Podospora anserina DSM 980 uid29799

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|171677201|ref|XP_001903552.1| hypothetical protein [Podospora anserina S mat+]
    MNASSLLARRAACLACRRSFFRSSNQQRQFSSTPAQLAAAFQSYSLPSHPPPAPRNATAPDTSITHNVQSPALPRVHETR
    PPKEPQAPLDPASSLPEREAQQSKSSTQLSAPSPRPRSKLRAPRKAAMKLTPAAVDHLRALLDQPDPKLIKVGVRNRG
    CS
    GLAYHLEFVEKPGAFDETVEQDGVKVLIDSKALFSIIGSEMDWIEDKLSQRFVFRNPNIKEQCGCGESFMV

    >gi|171677891|ref|XP_001903896.1| hypothetical protein [Podospora anserina S mat+]
    MRWLPAFLTASLAFAGGSLAAKKTTEERFNSFHAKSIASSSAAPIKLSDASYRELTGQPRDYTAAVVLTAMDSRFNCQLC
    REFQPEWDLLARSWVKGDKAGESRVLFGTLDFADGREIFMSLGLQTAPVLLLFPPTVGPHAVANSEPLRYDFSNGPQIAE
    VVHTWIARHLPDRPHPPVKRPINWMRWISTTVLTLGSLTASYVAWPYIVPVLQSRNIWAAVTLISILLFTSGHMYNHIRK
    VPYVASDGKGGISYFASGFQSQYGLETQIVAALYGLLSLAGISLAIKVPRIGDSKTQGVAVLAWGGVFFFTYAFLLSVFR
    GKNPGYPFRLPPFV

    >gi|171679391|ref|XP_001904642.1| hypothetical protein [Podospora anserina S mat+]
    MSLLRPLARAALRPATTPLRAFSTTTTRFIKPGQPLPDVGAILHESSPGNKVNLADEASKLNKMILIGVPAAFSPACSAT
    HVPGFLAHPKAEEYDQVAVVSVNDVFVMKAWGDVLNPEGKENVRFLADPSGEFTKALDMLWDGKAIFGNERSKRFTIIVE
    GGKVKSVAVEPDNTGTSVSLAENVLGKA

    >gi|171679639|ref|XP_001904766.1| hypothetical protein [Podospora anserina S mat+]
    MTAFDIKIVSDAICPWCYLGKKRLERAINLYKASVPNASSDTFKIHWHPFYLDPSLPKTSVDRDEHLLKKFGDPNRLAMS
    TMMLKRFGEAEGINFSFKARIGNTRDAHRLVQLAKTKSNELENSVISALFKLHFEEDGDITSHDVLIAAGEKGGLDKAEV
    ESWLDEGRGGPEVDKEVEEAYRDGVSGVPNFTINGKYRVEGAQDPEKLVEVLKRIKASAPAVSASSEGVSC

    >gi|171680729|ref|XP_001905309.1| hypothetical protein [Podospora anserina S mat+]
    MARRQHITLLLVGVMFFLTMTYFVSSSGGGGRDPTRILSDETWRSSSSHNSNGAGGALSESILKGGSIAPKLENATAKAE
    LGRASWKLFHTMMARFPEEPTADDSLALRTYIQLFARLYP
    CGDCASHFQKLLEKYPPQVSSRNNAAGWACFVHNEVNRRL
    RKELFDCNNIGDFYDCGCGDDGKGKKKEGDGGKERRRGYEIEVGEGVSLEREEGLVRGG

    >gi|171680759|ref|XP_001905324.1| hypothetical protein [Podospora anserina S mat+]
    MAAERNEPLRLGTIAPNFQAETTKGPIDFHEFIGDNWVILFSHPEDYTPVCTTELGEMARLEPEFSKRGVKLIGLSANTL
    GSHEGWISDIKDVTGSQVNFPIIADKERKVAYLYDMIDYQDTTNVDEKGIAFTIRSVFFIDPKKTIRCILSYPASTGRNS
    AEILRVIQSLQTGDKHKVTTPINWVPGDDVIVHPSIKGDEATKLFPNLRAVKPYLRFTPLPEID

    >gi|171680863|ref|XP_001905376.1| hypothetical protein [Podospora anserina S mat+]
    MASLFILRPLRVSLPRSGSQQLRQPAAKAAGVRRSFSSYLVTPQELAEALKKAPPSPISSEPRVIPLCASWFLPNDPEGR
    TGIDVFREKRIPKARFFDLDKVIDKHSEYPHMLPTPKGFAAAMSELGIRHEDTVVVYDSKELGIFSAPRVGWTLKTFGHP
    RVHILNNFRLWVEQGLPTESGNVWTVECGTYPIPEMDEAKVAHFEDVREVALDYNKEGAEGVQILDARSYGRWSGKDPEP
    RPGLSSGHMPGSINIPFDAVLDPQTKAFLPVDKLKQVFKEKGVDPAKPIISS
    CGTGVTACVLETALNEAQYGSPETRKVY
    DGSWTEWAQRVKPSDSLIRTVEQHSE

    >gi|171680974|ref|XP_001905431.1| hypothetical protein [Podospora anserina S mat+]
    MAEPIKISTLDELNQLITSTKYVILDFWAEWCGPCKAIAPLFAKLSKSHSVPGQLAFAKIDVDASADIAKEYGITAMPSF
    VFVVDGQVGKGIDVQGRKLGGGVKLGEGESADRVVQIRGADPRNLTLLANELGGLAKKGAEGSAEEAPKEEEKEEEAAAT
    A

    >gi|171681196|ref|XP_001905542.1| hypothetical protein [Podospora anserina S mat+]
    MADQVKHISSHQEFDNLLASNKYVIADFHADWCGPCKLINPHFSKMASTFSIPGFLAFAKVNVDHVQSVAQKYSVAAMPT
    FLFFKEGNQVAVNGQAMIQGANLPSLNLAVEKMGKLAKEKAAAAAAAE

