIQEFKPSNK
    VVQTDETARKPDHVPVSSEDERNAVFQLEKALSSNKATKSDLQMAVLSFEKDDDSNGHIDFITAASNLRAKMYNIEPADR
    FKTKRIAGKIIPAIATSTAAVSGLVALEMIKVAGGYPFDAYKNCFLNLAIPIIVFTETSEVRKTEIRNGISFTIWDRWTV
    HGKEDFTLSDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPSTEKKYVDLTVSFAPDADGDEDLPG
    PPVRYYFSHDTDE

    >gi|293353096|ref|XP_573585.2| PREDICTED: phosducin-like 2 [Rattus norvegicus]
    MALLPIRPTDPDQNGKHDPNEDTEWNEILRNFGILPPKEEPKDEIEEMVLRLQEEAMVKPYEKMTLAQLKEAEDEFDEED
    IKAIEIYREKRLQEWKALTKKQKFGELREISGNQYVNEVTNAEKDLWVIIHLYRSSVPM
    CLVVNQHLSVLARKFPETKFV
    KAIVNSCIEHYHDNCLPTIFVYKNGQIEGKFIGVIECGGINLKLEELEWKLSQVGAIQTDLEENPKKGIADMMVSSIRNV
    SIYDSDSSGSDAEAK

    >gi|109499823|ref|XP_344253.3| PREDICTED: hypothetical protein [Rattus norvegicus]
    MAAARALSLTVEAFGAPIPRRQGRLLAAFPRLLTRWETTSSIPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCS
    GFQYKFSLDTVINPDDRVFEQGGARVVVDSDNLAYVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKI

    >gi|169234756|ref|NP_001108485.1| selenoprotein M precursor [Rattus norvegicus]
    MNILLSPPPLLLLLAALVAPATSITTYRPDWNRLRGLARGRVETCGGCQLNRLKEVKAFVTQDIQLYHNLVMKHLPGADP
    ELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAKVPPEYLWAPAKPPEDASDRADL

    >gi|293353393|ref|XP_002728202.1| PREDICTED: hypothetical protein [Rattus norvegicus]
    MFLPGKLQPVSVAQWFVNCKFPSGKVVVFIQPTCPYLQKDPRNPQSTAFQTWSSGICEHHSH

    >gi|19924061|ref|NP_612537.1| ERO1-like protein alpha precursor [Rattus norvegicus]
    MGRAWGLLVGLLGVVWLLRLGHGEERRPETAAQRCFCQVSGYLDDCTCDVETIDKFNNYRLFPRLQKLLESDYFRYYKVN
    LRKPCPFWNDINQ
    CGRRDCAVKPCHSDEVPDGIKSASYKYSKEANLLEECEQAERLGAVDESLSEETQKAVLQWTKHDDS
    SDSFCEVDDIQSPDAEYVDLLLNPERYTGYKGPDAWRIWSVIYEENCFKPQTIQRPLASGQGKHKENTFYSWLEGLCVEK
    RAFYRLISGLHASINVHLSARYLLQDNWLEKKWGHNVTEFQQRFDGVLTEGEGPRRLKNLYFLYLIELRALSKVLPFFER
    PDFQLFTGNKVQDVENKELLLEILHEVKSFPLHFDENSFFAGDKHEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQ
    TQGLGTALKILFSEKLIANMPESGPSYEFQLTRQEIVSLFNAFGRISTSVRELENFRHLLQNVH

    >gi|16758004|ref|NP_445759.1| peptide methionine sulfoxide reductase [Rattus norvegicus]
    MLSASRRTLQLLSSSIPVRMMGDSSSKVISAEEALPGRTESIPVAAKHHVSGNRTVEPFPEGTQMAVFGMGCFWGAERKF
    WLLKGVYSTQVGFAGGYTRNPTYKEVCSEKTGHAEVVRVVYRPEHVSFEELLKVFWENHDPTQGMRQGNDCGTQYRSAVY
    PTSAVQMEAALKSKEEYQKVLSKHGFGPITTDIREGQVFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPTAIKK

    >gi|62079015|ref|NP_001014162.1| hypothetical protein LOC361118 precursor [Rattus norvegicus]
    MSFLQDSSFFSMGMWSIGVGAFGAAALALLLANTDMFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAV
    RRPG
    CFLCRAEAADLMSLKPKLDELGVPLYAVVKEKVKREVEDFQPYFKGEIFLDEKKKFYGPERRKMMLMGLVRLGVWY
    NSFRAWKGGFSGNFEGEGFILGGVFVIGSGKQGVLLEHREKEFGDRVNLLSVLEAVKKIKPQTPASRQS

    >gi|71795648|ref|NP_001025197.1| gamma-interferon-inducible lysosomal thiol reductase [Rattus norvegicus]
    MSCSPLVPFLSLLLLLFLPEVPRAATASLPQGSSEGAATCKAHDLCLFGPRRLLSAPPVNVSLYYESLCGACRYFLVRNL
    FPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECKLNKVEACLLDKLEKEAAFLTIVCMEEMEDMEKKLGPCL
    QLYVPEVSPESIMECATGKRGTELMHENAQLTDALQPPHEYVPWVLVNEKPLTDPSQLLSSVCELYQGTEKPDICSSMAD
    APREVCYK

    >gi|51948396|ref|NP_001004212.1| tumor suppressor candidate 3 [Rattus norvegicus]
    MSARAAPSRRRQAGRRLRYLSTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFVKAP
    PRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAFCNKLFFGMVDYDEGTDVFQQLNMNSAPTFMHFPSKGRP
    KRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
    AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLG
    LVVFFFSFLLSIFRSKYHGYPYSFLIK

    >gi|158138532|ref|NP_036643.2| copper-transporting ATPase 2 [Rattus norvegicus]
    MPEQERKVTAKEASRKILSKLALPTRPWGQSMKQSFAFDNVGYEGGLDSTCSSSTTTGVVSILGMTCHSCVKSIEDRISS
    LKGIVSIKVSLEQGSATVKYVPSVLNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVEGMT
    CQSCVSSIE
    GKIRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDINKLESTNLKRAAVPPIQN
    SNHLETPGHQQNHLATLPLRIDGMH
    CKSCVLNIEGNIGQLPGVQNIHVSLENKTAQVQYDSSCITPLFLQTAIEALPPGY
    FKVSLPDGLEKESGSSSVPSLGSSQRQQEPGPCRTAVLTITGIPRDSSVQPMEDMLSQMKGVQQIDISLAEGTGAVLYDP
    SVVSSDELRTAVEDMGFEVSVNPENITTNRVSSGNSVPQAVGDSPGSVQNMASDTRGLLTHQGPGYLSDSPPSPGGTASQ
    KCFVQIKGMT
    CASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEVIQSPRIAQLIEDLGFEAAIMEDNTVSEGDIEL
    IITGMT
    CASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIIGPRDIIKVIEEIGFHASLAHRNPNAHHLDHKTEIK
    QWKKSFLCSLVFGIPVMGLMIYMLIPSSKPHETMVLDHNIIPGLSVLNLIFFILCTFVQFLGGWYFYVQAYKSLRHKSAN
    MDVLIVLATTIAYAYSLVILVVAIAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTL
    GEDNLILREEQVPMELVQRGDIIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLIKAT
    HVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIIIGFVDFGIVQKYFPSPSKHISQTEVII
    RFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFLLLVDV
    ATLSLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKVSNVESILAHRGPTAHPIGVGNP
    PIGEGTGPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMG
    VDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGKKVAMVGDGVNDSPALAQADVGIAIGTGTDVAIE
    AADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQL
    KCYRKPDLERYEAQAHGRMKPLSASQVSVHVGMDDRRRDSPRATPWDQVSYVSQVSLSSLTSDRLSRHGGMAEDGGDKWS
    LLLSDRDEEQCI

