Plasmodium falciparum

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|124504737|ref|XP_001351111.1| thioredoxin-like redox-active protein, putative [Plasmodium falciparum 3D7]
    MACQVDNPPKTYPNDKTAEYEKYANYMNYLYYYQNNELKKIDSSYFKDKYLGLFFGASWCKYCVTFIDSLNIFKKNFPNV
    EIIYIPFDRTYQEYQSFLKNTNFYALPFDNYLYICKKYQIKNLPSFMLITPNNNILVKDAAQLIKTDEYINNLKSLIKNY
    IIHPKTFQFNNRFFDLFRN

    >gi|124504757|ref|XP_001351121.1| PfGLP-1, 1-cys-glutaredoxin-like protein-1 [Plasmodium falciparum 3D7]
    MIMKNKYGVFFSLSKNAIINSNRQLFPFKKVSKINFSNSADDKNNGVIPEQRTQYSGTNEYKDFEKTEVYQTLKIKIKEL
    LEQEKIVLFMKGTPEKPL
    CGFSANVVNILNSMNVKDYVYIDVMKNNNLREAIKIYSNWPYIPNLYVNNNFIGGYDIISDL
    YNRGELEKIIK

    >gi|124504793|ref|XP_001351139.1| glutaredoxin, putative [Plasmodium falciparum 3D7]
    MAGTSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFI
    NKDVVGGCDDLVKENDEGKLKERLQKLGLVN

    >gi|124505107|ref|XP_001351295.1| HesB-like domain protein [Plasmodium falciparum 3D7]
    MFNNFLNMYMCTLAEKLCKFKKNNFNNIHRNNNFYRDNNFYRDNNFYRDNNFYRDNNFYRDNNLYTNNNLYRDNNFYRDN
    NFYRDNNFYRDNNLYTNNNLYRDNNLYTNNNLYRDNNFYNITLRKFHFIQTISNNNFNFEIIKKYGDVINKIMFIHTQKK
    NKQERFMFNNKKYIKRKEYILNDLNEFISIIPHPEINNEITNNSNQKKNKDNKQNVLSTNQQIITNYNLNHKENVTSNLN
    FNNKEEDEKKLDKLLKKRNIKKRDIVTITEEAKEELKKIISINKKENNNNYNNMNTICSDNHNDMNTICNDKNILKLFFI
    TKG
    CNGLTHSFNFISKKDIHKEDEIIYDDQNNILLVIDKNCILYVINTTLDYYKDDLTEKFIFKNPNITSICPCGTSFHF
    SKKK

    >gi|124801006|ref|XP_001349582.1| hypothetical protein, conserved [Plasmodium falciparum 3D7]
    MLKFLSTKCKQFNSLNHIIKHKIYFPSKSNKSYFSSSVKDVEKKNKEPIIQLTNDAINKMKEINLKYKNSKALKVCVEAG
    G
    CSGFQYSFSLIDKNKIKDKEQIVYDKDCIVVIDKQVIDILKNSKIHYINNLISKKFTIENIQNISSKCSCGNSFDIDFV


    >gi|124802067|ref|XP_001347351.1| hypothetical protein PF10_0066 [Plasmodium falciparum 3D7]
    MNNSVTRKIEKQILEALKDKENDIDKEIRKYEILERKVYDENDEELEFIKNKRLEELKNKHKEKLTLLKKGHGTYKEVLS
    EKEFFEICKSSKNVCCHFYRNTTWR
    CQYMDKKLIDLSSKYWNINFIKINAEKSPFLCERLKIWCIPTVMLIQNGKTEHSI
    VGFDELGGDNFSEQTLVNVLRKWRLIETKENDD

    >gi|124802661|ref|XP_001347552.1| merozoite capping protein 1 [Plasmodium falciparum 3D7]
    MAQLAENTVLDESIQKVEVLNHNGETTSFYNEVEKHKENNEGIVVFTYPKANTPGCTKQAELFKEKHEEFVNNKYVVYGL
    SADTAEDQLKWKEKLELPYELLCDVDKNLLKLLGLTNEEDKTIRSHLVLKNDFTVSYVKKSVSPGKSATQVLNFLVNGDD
    GGDGNEEEENEENNNNEDKDNNENDEEGDVQGEGEGEGEGDEEKTADTDKEKPKKSSTSTQKKKGSVSSTISKKSVKKSN
    KVVKKNVKVKKEIKKKTNKKADNKKGKNVNNKLMKSNAKGANKKGGKKNSVVKKEDNKKKGKNNKKKNKNQNLKDLKKKN
    VKSGKGSVSSSNKKLPKGLKNAAKKAGKKIDKKKEQANKKNNNNKNKNKNKNLSKGNNMKHNKKPAKKVVKKK

    >gi|124803627|ref|XP_001347774.1| heat shock protein DnaJ homologue Pfj2 [Plasmodium falciparum 3D7]
    MNVTNVVKRRKKLSYFHSLLLIIFSFFLSCARGMDYYKRLGVKRNATKEDISKAYRQLAKEYHPDIAPDKEKDFIEIANA
    YETLSDPEKRKMYDMYGEDYAQGGMGGGSPGRGEHAHGFHFDQDVVNEIFKQFAGGGGAGASGGRAGNFHFKFTSGGPSF
    NHFEDEYEDIYKNEVLKINSKNIESVLNDISFSLIINFYSPT
    CSHCISFKKKYLKLRKKFDGYITFAVVNCQEENMLCRK
    YNVKSLPQLILMRSDKTYETFYGNRTDENLTYFIKNNIPSAIIECNNQKKLDNFLTQNIEIPKVLFFISHNDNIVMLKAL
    SLEFKKRINIGIIYNTNYSVMKLFKKKNIKTPSLLLVDDIDSLSGDLTQLKNFDFNILSLKLSHIVAQNRLKNNLYGHVT
    SYQELTKKKYESGQCHEKDSQICFFILKLLKKNYKSFDEDIKKVANKFSSDPLKILYINIYQQPYILDSFGLSNNIQYSN
    GLILVAFRPKRQKFKVYDGDVNVENVHKFVDNVVSGGIPINQNIKRSLKFVHVEQYDDEL