    >gi|171681208|ref|XP_001905548.1| hypothetical protein [Podospora anserina S mat+]
    MAEKPPQRMTLLQRLRKAILFLRLVGYGLRTYYNFFSRSLSAKIANRLAKSDASIGPNDVKNIVIVGAAFSGLYAARLLA
    GAVPRDGRYRIVVIEPNSHFNFTWVFPRF
    CVVEGHEHKAFIPYSPDFFDMGPKGLVQWVRDRVTSLTRENVLLRSGEVIP
    YDYLIIATGSNVADGLPSRAGVEDKEEAIELLKAMQERVKNASHIVIAGGGAAGVETATDAKDRYPGKSVTIVHSRQTLM
    HRFGNGLQQGTSEAMERLGVNVILGEKVLPESVDGKFITLSSGQKIECDCFPASGIVASLAPNTIAPSGHIRVKPNLQID
    DDSLPNVYVCGDVAQAKVRNPNSRVAARQAEICADNVVRAVKGKKPKYVFTEGFGDGVIKLTLGLVCRSLQDRSITQYFD
    GKSELLFPAEEPDLDLMCKGTWAAMGARPFEDTGVYSE

    >gi|171681265|ref|XP_001905576.1| hypothetical protein [Podospora anserina S mat+]
    METSFYLVTIFIVLWILKRLFTPTTPIPETSGKVYKIANAAEFDALLSSAKHVVVDFYADWCPPCRVIAPHFSGLADKHS
    SDGQLAFAKVNVDHVDNIASRYGVSAMPTFLFFENGAPKGVAVQGMTARPSVPLTGDGLVERVRGADRAALKAVVEVLAG
    KGGRE

    >gi|171682002|ref|XP_001905944.1| hypothetical protein [Podospora anserina S mat+]
    MPPSPTTTTTTPQPFHFKIDIYTDTVCPFSHLGFLSLTTAVSSFSPPTPVTFSLTYHPYILYPNSRPSSRKLGAALTYIY
    SSHTRTTSILTHLDNLASTYNIKFNWEGMTGNSRDSHRLILLAQSRFQASPSQQNLRRFMSRLYQASFQRGRDISSRQTL
    AELGVEAGLFGTVDKGLEWLDSGALGEEVDKECEKAKREIGVRAVPSYVVNEQYVVGGMQDPVVWLSLFDKIMRQPTSQL
    QGGGEQKGGQLGRREEHGGNCRVVAVENDT

    >gi|171682384|ref|XP_001906135.1| hypothetical protein [Podospora anserina S mat+]
    MSSSSSYPDQRTPDQWRAVLNKEQFRILREKGTEPPGSGKFDKHYPTTGVYTCAGCHAPLYKASHKFSSGCGWPAYFDSI
    PGAVTRHEDRAFGMLRTEIVCSNCGGHLGHVFKGEGFPTPTDERH
    CVNSVSLSFSPDDEPVKKKEQEETKEREDKSKV

    >gi|171682594|ref|XP_001906240.1| hypothetical protein [Podospora anserina S mat+]
    MDSTEQIYAQVREHYSSASRTAAPKYGESVAKSFGYSEDELSNIPEDANLGLSCGNPLAITSLKEGETVIDLGSGAGFDI
    FLASTKIGSSGRAIGVDINDVRSYPATSAFSQHTADKVARKCSPAPKRSRPPAAARFPTSPSSKAISPLSLSQTVAVSDI
    LAKKPLPDQLRKDIAMYVG
    CIAGAAEVADYQNWFREAGFKDSVITDTQADLNVYLDTKEDGTKKSGDCCGPVAAVSACDG
    GDEAKKATPSCSSATTDSSDVGRTDLNEFVGKLAFLRIEETRAR

    >gi|171682834|ref|XP_001906360.1| hypothetical protein [Podospora anserina S mat+]
    MFKFTTRLTTTARQAARRRFSTTPARLQILPVKVTGTGTGTLQKVSVPGKPYTFTADTYPVLGGADSAPSPVVYSLASLS
    A
    CNQVTGSVVASNHGIKLGKWDTDVEGDKFDKFVSEVERRCPITQLFKLSGVKYESEWVNEKL

    >gi|171683131|ref|XP_001906508.1| hypothetical protein [Podospora anserina S mat+]
    MGSTDAKLILYTNHRCPWAHRAHIILEELKVPFEEVIIDLDTPRTPEYLKINPRGLVPALSYNGEIIIESAIVANFLADA
    YPSHLLPPSNTPEGALRRARVALFVDAFISKFNSQLFALYTAEGEAARAEIADKAVAALVKEVEPLLADASPYFGGSDKL
    TQAEVLTGSFVIRHKSLSKTDLYPSNLWPSIVEKAPNFAKWAEVVAVHPSVTSIFKEQEIIDGTRARIAKLKAQKQQ

    >gi|171683301|ref|XP_001906593.1| hypothetical protein [Podospora anserina S mat+]
    MRLRNLFVFGAAALATASPPSADTEEDITRENTYFNGKKVPPILELTPANYKEELKKSKFLMVKHFSPWCGHCQEFLPTF
    QTLYEYYYTSKPVGKDADFTEFYDFRFAELNCVAYADLCTENKVAAWPTTILFEDGEPLVTFRGVKHISVLSGAVEDALE
    KVKPNTRPKTLELPEPGDKTSPDSKAETEKTEKADAREKGSEKELVKETEKEKETETSTAASADASTEGEATPKKTYTVN
    YNTPSQKVTPKPSNPNPKGLSVPLTWELFQSMVTLTQEPWFVKFYAPW
    CHHCQAMAPNWEQLAKEMKGRLNIGEVNCDRD
    TRLCKELRVRGYPSIMFFKGGEKVEYEGLRGLGDFVQYAEKAIDLSSGVPDVDFDSFKALEEKEEVIFLYFYDHATTSED
    FLSLERYPLSLIGKAKLVKTRDPKLYDRYKITTWPRLIVSREGRPTYYTPLAPREMRDTRMVLNWMKSVWLPLVPELTPS
    NARDIMDGKIVVLGVLNRENEDSFRGAIREMKSAANEWMDKQIQLFQIHRQDLRDAKQLRIEEAEDRGDQRALRNAKNIR
    INMDRSDMKEATFAWVDGNFWQRWIRTTYGIDAKDGDRVIINDEDKRRYWDQTSTGNPIVPSRTSILETLNKVTVNPPKL
    KPKLTIGVIEKMFFDIKMTFKEHPYLSMGCILGIAFGLFQWLMGRTTRRARSHFKLEEGVGMKESKPSTLFGGSSNTATK
    AD