    >gi|157819669|ref|NP_001102584.1| hypothetical protein LOC498685 [Rattus norvegicus]
    MAAPVTRQVSGCAGRVPSPTGSDTERGQPLAAAVAELPVLDASGRRVTFGALFRERRAVVVFVRHFLCYVCKEYVEDLAK
    IPKSVLQEADVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEISSSDWTLNHC

    >gi|31745170|ref|NP_853657.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor [Rattus norvegicus]
    MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDADEEVIQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNV

    >gi|68163437|ref|NP_001020169.1| thioredoxin domain-containing protein 15 precursor [Rattus norvegicus]
    MQLLCWWQILLWVLGLPARGLEEDSGHTWQEERPVPALQVGSVYLNEEEAAQGHRVQARVAEPSEASLGPRGDPMVVLSV
    IPGAAEDQRSTEAHDGTCSAQGDEDPRCGGRENLFGLQGAGGFQDREEEYYAEPGVAEAEPVATEDANSTDSLKSPKVNC
    EERNVTGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPW
    CRFSASLAPHFNSLPRAFPTLGFLALDASQHSSLSTRF
    GTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNVVVTQADQLGPLPSTLVKTVDWLLVFSLFFLISFI
    MYATIRTESIRWLIPGQEQEHAE

    >gi|281371342|ref|NP_001163900.1| nucleoredoxin-like protein 2 [Rattus norvegicus]
    MVDVLGGRRLMTREGTLVEAEAALQNKVVALYFAAGRCAPSRDFTPLLCDFYTELVSEARRPAPFEVVFVSADRSAEEML
    DFMRELHGSWLALPFHDPYRHELKKRYDITVIPKVVVIKQNGAVITNKGRKQIRERGLACFQNWVEAADVFQNFSG

    >gi|293354514|ref|XP_002728509.1| PREDICTED: rCG43947-like [Rattus norvegicus]
    MPPRPGRLFQPLAGLPALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQR
    LQPTWNDLGDKYNSMEDAKVYVAKVDCTANSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPAT
    PEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVC
    SEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVLAAEPPGDKGTVLALTEKSFEDT
    IAQGITFVKFYAPW
    CGHCKNLAPTWEELSKKEFPGLADVTIAEVDCTAERGVCSKYSVRGYPTLLLFRGGEKVGEHNGGR
    DLDSLHSFVLRQAKDEL

    >gi|22203761|ref|NP_671694.1| glutathione peroxidase 6 precursor [Rattus norvegicus]
    MTQQFWGPCLFSLFMAVLAQETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYAGKHILFVNVASFCGLTATYP
    ELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTS
    ELLGSPEHLFWDPMKVHDIRWNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYLNQTRTQ

    >gi|268836417|ref|NP_942087.2| thioredoxin domain-containing protein 3 [Rattus norvegicus]
    MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQALFRKLKNELNEDELLHFVVAEADSIVTLQPFRD
    KCEPVFLFSLNGKIIAKIQGANAPLINRKVIALIDEEKKIAAGEMARPQYVEIPLVDSLDEEYGEVHYESNVEVYNMAVI
    NPDAVLMRKNLEIKEKITKEGFIIEIQENMLLPEEVAREFYNHMIDEPDFEEFVYSMTNRLSCVLIISQGEDTEVIEEEA
    LPQSDDEEEEEEEEVVEEPDPLEEPHVRFAPMLVKKKRDSLQEYMDRQHMSDYCHVEDDAVKVSKFIDILFPDFKTMKST
    NVQRTLGLLYPEVCEEEKDNVLDIIQNEGFTILMQRQVVLSEEEARAVCHVHEDEDYFDNLIGYMCSNNSYILVLMREHS
    VERWKELIGPKTVEEAYASHPDSLCVRFASGNFPVNQFYGSSSKAAAETEIEHFFPPQSTLALIKPHVSHKERMEILKAI
    RDARFELTQMKEMHLTPEHASKVYFKITGKDFYKNVLDVLSSGMSVVMILTKWNAVGEWRRMMGPVDPEEAKLLSPNSLR
    ARYGIDVLRNAVHGASNMSEAATAISNVFTESNFEN