    >gi|124804169|ref|XP_001347922.1| endoplasmic reticulum oxidoreductin [Plasmodium falciparum 3D7]
    MKICLIPVFLSLIIYVILFLKGKKIGDLYITEHLRNKFENILLYFNIFEVQYPESYLNNEKLLGLHVRDIEKDAYRAYPI
    LKELKQKDYFRIFKVNLHLSCKVFLKGNEK
    CKEIKKCSVCECEQDEIPYNFRTNEIEIIENKMTNEDLKKTFIESKLYKD
    ILGIYAPSNEGFISYVDLVYNSPSFTAYEGRNIWNMIYKENCFQNEKSECEEMNSFYKIISGMQSNIAVLSSEYFYLKND
    FLFGEIQINNKFNNDYFKNLNYDYSVTFFKEKIGLYPERIENLYFTFAILLRSMCRLKSLFKQCKCNSGYEQNDKEAVRL
    LDDLLENFYHSCSSKEFLEPLFPQHGKDILSKFMNITNILDCVPCVKCRLHGKLKTTALQIALVEGVSDEHIGSLERNEI
    TALINALYYFADSILIINKTD

    >gi|124804507|ref|XP_001348023.1| protein disulfide isomerase related protein [Plasmodium falciparum 3D7]
    MKVYNFSFICISLIFVFIKRSLGLYTNVAEIETVDNPKRLEELLNLKKVYLVQFYATWCRVSRGFSNDFINIAKTLKDDV
    KFIAIKNESILNEYKITEYPTMHLIFGNEHNNKKEVEKFDGKYKIKDVVSFIYEGIKNYRLKELNIDTSKKSSYKKKSKG
    KNDGKVIILNDSNFDQNVIQYDDNVWFVFFYAPW
    CGHSKPIHPMFDELAKKVAHLKNAKIAKIDATVEQRTAQTYQINHY
    PSFRLFPSGNKKPHTAIDYNDSRTVDDLYHFFLKYYVEKKELIQLTSQQVFDEFCEKDVCLLALLPNKEDTEPSYFKSYV
    HILSNVIKDVNHLPVTLLWTQAGDQLDIVQKLNLTFGFPTVIALSLSKNVFSILKGNYSEQSIKNFITQMMMGKSSVDNL
    VPFKVKNVPKFSFNASNDINTEL

    >gi|124805556|ref|XP_001350473.1| hypothetical protein PFL0320w [Plasmodium falciparum 3D7]
    MNKYCTLKEQKKYNHLIESDKLYDIIKNKEECLLFDTSYYNIHNINNEDIFDDYDNVESIEGSIPMNSIISHNENSNFSF
    FFPTKNEFFIYLKNILIKNKRNITMLLENIPIILYEKEDIFYSPRIWFIFKMYGFKNVQILNGGLNKWIHEEKEIIHVNN
    EKKIIEEHINKQTIEQNEYYISHINNLLEKHFKKNENYINKNIMNSIYYYEDIQNLIKLKEQKQMQNYLLVDTRPNKSFS
    TLISINENIKVNNFIPFSINIPYNHFLNYHYENYKYVTFKNMKDIKILLEKYDLLNDQKIIIST
    CNKGISACLILFLLNL
    FDKPFSKLILYPGSLVEYNFYKYERN

    >gi|124805752|ref|XP_001350528.1| glutathione peroxidase [Plasmodium falciparum 3D7]
    MFFSMFIKFILPISFICYNFGKKFNMFSYFQKIKVSEQELLSSIYDYEVKDLSGSNVSMSKFKNKVLIIFNSASKCGLTK
    NHVEQFNKLHEKYNARGLEILAFPTSQFLNQEFDNTKDICTFNEKNKIKYNMFSPIEVNGDNTHPLFKYLKKNCDSMHDE
    NGTLKSIGWNFGKFLVDKNGEVVNYFSPKTNPLDLEKIIIQLLQK

    >gi|124805845|ref|XP_001350554.1| thioredoxin peroxidase [Plasmodium falciparum 3D7]
    MFLKKLCRSNFFGNSRRSFSLVTKKAYNFTAQGLNKNNEIINVDLSSFIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKD
    FENKNVELLGISVDSVYSHLAWKNMPIEKGGIGNVEFTLVSDINKDISKNYNVLYDNSFALRGLFIIDKNGCVRHQTVND
    LPIGRNVQEVLRTIDSIIHVDTSGEVCPINWKKGQKAFKPTTESLIDYMNNANKNV