    >gi|171683467|ref|XP_001906676.1| hypothetical protein [Podospora anserina S mat+]
    MMLSGACPGTVLAQLGVGVKSGVYAFAGASLAGVVWSGFLKPLLTQCPTPPKAGSASPSPKATVHEVLGVSKGTLLLGLE
    AMFVGIVIAAAKFTEVGPEAKIPPYYGGMLIAGAQLLSLVVRGCLVGMSTSYEEVGGWMLGGKLVPEKYRNMLFSAGVIV
    GSYFLSHGAPKFGEVTDVVVSPLSAAVGGFLMILGSRMAGG
    CTSGHGISGISLLSMSSFLTVGATFAAGGLMGLLIG

    >gi|171683881|ref|XP_001906882.1| hypothetical protein [Podospora anserina S mat+]
    MSGLKAGDSFPPNVTFTYVPPTGDLNVTACGIGIQYDASKEFASKKVVLVAVPGAFTPTCQVSHVTSYLAKLDDLKAKGV
    DQVIFIASNDHWVMAAWGKANGVKDDSILFMSDAGLEFSKSIGWTQGDRTLRYAIVVDHGKVTYAEVDSVRGSIENTGAE
    GVLAKL

    >gi|171684081|ref|XP_001906982.1| hypothetical protein [Podospora anserina S mat+]
    MPDQITSAADWRSTVSSNAVVVADFYADWCGPCKMIAPHFESLANKYAKPRKIAFVKVNVDNQGEVAQQYGVRAMPTFLI
    LHNGSVIKTIQGANPPALTSAVEAAIKLAGPGAVGGSSFSSGGQRLGGTPVGGQRVGSGQRVARPISWDISQWVNAVLSF
    LGLYFVSLLSLDPYKSAEASRFNKKNPPPAAKPATGPGGRPAGRATFKTLNDLGSE

    >gi|171684109|ref|XP_001906996.1| hypothetical protein [Podospora anserina S mat+]
    MAPQQVDTTISPSATGPALALAKQHSADHPLKLYAGWFCPFVQRAWITLQEKEIDYRYIEINPYHKSPEFLALNPRGLIP
    TLVLPPGEEGKQRVLYESVIVCEYLDEQYNSGTKLLPWDPYERARARLWVNFVEKKLVAGWYRFMQHTPDKPYSLEGVRK
    EFLENLKTFVREMDEEGEGWFSEGGFGLVDVSFLPWAGRLWLMDHYKEGGVGIPKREEREGLEEGERKVWERWERWYEAV
    MGRETVRGTWSEREEYIGVYKRYAEDQTGSEVGKATREGRALP

    >gi|171684345|ref|XP_001907114.1| hypothetical protein [Podospora anserina S mat+]
    MPSQRRLRALLYTVLAAVVVLLFFTSQARHSRETGAIKDFYHKTMNGLERERGGSQQVIPAHDHDADGDIDEDDAIMAKE
    MAAQLKQAEQKAKENANAKAPNKPDDPKKVIGVGSAAGGHKEEEDGDLEVEETPEEHQVEVELDLILRKSPVIIFSKSY
    C
    PYSKRAKGILLEKYVIEPAPYVVELDLHPLGRKIQDRLAIITKRTTVPNIMIYGKSIGGGDDVAALDNDNKLAAKIKELG
    GKRVEVSKRFSEKSS

    >gi|171685186|ref|XP_001907534.1| hypothetical protein [Podospora anserina S mat+]
    MSATAFRSRTTPRHAWSLTAARVKHCLAVTSLVWTVSPCVLAMMVAQNTRLKICSPLLSSSSKLSLKLIMPWTKEQTTLW
    PPCTQDKRFIRSHTGGSWLYLPRSVSSWPGVLPCCPAAPKERDGIENCQESCCDVKQQTPAQYGACAGSSATSHHKDRPT
    LSSTAQHQVHSGSRPGGPTCCHEGPSMEPMRTTLDREQGLSTHEHIVLSITGMT
    CTGCETKLHRTLGTFPSIKNLKTSLV
    LSRAEFDLEKRSLVDVMRHVERTTEFKCERVKKGASVDVIVPGGASAFMGERWPKGVTDMALVNDTTVNISYDPQLVGAR
    DLAERGWGVPVELAPPQPDASLSNGSRHVKHIGLMTLASILLTIPVLVLAWAPLHGHEIAYESGSLALATLVQFLVAGPF
    YPKALKALVFSRVIEMDLLIVLSTSAAYVFSVVSFAFLVTGEPLSTGSFFETSTLLVTLIMVGRYVAALARQKAVESISI
    RSLQVNTAILVDFHGDHGREIDTRLLQLGDIFKVMPESRIPTDGTTLAGTSEVDGSMVTGESRPVVKSPGSPVIAGTSNG
    LSPLLVRVTRNPGDNTIDTIAAMVDEAKLSKPTMQRLADRVASYFVPVISLLMIITFAIWIAVGIRVRGVSAREAIIEAV
    TYAITVLIVCCPCAIGLAVPMVVVITTGVGAEHGVIFKSAESIEVAYQAKYVILDRTGTLTEGKLSVVYYDGTDGELVNM
    SLLLELLESTKHPVSLAVATFLKDKGVLSSTVQDIRSLPGKGVQGLGLDGQILQAGNVRWLDVESDLRVQMPQEAGHTVF
    CFTIDGKLAAVFGLQDTLRKETATTIQSLQNRNVAVHVLSGDDDGPVWAVTDQLGIPCSNVRSRCTPADKKSYVEDILSR
    SPESVVIFCGDGTNDAVALAQATVGIAISRSLNSTAELAESAADIVLMRPDLKGILTVMDLSRKSVHRIIFNFTWSFAYN
    LFAVLLAAGAFMSLNNARIPPEFAGLGELVSVLPVILAALLLKRARF