    >gi|293354664|ref|XP_344619.4| PREDICTED: endoplasmic oxidoreductase 1 beta [Rattus norvegicus]
    MSPGFLRAVAGQGAAAAVQLLVTLGFLSSLVKTQVTGVLDDCLCDIDSIDNFNTYKIFPKIKKLQERDYFRYYKVNLKRP
    CPFWAEDGH
    CSIKDCHVEPCPESKIPVGIKAGRSNKYSQAANNTKELDDCEQANKLGAINSTLSNESKEAFIDWARYDDS
    QDHFCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDNGESFYTWLEGLC
    LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFKRRFDTVETKGEGPRRLKNLYFLYLIELRALSKVAPY
    FERSIVDLYTGNLEDDADTKTLLLSIFQDTKSFPMHFDEKSMFAGDKKGAKSLKKDFTKLYGRSFTKLLDTQESKDSFTQ
    GLGTALKILFSEKEIQKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKALLQHRR

    >gi|157278006|ref|NP_001098100.1| selenide, water dikinase 1 [Rattus norvegicus]
    MSTRESFNPETYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MVNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|72255541|ref|NP_001026830.1| methionine-R-sulfoxide reductase B2, mitochondrial precursor [Rattus norvegicus]
    MARLLRALRGLPWLEAPGRARGCAGSGRGDTGSLIKSKLSLSKADWQKKLTPEQFYVTREKGTEAPFSGMYLKNKETGMY
    HCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTKGSDESHTGILRRLDTSLGCPRMEVVCKQCEAHLGHVFPDGPDPTGQRF
    CINSVALKFKPSKP

    >gi|18266686|ref|NP_543163.1| thioredoxin-like protein 1 [Rattus norvegicus]
    MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFL
    FFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDLSFLESD
    CDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
    VNSVTLFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|8394432|ref|NP_058865.1| peroxiredoxin-2 [Rattus norvegicus]
    MASGNAHIGKPAPDFTGTAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQ
    FTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQ
    AFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

    >gi|62078517|ref|NP_001013913.1| thioredoxin-like protein 4B [Rattus norvegicus]
    MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSADLSKMATIYLVDVDQTPVYTQYFDISYIPS
    TVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

    >gi|57526993|ref|NP_001009651.1| chloride intracellular channel protein 2 [Rattus norvegicus]
    MASLALNTQADPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTIDTARKPEELKDLAPGTNPPFLIYNKELK
    TDFIKIEEFLEKTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLREFKRLDDYLNTPLLDEIDP
    DSTEERTLSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFAHTCPEDKEIENTYA
    SVAKQ

    >gi|50657380|ref|NP_001002807.1| chloride intracellular channel protein 1 [Rattus norvegicus]
    MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI
    EEFLEAVLCPPRYPKLAALNPESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVARAL
    K

    >gi|62078893|ref|NP_001014102.1| ubiquitin-like modifier-activating enzyme 1 [Rattus norvegicus]
    MSSSPLSKKRRVSGPDPKPGSNCSSAQSVLSEVSSVPTNGMAKNGSEADIDESLYSRQLYVLGHEAMKMLQTSSVLVSGL
    RGLGVEIAKNIILGGVKAVTLHDQGTTQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQ
    VVVLTNSPLEEQLRVGEFCHSRGIKLVVADTRGLFGQLFCDFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARH
    GFETGDFVSFSEVQGMVQLNGCQPIEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLAEPDFVMTDF
    AKYSRPAQLHIGFQALHQFCAQHNRPPRPRNEEDATELVTLAQAVNARSPPAVQQDNVDEDLIRKLAYVAAGDLAPINAF
    IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEALTEDKCLPRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIG
    CELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPYIQVTSHQNRVGPDTERIY
    DDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQPAENVNQYLTDSKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWGDCVTWACHHWHTQYCN
    NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNTLHLDYVMAAANLFAQTYGLTGSQDRAAVASLLQSVQVPEFT
    PKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDISPADR
    HKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHQQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
    QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCC
    NDESGEDVEVPYVRYTIR