    >gi|124806199|ref|XP_001350655.1| ubiquitin-activating enzyme e1, putative [Plasmodium falciparum 3D7]
    MQNKTPPLKKQRTDESVKPIEFDKSSESWKRSDCLEKMTENKIDTDLYSRQLGTYGFDLMNKLVKLNILIINVKGVGLEC
    AKNLILSGPQSVCIYDNDICDISDIGVNFYINEKDVEDKSCRSDAVLKELQELNNYVHIYNYKGTIEKNWLENFDVVICC
    DINKEDLIKYNNMIRGIDKKRIAFLSCNIYGLCGYIFVDFNKEFICYDSNGEQVKSCNVSKISKELEGKVSFDFDKTSPF
    EEGDYVQFSNVEGMTEINNKIYKIKNLKKYTFEIGDTSLYSEYIKGGICTQVKKHLKLNFYPYEYICVNPLNNENISNNE
    QKHNQNDNHFLDTCNNIIYENIPQPNSFIISDYAKFDMSNHLHYSIQALKWYELQNEKGLPENSDEDALEKIYNYAVTLN
    NKDKEEKKSYAVEQLKKDVVYNVCRYSKSHIAPVASFFGGLLAQEVIKFTGKYMPIYQLLYLDFFECISLNEKVDINEIK
    KMNCKNDNIITVFGKSFQKKLNNLNVFLVGSGALGCEYAKLFSLLDMCTRNSEQNTNLNQNNIDNNLACCGKLTITDNDN
    IEVSNLNRQFLFRREHVGKSKSLVSSEIIKKKNNNMHVQSLETKVGAENEHIFNEEFWTKQNIIVNALDNIQARQYVDNK
    CVWYSKPLFESGTLGTKGNVQVIIPYLTQSYNDSYDPPEDSIPL
    CTLKHFPYDIVHTIEYARDIFQGLFYNTPLSIKQFL
    NDKEEYINKIQEEGNNASLLENLQNVINSLKEISSQCNFDFCIKKSVELFHNNFINQINQLLYSFPLDYKLSSGEYFWVG
    QKKPPQPIVFDVNNEMIQEFLLSTSNLLAQVYNIPPCFDINYIINVAKKIEVKPFEPKKVKINMDEKNLNNISISFAEEE
    KIIDDFCKELLNIPTNNIKINPIEFDKDEQTNLHVNFIYAFSNLRAINYKINTCDKLKAKIVAGKIIPALATTTSIITGL
    VGIELLKYVNYYDNIQAYVKLSDEQRKKEKHDVLSYFKNAFINSALPLFLFSEPMPPLRMMDKEYDELMKGPVKAIPNGF
    SSWDKIVISIKNGTIKDLIDHINEKYSIDVNLISVGNACLYNCYLPAHNKERLNKPIHELYKQISKQDLLEDKNYIIVEA
    SCSDQDLVDVLIPSIQFIYK

    >gi|124806416|ref|XP_001350716.1| lipoamide dehydrogenase [Plasmodium falciparum 3D7]
    MYIFFPFFCSYDVIVIGGGPGGYVCSIRCAQNKLNVLNVNEDKKLGGTCLNRGCIPSKSLLHISHNYYEAKTRFKECGIL
    VDNVKLDIETMHKHKNKCMGNLSDGINFLYKKNNVNHIIGHGSLVDEHTVLIKTEKEEKKVTAERIVIATGSKPIEIPLK
    KLNDNNFNDADNVNDILEYDHEIIQNSDDILNFKKVPHNISIIGGGVIGLEIGSVFSKLGSDVTVFEYNERLCGFLDADV
    SKVLQKTLEKIKMKFVFNTSVIGGNIENNQAALFAKNKKTNEIKKTTSEIVLICIGRKANFDNLNLHLLNIELNKNKKIP
    VDEYFNVIAQPTIKAIGDAIDGPMLAHKAEEEGYLLANILFDELKNNKKKKAHINYDLVPSVIYTHPEVATVGYNEAKCK
    ELNMNFKSVSFPFAANSRSRTIDDYDGLIKLIVEKDTNRILGSQIIGNNASDLILPLSIYVANNGSSKSLSKIIYAHPTF
    SEVIKEVALQSFDKPIHM

    >gi|124806587|ref|XP_001350764.1| ubiquitin activating enzyme, putative [Plasmodium falciparum 3D7]
    MHKTIRKLFSDEVCDKIENMKILLVGAGGIGSEFLKNIITIGCKNIDIIDIDTIDITNLNRQFLFKKKDVKKYKSLVAKE
    RALMHKKDLNINAYTFDVCTMKSSDIKKYDYVINALDNIKARKYVNKLCIMEKKVLIEAGSTGYNGQVYPIYYNHTKCYS
    CEEKPKNKTYAI
    CTIRQTPSLPEHCVAWGRLIFETFFCKNDNETLIDIKNHIEEESKKRNMDKKEIIIFIFNYLFNDTIK
    ELIYLKKDYTTIPIPIHFEWDENIIDLFEDESEHNQNEINIDKLNDNKNNMGDNKYYCNNFKCEEKDREKDDNVLMLSSQ
    NIWDKKKCIEMYIKTFLKLYKYLNINKKEEEYLIFDKDDDECINFITSISNIRMLNFCISQKSKFDIQSIAGNIIPAISS
    TNAIVASLQAFQLIHVIEYFETLKNKNNKKNNNNNKKNNNNNNNNNNENNVSYCDEEENKTDHFNIRNSKAKHVWVKSIV
    NGNKIFSRGNLVNAEPLEIPNPNCYICQQPTIHIYIKNFEKMTLYNFVKDICMNELSFLYPFLDKDDRNIFDYDLFQEND
    DDYIQNLYASLSYWNIKHDEILLLTDFQNNNDQLEMHLKEDPSLETEYFIQQKNVPSKKRKINYMQVEGNMDTESVKKKR
    HILSDEHKETNDEKQPTKKRKQDLIKVEEIIIDDEESDNQNVVLID