    >gi|171687170|ref|XP_001908526.1| hypothetical protein [Podospora anserina S mat+]
    MPPLHCVNPPATASLFIQLSMCRRAIATSPSILDLLLPLPVRSASGPTRAHHSVSTARTRKIPHQSGPSQIAARSPRSSW
    RPCSPRGNLTRRSFTTTMPRSAATTAPPSGTTRALFNPQTDDDGQEMMLEITPRAAKRLSEIMAKDSNPYLALRIQVESG
    G
    CHGFQYLMKLVTLPPSLPSSSATDGAAESTSAIGEDDTIFTFAADGSSAPTDLTAPKIILDTPSLELLKGSKVDFTMEL
    IGSQFKIVDNPLATSSCGCGTSFDIKI

    >gi|171687485|ref|XP_001908683.1| hypothetical protein [Podospora anserina S mat+]
    MQKVHRIALGLLAAAAIATASDVVQLKKDTFDDFVKANDLVLAEFFAPWCGHCKALAPEYEEAATTLKEKNIKLAKIDCT
    EETELCQQHGVEGYPTLKVFRGLDNVGPYKGQRKAGAITSYMIKQSLPAVSDVTKDTLEEFKKADKVVIVAYVDAADKAS
    SEAFSAVAEKLRDDYPFGVSTDAALAEAEGVKAPAVVVYKDFDEGKSVFTERFEAEAIQKFAKTAATPLIGEIGPETYSD
    YMSAGLPLAYIFAETAEERKEISEKLKPIAEAQRGVVNFGTIDAKAYGAHAGNLNLKTDKFPAFAIQETAKNQKFPFDQE
    KEITLEAIKTFVDDFVAGKVEPSIKSEPIPEKQEGPVTVVVAKSYNDIVLDDTKDVLIEFYAPW
    CGHCKSLAPKYDELAS
    LYAKSEFKDKVVIAKVDATANDVPDEIQGFPTIKLYPAGAKNEPVTYSGSRTVDDLIKFVAENGKYKASVSEEAEEPSAA
    PAASEEASSAEPAAETKEAAKEADHDEL

    >gi|171688003|ref|XP_001908942.1| hypothetical protein [Podospora anserina S mat+]
    NIAHRQPRLASLGLPVTRSNIYQYNNMSTIREITSLSNWEHHVTSLPPSTLLVVSFHAPWAAPCAQMATVLSTLASEYPV
    TEPPSTSWVSINAEDLSDISETYNVTAVPFLVLIRNGQVLETVSGSSAVKVRNAIEAHAAKAGAPVLNGAATATDGHDGE
    VATEEDPEKKKEELFKRLGDLVKAAPVMLFMKGTPSEPK
    CGFSRQLVAILRENAVKYGFFNILADDEVRQGLKEFADWPT
    YPQLWVDGELVGGLDIVKEELSNDADFFKAYSIKSNGETAAAS

    >gi|171688428|ref|XP_001909154.1| hypothetical protein [Podospora anserina S mat+]
    DKKLPEEVDLVTRMQVDESVVGTTEIDESLYSRQLYVLGHEAMKRMGASNVLIVGQKGLGVEIAKNIALAGVKSVSLFDP
    APVAIADFSSNFFLHPEDVGKPRDQVVAPRVAELNAYTPVHIHQSDSLGENLSQFDKYQVVVLTNTPQHLKVLVGDYCHE
    KGIYFIAAETAGLFANIFCDFGNNFTVLDSSGENPVSGIVAGIDEEGLVSALDETRHGLEDGDYVTFTEVEGMEGLNGAE
    PRKVTVRGPYTFSIGDVSGLGQYKRGGLYQQVKMPKFISFKSISAAMKEPEFVISDFAKFDRPQQLHIGFQAVHAFAQTH
    GRLPRPMNDEDALVVISSAKQFAQAEGIEVEWDEKLLKELSYQATGDLNPMAAFFGGLAAQEVLKAVSGKFNPVQQFMYF
    DSLESLPTSVARTEELCQPTGARYDGQIAVFGREFQDKVANVRQFLVGAGAIGCEMLKNWAMIGLGTGPRGKITVTDMDS
    IEKSNLNRQFLFRPKDVGQMKSDCAARAVQAMNPELVGHIVTLKDRVSPETEHIFNEDFWNDLDGVTNALDNVEARTYVD
    RRCVFFHKPLLESGTLGTKGNTQVVLPKITESYSSSQDPPEQSFPM
    CTLRSFPNKIEHTIAWARELFESSFVKPAETANL
    YLTQPNYLETTLKQGGNEKATLEMLLDYLKNDRALTFEDCVQWGRMLFEKQYNNAIQQLLYNFPKDSVSSTGTPFWSGPK
    RAPDPLKFDVNNPTHYSFIVAATNLHAFNYNINVKDKTRQDYIQALESMIVPDFSPDSNVKIQADEKEPDPNAGAAFDDE
    AELSNLIKQLPDPKSLAGFKLTPVEFEKDDDTNHHIDFITAASNLRADNYKIEQADRHKTKFIAGKIIPAIATTTALVTG
    LVILELFKIIDGKDDIEQYKNGFINLALPFFGFSEPIASPKVEYMGPDGKVTFDKIWDRFEFNDVTLQELIDDFKSRGLE
    ISMVSSGVSLLYASFFPPAKRKDKYPMKLSELVETVSKKKIPEHQKELIFDVVTEDADGEDVEVPYIKVKIR