    >gi|16758274|ref|NP_445964.1| peroxiredoxin-4 [Rattus norvegicus]
    METWSKLLDGTTPSRRWRKLVLLLPPLLLFLLQTEALQGLESDDRFRTRENECHFYAGGQVYPGEVSRVSVADHSLHLSK
    AKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLA
    WINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYT
    DKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|16758822|ref|NP_446398.1| magnesium transporter protein 1 precursor [Rattus norvegicus]
    MASPRWLWCVCATAAVTLLLVSKVPSASAQRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTA
    LQLHRQ
    CVVCKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPKRADTYELQVRG
    FSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIR
    GPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSI
    FRSKYHGYPYSFLMS

    >gi|16258817|ref|NP_434690.1| copper-transporting ATPase 1 [Rattus norvegicus]
    MEPNMDANSITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATVIYNPKLQTPKTLQEAIDDMGFDALLHNANP
    LPVLTNTVFLTVTAPLALPWDHIQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSANQIVELVPDLSLDMGTQEKKSGTS
    EEHSTPQAGEVLLKMRVEGMT
    CHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVYQPHLITAEEIKKQIEAVGFPAFIKK
    QPKYLKLGAIDVERLKSTPVKSSEGSQQKSPAYPSDSAITFTIDGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVK
    YNASLVTPEILRKAIEAVSPGQYRVSISSEVESPTSSPSSSSLQKMPLNLVSQPLTQEVVININGMTCNSCVQSIEGVIS
    KKPGVKSIHVSLTNSTGTIEYDPLLTSPEPLREAIEDMGFDAVLPADMKEPLVVIAQPSLETPLLPSTTEPENVMTPVQN
    KCYIQVSGMT
    CASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAELIRELGFGAVVMENAGEGNGILEL
    VVRGMT
    CASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGNLGFEASLVKKDRSANHLDHKREIK
    QWRGSFLVSLFFCIPVMGLMIYMMVMDHHLATLNHNQNMSNEEMINMHSSMFLERQILPGLSIMNLLSLLLCLPVQFCGG
    WYFYIQAYKALRHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEA
    LAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGST
    VIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVE
    AYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGT
    ITHGTPVVNQVKVLVESNKISRNKILAIVGTAESNSEHPLGAAVTKYCKQELDTETLGTCTDFQVVPGCGISCKVTNIEG
    LLHKSNLKIEENNIKNASLVQIDAINEQSSPSSSMIIDAHLSNAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHER
    RGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQ
    LQEEGKRVAMVGDGINDSPALAMASVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLI
    GIPIAAGVFLPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYDNYELRPRSHTGQRSPSEISVHVGIDDTSRNSP
    RLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTTL

    >gi|62078715|ref|NP_001014015.1| hypothetical protein LOC305806 [Rattus norvegicus]
    MFLPGKLQPVSVAQWFVNCKFPSRKVVVFIKPTCPYCRKTQEILSQLPFKPGLLESVNITVTNITNAIQDYLQQLTGWRT
    VPQVFIGKERLHRQTQ

    >gi|293345623|ref|XP_002726107.1| PREDICTED: peroxiredoxin-1-like [Rattus norvegicus]
    MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPREIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK

    >gi|293346041|ref|XP_001060093.2| PREDICTED: methyltransferase like 6-like [Rattus norvegicus]
    MNVIWRNCICRLRQGKVPHRCQSGVHPVAPLGSRILTDPTKVFEHNMWDHMQWSKEEEDEARKKVEENSATRVAPEEQVK
    FENAANKYWDTFYQTHKNKFFKNRNWLLREFPEILPVDQNTKEKLGESSWDPARSSISRTQGTETHRQETFVSSEPGSRE
    RSASNPDLEEYSRGPRKAEQFPGSKATFRILEVGCGAGNSVFPILNTLQNIPGSFLYCCDFAPEAVELVKSHEAYSEAHC
    SAFIHDVCDDGLAYPFPDGTLDVILLVFVLSSIHPDRMQAVIHRLSRLLKPGGMLLFRDHGRYDNAQLRFKKGR
    CLSENF
    YVRGDGTRAYFFTKGEIHRMFCEAGLHEKQNLVDHRLQVNRKKQIQMHRVWVQGKFQKPSCWTPRSADEHALPSPD

    >gi|293347283|ref|XP_001058924.2| PREDICTED: similar to CG12279-PA [Rattus norvegicus]
    MLARLVLGTSCRAVLGSVEPALGGLKSRWGSSQHFCSTLSKDVTYRELKNLLNSKDIMLIDVRNTWEILEHGKIPGSVNI
    PLDEVGEALQMNPREFKEKYGEEKPSKSDRLVFS
    CLAGVRSKKAMDTAISLGFNSAQHYIGGWTEWVTYEISEKKQS

    >gi|157822229|ref|NP_001102915.1| maleylacetoacetate isomerase [Rattus norvegicus]
    MQAGKPVLYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGITIGQSLAILEYLE
    ETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMPWAQKAITSGFNALEKILQSTAGKYCVGDEVS
    MADVCLAPQVANAERFKVDLSPYPTISHINKALLALEAFQVSHPCRQPDTPAELRT

    >gi|109482017|ref|XP_001081046.1| PREDICTED: SelR-like [Rattus norvegicus]
    MSAFNLLHLVTKSQPVALRACGLPSGSSRDKKNCKVAFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVISSEAIEFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFT
    PADSGEAEGGGSKESSSPAAADRAEL

    >gi|293349414|ref|XP_001070642.2| PREDICTED: similar to Thioredoxin domain containing protein 6 (Thioredoxin-like protein 2) [Rattus norvegicus]
    MGNRKKEIALQVNIKTQERWEEMLASKGLTVVDVYQGWCGPCKAMVSLFQKMKIEVGLDLLHFASAEADCLDVLGKYRGK
    CEPTFLFYARGELVAVVKGANPILLQKTILQKLEVEKKALAEGREWNVVTDENHLGAAKWPPRKKDGGKDGDIAAVSHKS
    HKHCAVSLPEPYSEKSGQATSEDQGVRQVAAGKMSCINSQDARDPGLPTAASSGKACTLGLIKPDAVAHGRADEIIMKEA
    FEKLVHHMCSGPSHHLILTKTEGTEDVVTAWQNFLGPCDPDVARREQPESETIVSFTSY

    >gi|293341454|ref|XP_002724949.1| PREDICTED: rCG20339-like [Rattus norvegicus]
    MLRVAVLRQSHTGAAAGTMTGVPTVSFSELRQLLASGRARLFDVRSREEAAAGTIPGALNIPVSELEMALNMDPAAFQTS
    Y
    CAEKPKLEDKNLIFFCQMGRRGLQATQLAQGLGYTGARNYAGAYKEWLEKEG

    >gi|293341676|ref|XP_001076368.2| PREDICTED: phosducin-like 2-like [Rattus norvegicus]
    MALLPIRPTDPDQNGKHDPNEDTEWNEILRNFGILPPKEEPKDEIEEMVLRLQEEAMVKPYEKMTLAQLKEAEDEFDEED
    IKAIEIYREKRLQEWKALTKKQKFGELREISGNQYVNEVTNAEKDLWVIIHLYRSSVPM
    CLVVNQHLSVLARKFPETKFV
    KAIVNSCIEHYHDNCLPTIFVYKNGQIEGKFIGVIECGGINLKLEELEWKLSQVGAIQTDLEENPKKGIADMMVSSIRNV
    SIYDSDSSGSDAEAK