    >gi|124808622|ref|XP_001348365.1| glutathione reductase [Plasmodium falciparum 3D7]
    MVYDLIVIGGGSGGMAAARRAARHNAKVALVEKSRLGGTCVNVGCVPKKIMFNAASVHDILENSRHYGFDTKFSFNLPLL
    VERRDKYIQRLNNIYRQNLSKDKVDLYEGTASFLSENRILIKGTKDNNNKDNGPLNEEILEGRNILIAVGNKPVFPPVKG
    IENTISSDEFFNIKESKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRKFDESVINVLENDMKKNNINIVTFADV
    VEIKKVSDKNLSIHLSDGRIYEHFDHVIYCVGRSPDTENLNLEKLNVETNNNYIVVDENQRTSVNNIYAVGDCCMVKKSK
    EIEDLNLLKLYNEETYLNKKENVTEDIFYNVQLTPVAINAGRLLADRLFLKKTRKTNYKLIPTVIFSHPPIGTIGLSEEA
    AIQIYGKENVKIYESKFTNLFFSVYDIEPELKEKTYLKLVCVGKDELIKGLHIIGLNADEIVQGFAVALKMNATKKDFDE
    TIPIHPTAAEEFLTLQPWMK

    >gi|124809175|ref|XP_001348508.1| NAD(P)H-dependent glutamate synthase, putative [Plasmodium falciparum 3D7]
    MGKENIDNKGLYDSRNEKDACGVGVVADINGKFSRNVIQKALQILLRLSHRGGVQGNNGDGAGILVGIPHEYFQMLSDTC
    QLPFLLPEKGEYAVAQIFLPQNEERRLFLYHEIEKEVYNHGLVVLGWRSPIPVRRDVISCSVKKSEPFIAQMFVCKRSVF
    KNYDDFNIYPFSDINFTDDSNLKLNELPDDIELLSFFIRKKLVRHNDMYFCSFSSRTIVYKGLLTPSQIYLYFEDLLSEN
    FTSYLAMVHVRFSTNTSPTWYAAHPFRRICHNGEINTISVNSILFQERMESAKTPECFKSVSIKDLRPINEENYIIYDND
    DEIIQKRDTFEDIMLTQNRLKKKSRRNLLLKLKKDYTYNSSAIHYNIKREYMNSDINSNSEFLSNVNDDSKSSSDVDKIS
    EENLMNHLKEKNNKAFRKSMKNQIKHGESQKTKGAISYPSDSSIFDNAIDFLTMTGREIEHAVMMLMPRAYQKDPNISPL
    EKAFYEYHTCIMEPWDGPALIIFTDGYKVGASLDRNGLRPARYSITNYGLFVLSSETGVVDLSYDKIVHKGSVYPGKVVL
    VDFKEKKFLRHEEVLSKFLRERPYKKWIDHYSIHMDNIIRPVTNMENIRMNAYKYGAILNKDNYYHNNNTNINNSNNNNN
    NNMIKSNSNALSINNNKTCLNDIDYYDESLIKKLKAFGYTYDAFNMIISPMVKHAADGLGSMGNDTAFPFLSYLHRNLLY
    YFQQTFAQVTNPAIDPIREENIMSLMSNLGKEGDLLQYSHVNCHRIFINGPILNEALYNMLLQLPDFPHIIIDMTIDLDK
    LQSMMINVNSNFSPNKDGDPSQNIHNNIVSNKNSEDPSKLDVCKTKQAKEEHTKKKHISSKYLIKFIDSVNSKAENAIKK
    GCQLIILSHNNVNEKRVPIFSILIVGALHKYLLSKNLRTKCSLIVKAGDCFEIHHLAVLLSFGADCIYPYILYESLQFIK
    FADNEARLSNNQMISNYRHAANYGILKIMSKNGISTLPSYKGCGLMQPLGISDEILKKCFINVCDSIIGGVTFEFVEKEI
    LNIFYLAYPKRILTLNLKDANEELDDYGEYHFRNIGKSQIHMNHPETISLLQKATRSGNKDTYKKYSELQNELINHCEIR
    GQLEINYKKCPSYNKIKKKHEPINIHLVEPVNKILLRFCTGAMSFGSLSEEAHTTVATAMNSMGLKSNTGEGGEAEERIK
    TANNEINTNSAVKQIASARFGVTAYSLVNAQELQIKVAQGSKPGEGGELPGYKVSSKIASIRRSTPGVGLISPPPHHDMY
    SIEDVGQLVYDLKNINKEAKISVKLVSKLGIGVITSGVVKGNCEQILISGTSGGTGASKWTSIKHAGLPWEIGLAEAHQT
    LCKSKLRKRVILQIDGQLKTGRDVILGALLGAESFSFSTQPLISLGCIMMRKCHLNICPVGICTQDPELRKKFAGKPEYI
    VNFFFMLAEEVREYLASMGFRKFSQIIGRSDLLKKKDHLKYDEKRKLLDFSKLLFPGWKYYAEDEMKDDQNKRYKNISNK
    KKKYNTNSLYSASKHKKKNTKAGLHSIKKKMKNRKQVLINESFNTIKKYKINSKQADTIERVNGQNEYFINVECDEADAE
    NESDQNDNNEEEETDKSDVEENIDNDENEDMDQIDDIDEEDDEYYNDGSDDSDDSDDSDGNDDSDDNDDDIDDLDDVDDV
    DDLDDVDDLDDVDDLDDLDDVDDIDDVDDVHNADNVNCRKDNHTDHDYDDNNNVKDEYPNNNDKKGQNSREKRNKKKSMN
    RNIIYKYQYKEKGSYNINKKNHNNNNINKKNTKKIKKKIHLKKKKVKPIPIFCCETQNHKLSDVIDRELIRRSKIALLNC
    TPVNIKMPIKNTDRAVGAMLSYHIIQKYGEEGLPIDTINVKFRGTGGLSFGVFLTSGVNFELEGDANDFVGKGLSGGIIS
    VHFPKNALFINECQKNVIAGNSVLYGATKGRAFFAGRAGERFAVRNSGAIAVVEGVGSHGCEYMTKGIVVVLGEIGCNFA
    AGMSGGIAYVLDINEKNVNHQMVDLKVCKTMDEKMTLEKLLHEHYERTNSYTAKMLLQNFDENLQRFTKIIPRDIKRVLT
    EACIEFVKTGNEEAAAILDDWASLLKSVDQPEHMYKKAMQFFTTITDDISGLSKSLALRSVDGLIIYDILQEQRSRNLLS
    IKNSSNDFNSLNNEEQNIKKKKFFDFESFIHNLELCRSNNRKWRRFSEIPFKCNAFSDFKNTFPEKLDDKSKEMIKKYIL
    NEQYLLDLHLKSLNSNKFIEKLIIRETDDYIHMDQKQLSPNIYTLKKYLYPSDNYDVSNISNSMTAYNKINGVHLMNKQN
    ENKQNAEVPNSYDFSGYTLGARRKTADMVNIQKDDENDIRIANNTKSISNTNDMNNVSNMNNMNNVNNVNNVNNVNNVSN
    MNNMNNMNNMNNINNMNNINNMNNINKDDNNNINGDDTNNTVISEVTNTTYANKSSNYSQSQYAKTSGDGKIKKYSVDTE
    ISDMTRVSSDYGNASSISSTKPFLVANPNKVTGFKEYERLSHPLKDISSRVLDYSEIIVPINVKSKLHNQLLKTQASRCV
    DCGTPTCHYPNSSGGGCPLGNRIFDWNNLVYENEWKKALERLLDTNNFPEITGRVCPAPCEDACVLSINEKAVSIKFIEL
    SIIEYGFIKKWIQPMIPISRTGKKVAIVGSGPAGLTAAQQLNKAGHEVTVFEKDEYFGGLLMNGIPNVRLDKKILERRLI
    LMKKEGILMKNNVNVGVDITLSDLVKEYDAILLATGYKIPRKLDIPGANLNNIYFAMDFLTS
    CQISLTKSDMTDDNYIDV
    SEKHVIILGGGKTAVDCISLAIRMGASSVLQFTRQEILPMNTSEYWWPGLKNIFKVEYSHEEAIIIQGRDPREFCVRSLE
    FIPSNKDPKRVSGIRAIRVKLKKNLKSEMKQNNKMLYNNYMDNHRNNSSKIDLKKHLSKTNKLKSIKSISKGPTQETTTA
    SSYSSSSPAENDIIQNYQIIKDHNEYFDIPFTERIYKADVVILALGFSKTDDSIWENDNIKIELNNYNCIKTNNRIYQTN
    HKNIFACGDCRIGPSTVVQAIAEGRDVASKIDEYLTNSVSILPPCNTYYYYPKNYKNVPFGSSNWG