    >gi|171688576|ref|XP_001909228.1| hypothetical protein [Podospora anserina S mat+]
    MASRRLLTLLPRAAALPSPATRPIIATTRLINSRQYHDSQTQTLQGPLYKHLTTTSKPSPTLQKRAYSSDPPADDNHPSK
    IYDFSSLQKLISNPSPKVTIIDSREPGELQQTGHIPSAINIPVTTSPDSFFISPEEFEDRFGFPRPAKDQELIFY
    CKAGV
    RSRAAAQLAKQAGWEKVGEYPGSWLDWFEKGGAVERS

    >gi|171688950|ref|XP_001909415.1| hypothetical protein [Podospora anserina S mat+]
    MQAISILARRPVLSSRTVASGRIGTISRHFSSTVINMAPISKETDFLVIGGGSGGLGAARAAASRYGAKAMVIEGKRLGG
    T
    CVNVGCVPKKVTFNAAFIAETIHQAKAYGFNVQETAPFDWPTFKTKRDAYIKRLNGIYERNLANDKVEYIHGWAKLLSK
    NSVEVTLDDGSKEVVNAKKILIAVGGNPHVPPEIPGSELGINSDGFFDIDKLPKKVALVGAGYIAVEFAGMFNALGVETH
    LFIRYDTFLRSFDPMIQEKVTAEYERLGIHVHKRSLTNKVEKDEKTGKLRLHYNSSKGEGSNGEGVLEDVDHLIWAIGRT
    PAIDGLGLEAAGVKTTEKGHIVVDEYQNTNVENVYALGDVTGHVELTPVAIAAGRKLAARLFGPEQFRTSKLDYDNIPSV
    VFSHPEVGSIGLTEPQAVEKYGAENLKIYKTNFTAMYYAMMEPEEKAPTSYKLICAGPEEKVVGLHIMGLGSGEMLQGFG
    VAVKMGATKADFDSCVAIHPTSAEELVTLR

    >gi|171690126|ref|XP_001909988.1| hypothetical protein [Podospora anserina S mat+]
    MTTLTAPPTTPFTFPSPRDSPAFFPPTPPSTTTPLLTTTATTTTTTKRKHSSISTAPQPPNYKTLINTSPKITPFEKKVY
    HLLLTIPPGSFTTYALMSTHLKSSPRAVGNALRKNPFAPGVP
    CHRVLATGNSLGGFKGKISRKSPDGVGGVDALIEKKEL
    LRREGVKFDDKGRALGTPFRGFK

    >gi|171691192|ref|XP_001910521.1| hypothetical protein [Podospora anserina S mat+]
    MLPSLALLPAIAGLLPSVSAAALSSNAQKIEDRAITPLACLFFGDIVSPWWLNRCKQHLDMVVIDLRSAEEYAVSHIPGS
    ISAPFEPISAWSQMGPGDLLLELPEYNDLAAFLGSIGVGNSPSTATKIVLVNGVGVPAFPQAAGPRVALTLKFAGLSTGR
    VAILDGGFPAWTSESLPSTTEVPVPVPKTFISSPDRSFLVDINYVASKINKNRQGIFILDGRDQAVYNGSVLEEWAQRPG
    HIPSAKNLPTQKVWNPDGSFKSTFELLALLRQQIGYGASRSYGEIIVS
    CGVGGYASGLYWVLTRMLGFDNVKFFDGSAQQ
    WSNEGYPMEL

    >gi|171691540|ref|XP_001910695.1| hypothetical protein [Podospora anserina S mat+]
    MPYDKLVLALGAEPITPKGIEGGDGNQVFHLTTLGDLDSIKEHIKTHSVKTVAVIGGAFIGLEAAENLRLLGLEVTVIER
    LSHIFPPADADMVYPLEKELNAHGVNLITNATVTKILPQEVELAPSGQQIPAELVIMAAGVRARLSIPQAAGLKTGKTGL
    TVNEHMQTSDPNIYAVGDMVETPNLLLLGLDHPDKNKMLALAGPANRQGRLAADHICGKETKYRGNIGTWVCKVFGKAVG
    MTGLSAHQLDEISGSNHDWVTVHPVNHAGYYPGSCRLTVKIHFDLKNGKLLGGQVTGPENAGVDKQTDVLAVALTAGMTV
    EDLEHLELAYAPPFGSAKDAVNMAGFVAGNVLRGDVEIVHAADFAFETSKGRRKSLEDYFLLDVRSPKEFASGHIDGAVN
    IPLGDLRKRLDEVPKDKPIISY
    CQVGYRGYLGYRILKQDGYDAVNLDGGYRAVFEGGFDDGLKPVVKRWAPN

    >gi|171692341|ref|XP_001911095.1| hypothetical protein [Podospora anserina S mat+]
    MDVTLFVYDLSRGLARQMSAGLLGFQIDAIYHTSIKLNGLEYVYDGNVVAIRPGSSHLGQPEQQLHLGTTDLPMEVIEEY
    LDSLREIYTVQAYDLWKHNCNNFSNDFAMFLLGKGIPEHIVNLPQTVLDSPFGQMLMPMLNQQINSNRRQGGILGIQQST
    PGSSVKPKFQLHQHTGKVHNVATLTELDQLLARHQHSCAAVFFTSAT
    CPPCKLVYPLYDELAAEVGDKGVLIKADISQAF
    DIRSRYSVRATPTFITFLKGKQENQWTGADPATLRGNVQLLVQMAWPRHRHESLDLPTISNRNAKPVLYTRLPPLAKLLA
    KLPAETSSNPSVRDMKRFLETRAAEGPAEATLPNIPGFLSFVNDSLAKIEADKLFPLIDLLRCALVDPRVSSVLAEEQDC
    KTVLSILRLVNNAVESCSCPYPLRLVTVQMSCNLFSSHLHEDAILSHQALRHAITELTTACFRESETATLRVSSAGLLYN
    LALANSKKRRAGPGDALPGEEQAALAGSVLEAIGGERESAEALEGMLNALGLLVYLLPQEGEEMGEMEQLLVIMEAGDVV
    KGKGMVEGFGGLKGLVGEVGELLGKGLRKA