    >gi|109500740|ref|XP_001060183.1| PREDICTED: hypothetical protein [Rattus norvegicus]
    MAAARALSLTVEAFGAPIPRRQGRLLAAFPRLLTRWETTSSIPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCS
    GFQYKFSLDTVINPDDRVFEQGGARVVVDSDNLAYVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKI

    >gi|293342695|ref|XP_002725291.1| PREDICTED: rCG43947-like [Rattus norvegicus]
    MPPRPGRLFQPLAGLPALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQR
    LQPTWNDLGDKYNSMEDAKVYVAKVDCTANSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPAT
    PEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVC
    SEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVLAAEPPGDKGTVLALTEKSFEDT
    IAQGITFVKFYAPW
    CGHCKNLAPTWEELSKKEFPGLADVTIAEVDCTAERGVCSKYSVRGYPTLLLFRGGEKVGEHNGGR
    DLDSLHSFVLRQAKDEL

    >gi|157786758|ref|NP_001099208.1| epididymal secretory glutathione peroxidase precursor [Rattus norvegicus]
    MAIQLRVFYLVPLLLASYVQTTPRLEKMKMDCYKDVKGTIYNYEALSLNGKERIPFKQYAGKHVLFVNVATYCGLTIQYP
    ELNALQDDLKQFGLVILGFPCNQFGKQEPGDNTEILPGLKYVRPGKGFLPNFQLFAKGDVNGEKEQEIFTFLKRSCPHPS
    ETVVTSKHTFWEPIKVHDIRWNFEKFLVGPNGVPVMRWFHQAPVSTVKSDILAYLNQFKTI

    >gi|109506264|ref|XP_001054206.1| PREDICTED: endoplasmic oxidoreductase 1 beta-like [Rattus norvegicus]
    MSPGFLRAVAGQGAAAAVQLLVTLGFLSSLVKTQVTGVLDDCLCDIDSIDNFNTYKIFPKIKKLQERDYFRYYKVNLKRP
    CPFWAEDGH
    CSIKDCHVEPCPESKIPVGIKAGRSNKYSQAANNTKELDDCEQANKLGAINSTLSNESKEAFIDWARYDDS
    QDHFCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDNGESFYTWLEGLC
    LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFKRRFDTVETKGEGPRRLKNLYFLYLIELRALSKVAPY
    FERSIVDLYTGNLEDDADTKTLLLSIFQDTKSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWG
    KLQTQGLGTALKILFSEKEIQKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKALLQHRR

    >gi|293343193|ref|XP_001063895.2| PREDICTED: rCG20581-like [Rattus norvegicus]
    MSLRALITGFTPRSMANAAGRRSWAALRLCAAVILLDLAVCKGFVEDLNESFKDNRKDDIWLVDFYAPWCGHCKKLEPIW
    NEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMF
    DHVRKRHRVFFVYIGGESPLKEKYIDAASELIVYTYFFSASEDVVPEYVTLKEMPAVLVFKDDTYFVYDEYEDGDLSSWI
    SRERFQNYLTMDGFLLYELGDTGKLVAIAVIDEKNTSLEHTRLKSIIQEVARDFRDHFHRDFQFGHMDGNDYINTLLMDE
    LTVPTIVVLNTSNQQYFLLDRHIKDASDMVQFINSILDGTVPAQGGDSIFQRLKRIVFDAKSTIVSIFKSSPLMGCFLFG
    LPLGVISIMCYGIYTADTDGGYIEERYEVSKSEMENQEQIEESKEQESSSGGSLVPTVQESKDVLEKKKD