    >gi|124809308|ref|XP_001348542.1| 2-Cys peroxiredoxin [Plasmodium falciparum 3D7]
    MASYVGREAPYFKAEAVFADNTFGEVNLHDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFKERNVELIGCSVDSKY
    THLAWKKTPLTKGGIGNIQHTLISDITKSISRSYNVLFGDSVSLRAFVLIDKQGVVQHLLVNNLAIGRSVEEVLRIIDAV
    QHHEQHGDVCPANWKKGKVAMKPSEEGVSEYLSKL

    >gi|124809933|ref|XP_001348719.1| thioredoxin [Plasmodium falciparum 3D7]
    MVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKN
    GSSVDTLLGANDSALKQLIEKYAA

    >gi|124810114|ref|XP_001348764.1| hypothetical protein PF14_0590 [Plasmodium falciparum 3D7]
    MKRTDDKIYVDINNEEEYKNLFDDKNDILYIIDIYTRWCGPCIFTFEMINKIYKNNLIFSENVKLFSICAQTVSSLKNYD
    NNCKPFYIILKNGEIIQQIQGCNIPLIFSFIDEHLMNKKIN

    >gi|124810388|ref|XP_001348868.1| protein disulfide isomerase, putative [Plasmodium falciparum 3D7]
    MHIDKLLIVFIFLIKLCVCHTEKGVKKEIVSINIDEFNNILKDEGNYTLLIVYTHWSYNSNLLLENLDKLSKLLLYEENI
    KLCKINAAANTFIIDKLDVYSYPSLFMIRNKEIYRYNGVNNIRGLLLWIYQYLDFKIYEINNIERLDVFIDLNEYNNTIL
    FFIFKDLGTANNNINNISRINDLINICLLTNKTLCYYIKENNVIDYFEKNIIQDKYHYNLKNINQDSYYAILFKNDEFDD
    YFFPLNKKELDMLSNNEYTNEEKIDHLYNWINEREQPLVIQFSEHFFSMLFSNDAVTLFIIYNNINNINKDDIIKCAKKY
    NHKIKFAISGTTQIFEKRLLNELLIEDNIKKPLMRITEFKNYIRFPYKYKPQSDDQEINEKTIDDFINGYLQEKKYFYRK
    SERALPDEYNNGYIKIIVADNYDQYVYKNDMNVIVLYYAPW
    CGHCYKFEPVYREVGKRLNLYAAKFKNYKNDIIISKIDA
    VNNEIYNIHIEGYPTIYLYKKGDKLNPVRYMEGRTVKNIITWICKETQSNIDISEFLNIDLDNEQLFENYEEL