    >gi|171692591|ref|XP_001911220.1| hypothetical protein [Podospora anserina S mat+]
    MSFFFRRFFSSATSPATMDAAQKKAQQLIDDNAVMVFSKSYCPYCNNTKRLLDSYDATYKAIELNQEDDGDDIQAALAKI
    TGQRTVPNIFINKQHIGGNSDLEAVASKGKDGKKLEELLKEAGAL

    >gi|171693453|ref|XP_001911651.1| hypothetical protein [Podospora anserina S mat+]
    MTSSPWTACKGQEYPLSNLKDKVILIVNVASKCGFTSQYAGLQELYKNITAKHPDQFVILGFPCNQFGGQEPDAEAEIVT
    FCERNFGVTFPIMQKIEVNGDNAHPLFEWLKEQKSGLLGLKRIKWNFEKFLIGKDGQVKGRWASVTGPASLEKEILAELE
    K

    >gi|171693715|ref|XP_001911782.1| hypothetical protein [Podospora anserina S mat+]
    MASPPKDLAPDVPTTTVTPDTTVTESGAGAAAAKPETNTTLGGDGAGTTTRRAATFSVSPSQSQQQSGTNGGSGSGGGSV
    KSAAANRNSTADIDTTNPLDFSEDVSADNSLPTLATLKKIDNYIVLDRNGKSHTFRSLYTGRHVARRVLLVFVRHFY
    CGN
    CQDYLRTLSSAFSPSDLLGLPIPTFIVVIGCGDPGLIDMYTSETGCPFPVYTDPTRKLYAELGMIRTLALGERPAYTKTH
    LVRSSLASVVQGLKQIPKGLAHKGGDSRQIGGEFLFEPVGGEDVASPIKELGEWVRGERAGNGDGESVKMGVRHRASETP
    SIDGKNMELGGDGSEGVDKIVSWCHRMRNTRDHAEVPELMEVFGMAVGEMEKIPGDVKGLERERWERAIRERKGVGLGGK
    GRGSLER

    >gi|171693909|ref|XP_001911879.1| hypothetical protein [Podospora anserina S mat+]
    MFARTILSRQLLRPAFAAPAAARTSFLTSIQTRFLSDQTRQAIDKAVSSAPVVLFMKGTPETPQCGFSRASIQVLGMQGV
    DPAKFAAFNVLEDNELRQGIKEYSDWPTIPQLYIDKEFVGGCDIIVSMHQSGELAKLLEEKKVLAVEAEAAEEEAKKE

    >gi|171694181|ref|XP_001912015.1| hypothetical protein [Podospora anserina S mat+]
    MVLLKSFMLAGLTAVVAAKSAVLDLIPSNFDEVVLKSGKPTLVEFFAPWCGHCKSLAPVYEELAHAFEFTKDVQIAKVDA
    DAERSLGKRFGVQGFPTLKWFDGKSDKPTEYNGGRDLEALTAFITEKTGIKSKKKLAPPSSVTYLTDATFKNTIGGDKHV
    LVAFTAPW
    CGHCKSLAPTWESLATTFANEPNVVIAKVDAEAENSKATANDYGVTSYPTIKFFPKGSTTPEDYNGGRSEEA
    FVAFLNEQAGTHRAAGGGVDATAGTFAVLDEIVTKYIGGTPLTDAAAEVKKAAESLKEDAQYKYAEYYIRVFDKLSKSDS
    FAAKELARLEGILKKGGLAPTKLDELTTKTNILRKFVEKVTGKDEL

    >gi|171694808|ref|XP_001912328.1| hypothetical protein [Podospora anserina S mat+]
    MSTCPFILTKLFTPFSRAAIAKSPNTHSLLKKMGTSASASAATQKEYPEGAARATVAAGCFWGVEHMYRKHFGSKGLYDA
    RVGYIGGNTQDPSYRAVCSGNTGHAEATLLVYDPTKISYTDLLTFFYRMHDPTTSNQQGPDRGSQYRSGIFYHDAEQEKT
    AREMTKKANEQWWNNKIVTEILPAQKWWDAEDYHQEYLTKNPYGYECPSHFLRTFPDLQ

    >gi|171695016|ref|XP_001912432.1| hypothetical protein [Podospora anserina S mat+]
    MKTAARLFYLSVFALWSPEVQCQNSQPSASPPAPPQDACAISPKAIVSDACASYSTLERLNRNVKPALDELTQTTDFFSH
    YRVNLFHKKCPFWNDENGM
    CGNIACAVETLDNEEDIPPVWRAKELGKLEGPRAQHPGKAVQKQEPVRPLKGKLGEGVGES
    CVVEYDDECDDRDYCVPEDESATSKGDYVSLLRNPERFTGYAGDGAKQVWDAVYRENCFQRSSFPHYAALGKDTSARGPA
    AMDFKAVLDAAGRQHVLEQTREHNPLTPFVANTGLEAEDECLEKRVFYRVMSGMHASISTHLCWDFLNQTTGQWQPNLAC
    YKARLHQFPDRISNLYFNYALLSRAIAKLGPYLTAEQGYTFCTGEPAQDAETREKVLAVTTKAASVPQIFDESLMFKNGE
    GPSLKEDFRNRFRNVSRLMDCVGCDKCRLWGKLQTAGYGTALKVLFEFDNNDHPQVPVLKRTELVALFNTYARLSSSMSA
    IQKFRGMVEAEDNKGAKKVVVNKILSVGPIKKALDEQDVDEVETKREERIRREPKSSSEAMAEEWENIKKVTMFVLKGWI
    SFPAKAWVVLSQEAARFLQFFLGLPVTPRTWTLEFPRVDEL