    >gi|124505837|ref|XP_001351032.1| human hepatopoietin-like protein, putative [Plasmodium falciparum 3D7]
    MIFIEKCYEQSCKKRNKKNESNIKSIYENKKKEQIYPPDRDEIGRASWLILHTISANYPDNPSEYDKIKHTKFFYAFSNL
    YP
    CHICKLDLLHILKKYHLNCNNKINFSTFIYNLHNMINQEIGKDLFPCQDIQTIIDKYKTVD

    >gi|124506373|ref|XP_001351784.1| hypothetical protein, conserved [Plasmodium falciparum 3D7]
    MTIHIFLCFLLILKIVNALKSNRFSSYIYTPKTFLYNNKSIPNKKLVRKFVNRIKLVDDTIKSNEHIIKITDNATNKIKE
    LQKECNDDYLILKLYVENGG
    CKGLKYKLNPIKKNEIEEDDYIQQFDELKFILSIDSTSVIYIYNNTLDYSNDLISGGFKF
    INPNATKKCGCGKSFNV

    >gi|86170662|ref|XP_966059.1| glutaredoxin-like protein, putative [Plasmodium falciparum 3D7]
    MDFIKVEDQRKYIEGNKGYQLFYLNSSTSKEYGSHIDVLNMMLEDYSSVLKIYVINVVDDNNKYEFQFYAKSQLIKSFVN
    TNIGSITSFLRKYMQTLSYEQDTEEKNKEKEREKQIIERIQNLLKNNKIILFMKGTKTFPQ
    CKFSNAVIFMLNSMKIKYE
    TYNILEDQDIRAHLKIYSNWPTYPQLYINTELIGGHDIIKSMYDNNELALIIPDDCFEE

    >gi|124511746|ref|XP_001349006.1| Cg6 protein [Plasmodium falciparum 3D7]
    MNKYIRAPNLIYICASLGIHSILFKKQKSPDNKNSYHIKDFIKLKNIIFLTSCEVTQDPKEGGGKKNYDRYHNELFNNKI
    NQNKVHIDNNELVNYFDELYEQSKNENIITKGEGEEVEFNSSNLLLPFVEEHEHVKDKNDNDKCIKYEYVNDKCIKDEHG
    EFERVEENIKLSEDIINIIENILKKYNVVLFMKGTALNPY
    CKYSKQAIHILKLNKVKQIHTVNILDNQELRNALKIYSNW
    PTFPQLYVNQKFIGGIDKLQELHDQNKIKDII

    >gi|124512108|ref|XP_001349187.1| antioxidant protein, putative [Plasmodium falciparum 3D7]
    MDRYINIDVRNMNNISDTDGSPNDFTSIDTHELFNNKKILLISLPGAFTPTCSTKMIPGYEEEYDYFIKENNFDDIYCIT
    NNDIYVLKSWFKSMDIKKIKYISDGNSSFTESMNMLVDKSNFFMGMRPWRFVAIVENNILVKMFQEKDKQHNIQTDPYDI
    STVNNVKEFLKNNQL

    >gi|124512228|ref|XP_001349247.1| disulfide isomerase precursor, putative [Plasmodium falciparum 3D7]
    MTRKYFSSLFLFLISFVFESFVRSHGDLFNHFVTDIHDGELDKFITKNDIVLVMFYAPWCGHCKRLIPEYNEAANMLNEK
    KSEIKLVSIDATSENALAQEYGITGYPTLILFNKKNKINYGGGRTAQSIVDWLLQMTGPVFSHVEGNIEDVLKEKKINVA
    FYLEYTSEDNDLYKKFNEVGDKNREIAKYFVKKNDKHNKLFCFRTDEKKVEYDEKTPLEEFVTSESFPLFGEINTENYRF
    YAESPKELVWVCATYEQYNEIKEHVRLAAQELRKKTHFVLLNIPEYAEHAKASLGLTEFPGLAFQSNEGRYLLKNPKESL
    LNHNAIINFFKDVEAGKIEKSLKSEPIPEDDKNAPVKIVVGNSFVDVVLKSGKDVLIEIYAPW
    CGHCKKLEPVYEDLGRK
    LKKYDSIIVAKMDGTLNETPIKDFEWSGFPTIFFVKAGSKIPLPYEGERSLKGFVDFLNKHATNTPISIDGVPEFEDGTS
    EEL