    >gi|171695358|ref|XP_001912603.1| hypothetical protein [Podospora anserina S mat+]
    MAPPQSQSLSAPPAHMATTTLKVEGMTCGACTSAVEAGFKGVDGVGNVSVSLVMERAVVMHDPQRISAEQIREIIEDRGF
    DAEVLSSDLPSPVAPRNSFGVFPTDDGPAMMVTTVKIEGMT
    CGACTSAIEGGFKDVSGVKHFSISLLSERAVIEHDPALL
    AADAICGIIEDRGFDAEVLESTEKQQEADALVDSGKTASTAATTTVAIEGMT
    CGACTSAVEEGFKNLDGILRFNISLLAE
    RAVITHDPIKIPADKIAEIIEDRGFDTKILSTVFESSDSSSGGSSTAQLKIYGNLDATAAQGLEEKLLALPGVSSAKLAP
    SSSRLTVVHKPNVTGLRVIVEAVENTGFNALVADNDDNNAQLESLAKTKEINEWRRDFRISLSFAIPVFIISMILPMCGP
    LDFGSIRLIPGLYLGDVICLGLTVPVQFGIGKRFYKSAYKSMKHGSPTMDVLVVLGTSCAFFFSVMAMLVSILMPPHTRP
    ATIYDTSTMLITFITLGRFLENRAKGQTSKALSRLMSLAPSMATIYADPIAAEKAAEGWNKETSAGDANQPLDGSAAEEK
    VIPTELIQVGDIVILRPGDKIPADGTLVRGETYVDESMVTGEAMPVQKTKGSNVIGGTVNGHGRVDIRVTRAGRDTQLSQ
    IVKLVQDAQTSRAPIQRLADLLAGYFVPSILFLGLMTFLVWMILSHVLSHPPQIFLEEASGGKIMVCVKLCISVIVFACP
    CALGLATPTAVMVGTGIGAENGILVKGGAALETTTKITQVVLDKTGTLTYGKMSVAKTTIVSAWENNQSVRRLWWTIVGL
    AEMGSEHPVGKAVLGACRTELGLGPEGTIEGSVGDFTAAVGKGISALVEPAVGGERKRYQVLVGNVKFLRENNVDVPESA
    VEASEKINTAANSSSSSPSSPAPVRKAQAGTTNIFISINGSYSGHLCLSDTIKENAAAAIAVLHRMGVKTAMVTGDQRPT
    ALAVAAAVGIPPADVYAGVSPDQKQEIIRQIQDSGEVVAMVGDGINDSPALATADVGIAMASGTDVAMEAADVVLMRPND
    LMDIPAALHLARTIFRRIKMNLLWACMYNAVGLPFAMGLFLPLGWHLHPMAAGAAMAGSSVSVVVSSLFLKFWKRPRWME
    EGGLKPKGVVERMGDGIVSGMEGLLGVFTGRKGARGEGYVPLDDLENGGR

    >gi|171695620|ref|XP_001912734.1| hypothetical protein [Podospora anserina S mat+]
    MHHPTLCAVAVALLSALPGAQAGLYSKKSPVLQVDAKSYDRLIAKSNHTSIVEFYAPWCGHCKNLQPAYEKAAKNLAGIA
    KVAAVDCDDDANKQFCGQMGVQGFPTLKIVRPKKGGGKPMVQDYNGQRTASGIVEAVVQAMNNHVVKVEDKTLDKFLDDE
    KDAPKALLFTDKGTTSSLLKSIAIDFLDVITVGQVRNTQAKAVEKFGITKYPTLILLPGGDAPAVTYDGELKKEALVTFL
    SQAGAPNPDPAPAKPKAAKKEKKSEKKTEKKTEKKAEKKADSSESSSTAESEPEVPTQEAPVIIEKALPIPTINSQEKLI
    KECLTEKSHTCVLAFVSNSESDLAKKALDSLAQLSFKYAQGKRNLFPFYEVPTSINGAAPLLKALDLTNEVEIIAINARR
    GWWRHFEGADFAHTTVESWIDAIRMGEGSKKKLPEGIVAISVEQPTPATPEPEADPTAADTPDATEAATSEEPTPLTPEE
    NATRVPPESSATEATDPEPECQTGAAEQCGARPAAEHDEL

    >gi|171695816|ref|XP_001912832.1| hypothetical protein [Podospora anserina S mat+]
    HATAQLRLINSKVLIIGAGGLGCPAAQYIAGAGIGTIGIIDGDVVEPSNLHRQVGHATSRIGMKKVDSLITHLRDLNPLP
    TYVPYTYPISHENAADIITLYDLVLDCTDNPATRYLISDVCVLLCKPLVSAASVQKSGQLIVLNCPPTPQGKMDRKYPPC
    YRCCFRKPPPANTQLS
    CGEAGIMGPVVGLMGVAQAGEAIKILASALHLPQSSSDTTTEDDPHNLIQPTLLIYSYDLNAAP
    GPYTFRALKMASRKKNCFACGENSPQTLTLEGIKSGNPNYIQFCGLQTRKATLPAQDRITASAYHAARESGQLQNHILLD
    TREKEHFSFGSIDGAVNVPFGKLLMKAATIKRDGGDAQEILPLKSAEDPIFVVCRRGLDSQEAVEKLKELGVDHGGKRKI
    VDIIGGMRAWKDEVDPSFPFI

    >gi|171696308|ref|XP_001913078.1| hypothetical protein [Podospora anserina S mat+]
    MSSTHDSKPIEVTSSAQFQTILQTNALVVADFYADWCGPCKAIKPIFEKASEELSHENVLAFIKVNTDTQKDIAQAYNVT
    SLPTFIYFRNGQITSRVKGADVQKLSGMLETIRGHFQEAIENPGGAAGGSSSSGATWRGAELPRGYTDITDQIEINRCEL
    LNVESGPEGVRTLLDKSRPSALSGQKSATKDWVESDTDEQLMLFLPFQAMIKLHTLQITSLPPSDDDDDEAPMRPKTIKL
    FTNKSHNLGFDEAEDMSATQVIELSEKDWNPDGTANISLRYVKFQNINSLVLFVVDGDGDSEKVRLDRVRLVGEAGEKRE
    MGKLEKIGDE

    >gi|171696330|ref|XP_001913089.1| hypothetical protein [Podospora anserina S mat+]
    MPSLKEQLKLRIESEVQTQIHVGRSFAMRLETRAYSDLHGTNEVNSGPLSLKGRGNAISISPREQLQAVSAHWSSNPSFP
    SNLQPHLRPNITTQSQHHQPLPSRPYHLHITAITMSAGPVHPSSEPARWKYLDRIRTRPGPFTTPEMFSGETSAEAMDKM
    KILVIGAGGLGCELLKNLALSGFKNIHVIDMDTIDISNLNRQFLFRQSDVGKFKAEVAAAFVEKRVKGVKITPHNCKIQD
    FDEDFYMQFQIVVCGLDSIEARRWINATLVNMVDETVEDSYKPLIDGGTEGFKGQARVILPTITSCLECQLDMHAPRAAV
    PL
    CTLASIPRQPEHCIEWAHVIAWDKEKPFPQLDKDDPEHITWLYQKALLRAKEFNISGVTYSLTQGVVKNIIPAIAATN
    SVIAAACCNEALKIATNCAPYLGYPENNYMMYSGNDSIYTYTFKHEKKDDCPVCGVSARELAVDPKWTLQELVDSFAARP
    EAQLKKPSVRAEGKTLYMQSPPSLEEQTRPNLEKTLAEGLGLMDGQEIGVTDPAFATVSFKFRLKFT

    >gi|189091824|ref|XP_001929745.1| hypothetical protein [Podospora anserina S mat+]
    MANDTQDRDEQATTAAAANTSQPLPKGVVLGKDGKPQAKTMTALSTGKPVPAVKKRTDCPPDVVALGRSSWTLLHSIAAT
    YPEKPTPSEQSDVISFMKLFSKLYP
    CWVCAEDFQEYIERKQIKAGSRDEFGNWLCEAHNGVNKKLGKKTFDCSRWLERWR
    DGWKDGSCD

    >gi|189091844|ref|XP_001929755.1| hypothetical protein [Podospora anserina S mat+]
    MLSQRLLLGRTAVRSALKPSGSPIALASRWSRTYASQSEEKDLVIIGGGVAGYVAAIKAGQEGMKVACIEKRGTLGGTCL
    NVGCIPSKSLLNNSHLYHQILHDTKHRGIEVGDVKLNLQQLMKAKETSVTGLTKGVEFLLKKNGVEYIKGTGSFQDEHTV
    KVELNDGGETSVTGKNILIATGSEVTPFPGLTIDEQTVISSTGAIALEKVPEKLVVIGGGIIGLEMASVWSRLGSKVTVV
    EYLDQIGGPGMDTEVAKGIQKILKKQGITFKTGTKVLSGEKTGDEVKVQTEAAKGGKEETLDADVVLVAIGRRPYTGGLG
    LENIGLELDERGRVIIDAEYRTKIPHIRCVGDATFGPMLAHKAEEEAVAVVEYIKKGYGHVNYGCIPSVMYTFPEVAWVG
    QSEQDLKKADIPYRVGTFPFSANSRAKTNLDTEGFVKILADPETDRLLGIHIIGPNAGEMIAEGTLALEYGASSEDIART
    CHAHPTLSEAFKEAAMATHAKAIHF

    >gi|171688766|ref|XP_001909323.1| hypothetical protein [Podospora anserina S mat+]
    MAQHSPHTQTALLKWVNTFDTRRKAGSLQDLRDGIILGQILEKMLAPEFQSSSLIQAPRSESDKKQNLETVYRGLARFLR
    TDNPLLAPSPSEFRAIAENPDDNALCEFLSAFLTAACLGSLSRTYVPKVLTLDKASQGEIAKIISQKSQLKEERESKRGE
    GDSGEEEDLDIQDARDPELMQEELDQMRDKVEILKKQNADLQTRLDKLLDTREAVLHDLRVSQDELQTLKRTRGQDASVA
    IRDMRNEVREKMDEIDRLEVLLDKETARAARLEKENETLRAKAERIVELQDKVTLLEHETKQQQQMIKGLENYKKKAQDL
    TAIQQRNRILDEQVQQYEAEMKLFEEVKEQNRRLQKEVDEKVRVLSSNEQEIIYTLQSKNVLQDTNEELKRKVEYLESKR
    QLDEATIRELQEQLQLGDIMQPSGSESPGAGATKFSLEHELEGTSDPTVALRLEVQKLKAENNLLRNNMAVASENERLRN
    ELDLAGQRVDHYRETATDEMEKHAVAQEQIEALIANAIIHEELLLETTKE
    CEAARKRIVELEQLTNDREREIIQVKAELE
    AVGQEQSEALEVLKSSDELISASLRTELEATRKQLKHKVFELEQMKDQLMGVLVSKDKTQKRLDDALAAAAPNGQQQADE
    ATPAKSKKEDAEKIEKLKTALKQKLEQLEKSEQDKYELQRKLKVMENGGAYAAQKAANDQIIKTLQKENAMITTAWYDLS
    SRLQSNHVVLARRQDAPKSWINKQRQMVNATPRR

    >gi|171680097|ref|XP_001904994.1| hypothetical protein [Podospora anserina S mat+]
    MSQPAMRATINVLPRAATRQCLRSLSTASNMAARRPTTSCLPKPQTQTYQPLVQRRFKFKTVEEAKSRYRSGPFSWKAGI
    LFLMTGAGLLFYFEKEKERMQRKRIAESTKGVGRPKVGGPFSLIDQNGNTVTDEDLKGRYSLVYFGFTH
    CPDICPEELDK
    MARMFDLVEEKRPGVLAPVFVTCDPARDGPKELKEYLAEFHPKFIGLTGTYDQIKAMCKAYRVYFSTPNEVKPGQDYLVD
    HSIYFYLMDPEGDFVEALGRQHSPDQAAKIIVDHMKEWKGPLKKA