    >gi|124512464|ref|XP_001349365.1| lipoamide dehydrogenase, putative [Plasmodium falciparum 3D7]
    MVIRQNIKHIVKLNVVTLIWLSYLFLLKPHGTLKNMMVCNAVLLPFNEKNKGINNFVYINPKNIILNKIKKDVIKLEKDN
    IILCQHNRKRDNYIKQQKRKEKNANNFTFMLKGSTQNIMNINEKEYDLAIIGCGVGGHAAAINAMERNLKVIIFAGDENC
    IGGT
    CVNVGCIPSKALLYATNKYRELKNLDKLYYYGIHSNIFQNNKNTEIENNQLVSNSFQINITKLKEYTQSVIDKLRN
    GISHGFKTLKFNKNSEHVQVIYEHGQLLDKNTIKSKKSGNTYKVKNIIIATGSVPNIPNNVEIDDKSVFTSDMAVKLVGL
    KNYMSIIGMGIIGLEFADIYTALGSEITFLEYSSELLPIIDNDVAKYFERVFLKNKPVNYHLNTEVKYIKASKNNNPVII
    GYSHRTGNDDNEKKNMTDVKELYVDSCLVATGRNPNTQNLGLEKLKIQMNRGYVSVNDNLQVKMENNEIYDNIFCIGDAN
    GKQMLAHTASYQALKVIDFIEKKEKKNVNINVENNLSKPILYKNIPSVCYTNPELAFIGLTEKEAKVLYPDNVGVEISYY
    KSNSKILCENNISLNNNKKNNSYNKGQYNINDNTNGMVKIIYKEDTKEILGMFIVGNYASVLIHEAVLAINLKLSAFDLA
    YMVHSHPTVSEVLDTAFKSISKIRTH

    >gi|124512718|ref|XP_001349492.1| 1-cys peroxidoxin [Plasmodium falciparum 3D7]
    MAYHLGATFPNFTATASNVDGVFDFYKYVGDNWAILFSHPHDFTPVCTTELAEFGKMHEEFLKLNCKLIGFSCNSKESHD
    QWIEDIKFYGNLDKWDIPMVCDESRELANQLKIMDEKEKDIKGLPLTCRCVFFISPDKKVKATVLYPATTGRNSQEILRV
    LKSLQLTNTHPVATPVNWKEGDKCCILPSVDNADLPKLFKNEVKKLDVPSQKAYLRFVQM

    >gi|124506757|ref|XP_001351976.1| selenophosphate synthetase, putative [Plasmodium falciparum 3D7]
    MRICKRIDPVIDIVIVGFGMSSKSFVDIFLSKNELKGVNITIISKNTFVFLDKYVQCIELCKDTYIDIYKYCKERNILFI
    NEEVESIDSDKKIIKFSSDRNHLCYDYLLCDFDYKSSYLMNNNDLSHMNIYTYKDKNLFFYYTHIIYLSLIKSQNNKITD
    KKEYMKWKTFFFKNIPLEKFYNFCSYNDKYVENIIDIYNFFDILLNNNIPYYDFKIVQEKVKILNVLKNKNPLIKEIVKN
    ENYNFHFSNNEEKDETKQTNNSSDNIFQFLILCDENNYNFGKNLYYEIFENLHKISISVKIIYVHIINEEKCNKKENIND
    TISNNNIKNNIKNNIYNNNMKCSKFCSYFVQVREIKQVKKSEDKLFIEYIDMNNKLSTIFFDECINITNLKYPSYIYKSG
    YDIDNNKNINNFCQYYKDESLYFPNQITNYDTYTICQNVYINIYNNIHKKKYISIDNVKDHIYIYNWKQKHITIEHFSIN
    HIYELLINIYNKIIKIIKFNLIYIYKHPLTQNKVKPFLMNKKYLIDNYLNEKKKKIKTIEKKNKSSSIDLFINLIMYIYN
    QFLYYIAHFENIFVHTKQEEHNLNTNNNSKMKTNCNVKNIKNTNQNTELLPAYMYDEYKKEYENRLIIKKKTSYKLVQHN
    NNNNSIELNEDNNKNDYVKGTDDTFVIVECNNFGKEAMLDTSDNKKVQSYIKESIDKIINRNTCGG
    CGSKVPSNVLSNSL
    KSLDIFNSPNVYLGVEGSDDCCIFVHSKSKNTEQSPALVQTIDFFKSFIDDEYILGSIIAIHSLSDIYSMGGTGICALCV
    LIVKDNIERKLQQRLENVLTGCCQKLKEERCVLSGGHTCAGNENYVGLAVTGKIKKRKEKKSQQKNGNKNIMKFEQDKNE
    NEGNSHIEQLINQNNINNINNVQFEEDEHKINKETNSYFEKHQMLKENYLFLPKGNGDIKNGDVIITTKMFGFGFIMAAH
    IIKKAKARWIYSCLDEMLISNRKSGLYFLQNNAKACTDVTGFGILGHLNEMLKCSRKEIYLHHKKTNYKHNDNLDQTTKD
    GYSKNQDKQIKQKKIFNRCDQNNNKLNMLGAKIKLNNIIIAEGVQECIENNIYSSMYKKNHYLCNNIINLDEAQLYSKYG
    ILFDPQTSGGLMAIVQREKATQILSDLKNMGYPNSSIIGEIINVQYEKFNNKSIQDISLSDYLDTTDSIYVEL

    >gi|124506849|ref|XP_001352022.1| NADH dehydrogenase, putative [Plasmodium falciparum 3D7]
    MLVKFRKCGQANIFRSISNVRKIYNVAKNNLKNNKDIERKEKIIILGSGWGGFNFLLNIDFKKYDVTLISPRNYFTFTPL
    LP
    CLCSGTLSVNVCTESIRNFLRKKNGYCGNYLQLECTDVFYEDKYINCIDIENNKVKLFYDYLIIAVGAKTNTFNINGV
    DKYAYFVKDIDDALKIRKKFLDILEKCTLPNISNEEKKKMLHVAVVGGGPTGVEVTAEFADFINKEVKINYKDIFNFISI
    SIIEGGNNLLPTFTQNISDFTKENFHNLNINVLTNYYVIDVDKHSFHIQSSLNKNEKKKLSYGLLIWASGLAQTTLIQKF
    LKTIPVQANNAILKVDEKLRVIGIPSNNIYAIGDCKKIQPKLLHEHTNEIIKILTGNKLTSEALKLKQSELTKTFPQLSI
    SKWDYEKNKKGEMTPQQFHDYLFEIDKNYKSPTPTAQNAKQEAYYLSNVFNNFIHTNQKFNIPSFIEKWKGSLAYIGNHQ
    VVADLPYYELKGGRFSSTFWKVVYIQLLLSWKSRFHFFIDFIKTKWYGRPFIK

    >gi|124506871|ref|XP_001352033.1| thioredoxin, putative [Plasmodium falciparum 3D7]
    MKCYEMINMIHINIYLEQSIYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYYYVTLVDIDVDIH
    PKLNDQHNIKALPTFEFYFNLNNEWVLVHTVEGANQNDIEKAFQKYCLEKAK

    >gi|124506936|ref|XP_001352065.1| protein disulfide isomerase, putative [Plasmodium falciparum 3D7]
    MKHFCFNNILYIFIIYIIFLLHLNNIILCEGAIWEGISKDEIRNVKHLTHEVELQIYSQHTQNCMALFCNEKESKCKNVY
    KEFVKASNELIDNDVVFVYVDTISLAKTADNFEIKNIPKILTFKDFDPEKGYTFNRKYTKENILEWFKLLPEPSIEIMEK
    NNVEKYVEMHKKKGYASIIAFCIRGSDNANKFVHFGETQKLPNLAVGLIYVENDEDVKIEIFNGPGSTIPKENFKYKDTY
    VPYNGIWTSDSIYQFAENYMKQFPVIINYHRKSLPPLNGDIYFYIFNRFGEYSDTLYVELYDLIMKHNQIKFVFPRKDEV
    LEHFNIENNMSLISIMDYNNASFVTLSQMLRPKKYAKIMDENITVSHVESFLDEFLKNNLAVYRKSEKPIKRREKQKYQI
    LCSNDFESYVMDPEKLVLIFYHVQG
    CKECKPLFTFWDTVANYFHLENKYKDVLVATMDAKLNDMIDESVDYYPSLALYPK
    GENKLKRKHILLFPMKLDTLIDVVDEYLEDLDQDL

    >gi|124507024|ref|XP_001352109.1| thioredoxin reductase [Plasmodium falciparum 3D7]
    MCKDKNEKKNYEHVNANEKNGYLASEKNELTKNKVEEHTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGT
    KWGIGGT
    CVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGL
    AKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGF
    LNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDI
    DGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTP
    IEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRQKHIRAQKDEYDLDVSSTCLAKLVCLKNEDNRVIGFHYVGP
    NAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGCGGGKCG

    >gi|124507056|ref|XP_001352125.1| thioredoxin, putative [Plasmodium falciparum 3D7]
    MFFLQNLKKITHPKYLCTTIRRNVYTVNGNKLVVAQFGASWCAPCKKMKPVIEKLGEDNDNIESLYIDIDEFPELGENED
    INELPTILLRKNGKYLDKIIGMNESDLIKAVEKHQSD

    >gi|124513620|ref|XP_001350166.1| thioredoxin [Plasmodium falciparum 3D7]
    MKKYIFFFLFSFINFFFVYDVTCTKEVTSTNDDPLTPLNRFDKYYLRMFKKVPRLQQNGSNIINGVNMKNTVIVLYFFAK
    W
    CQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKHL

    >gi|124513762|ref|XP_001350237.1| thioredoxin-related protein [Plasmodium falciparum 3D7]
    MAIFKKSIIIFLFFTFFNYCFSQDVIELNDSNFESLTQLSTGNTTGSWFIKFYAPWCSHCKAMSKTWAQLATELKGKINV
    AKIDVTLNSKTRKRFKIEGFPTLLYFKNGKMYDYKNHDRSLEAFKNFVLETYKNAKASEPPKPLNYMDILKDFLNETFQN
    IDRIYKYAFPSLAVLVSVSFLTGSIFSLILLKCCCMKSGASKVAKKKD

    >gi|124514016|ref|XP_001350364.1| UBA/THIF-type NAD/FAD binding protein [Plasmodium falciparum 3D7]
    MYQVVKEYLNNYQRYIYYGVFIVVGYFLHDLINYAQREGVRIGRIRKIFDLFSKVLKKVYIFFNFYERRIITLENELFYK
    NYDKEVIDRHGKLLNIYDIPHDSLYKIFNTKILIIGLGGLGSPVCLYLSKFGFKEIGLVDGDKVEKSNLHRQIIHKEKYI
    GLNKCISAKLFLKDMDVHVSDCIKCYPFFLDKLNGINIIKEYDIIIDCTDNISTRFLINDLCILYKKKLIFASALGIYGQ
    VNVYNLNNNTSSCYRCLKSFNNHSQNND
    CDENGILSTVTGVIGLLQANEVIKLSIGLDQDVLTNFLTYNSFSNKLPFESL
    NINYKNKNCLCSMKNFKELYNFILSHNYDNINNTNNTNNTNNTYNTNNTYNTYNTNYNNNYNNNNNSSSNKINNANNIYC
    NNLICFNQTNETYIYQIDTFQFIDILNNNYSSLSFPVNQICILDVRKINNTNIYGLRNSVKWSFYEIIETFNKLQHNKHE
    LLQIIIDKLNISKSKKNILIIVVCRRGIDSLKITKHFNNLFLYNDKLDSNKKEATYNNNDISLYNTKNKKFNKTLLNDAH
    IIAYNLKGGYLQLQKKIFKNLPFL