Apis mellifera

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|48096617|ref|XP_394728.1| PREDICTED: similar to CG11790-PA, isoform A [Apis mellifera]
    MLRIIFFILICSFVDVYSASLETVSDEELINLIKTEKYVVVLFSSKDCTTCDNYENELIHLREDLVNSLSSWVIKAVDSQ
    LLRLYSADKEPALVFFRHGMPLLYDGPLNDEEILTMFTENKEPTVKELTDDTFEHLTQASSGATTGDWFVMFYSTD
    CVEC
    VRMIARWEAVGAKLKQRVNVARIDKYTTGASTARRFNVYKAPEFILFRHGKMYRYQITKYDINSFVSFAKEWYKNARAES
    VPVPQSPFDDLVQMIANCLRENPWIMKLGSITIGVFIIISVASKFRRKTEIPQKKD

    >gi|48100580|ref|XP_392623.1| PREDICTED: similar to Ecdysone-induced protein 28/29kD CG7266-PA, isoform A [Apis mellifera]
    MPGQFEEIQAKRATFGMGCFWAGDCLFGVLPGVIRTCVGYAGGQKESPTYKNIGDHTEVVDIEYNPNIVSYSQLLALFWQ
    NHEYGLTTKIKRQYMSLILYHDEEQKLLAEKSREQEQYKHTDLILTEIRKFEKFYLAEDYHQKYRLRKHPWLMENTGLTS
    DELLRNSPLAAKLNGYIAGAGTLEQFKKELPNLNLSEKAAKYLEKYVIENQGNGLYC

    >gi|110766022|ref|XP_393124.3| PREDICTED: similar to sperm protein SSP411 [Apis mellifera]
    MATTSKKYENIQIAKSNHLNLEKSPYLLQHATNPVDWYPWCDEALEKAKKEDKCIFLSVGYSTCHWCHIMEKESFKNKEI
    AIIMNKNFINIKVDKEERPDIDRIYMTFVQATTGHGGWPMSVFLTPDLKPIFGGTYFPPEDTSRQTGFKTILLSIAQKWN
    QSKTKINEAGSTNLEILQNISKIPHTSKLHDIPSLECSKICIQQLENEFEPKFGGFGSTYNMQSPKFPQPVNFNFLFHMY
    ARQPNGDLARLCLHMCVYTLKKMSYGGIHDHVGQGFSRYATDGEWHVPHFEKMLYDQAQLMKSYADAYLATKNNYFAEIV
    NDIATYVIRDLRHKEGGFYSAEDADSYPTYDASAKKEGAFYVWTAMEIKSLLNKELSDEKHIKLSDVFCHHFNIKELGNI
    KSYQDPHGELEGKNVLIMYNEIEETAKHFNLPVEEMKMHLMEACSILYKARSTRPRPHLDDKIITAWNGLMISGLAFGGT
    AVNNKQYIEYAVDAIKFIKRYLFDKTKNILLHSCYRDEKNIITQMSTPIPGFLDDYAFVIKGLLDLYESDLNEEWLEFAE
    KLQDLQDQFFWDETNAGYFSTTSNDLSIILRLKEAYDGAEPSGNSIAAENLLRLADYLGRSELKDKAVRLFGTFRHLLIK
    RPVSIPQLVSALIRYHDDTTQIYVVGKRNAKDTDDLLSVIYKRLIPGRILFLIDHDKTNSILFRKNEHFRNMKLVNNRTT
    VYICKHCTCSLPVTNSEQLAILLDEQ

    >gi|66499807|ref|XP_624501.1| PREDICTED: similar to CG6781-PA [Apis mellifera]
    MSSKHLTIGSVAPPIVPGKIRLYSMRFCPYAQRIHLVLDAKHIPHDVVYVNLTHKPDWLLEKSPLGKVPCIELEGGEILY
    ESLVIAEYLDDTYPQNKLYPNDPLARAKDKLLIGRFNSVINTMCKLFINTSIDQDIFDEALSELELFERELASRGTPFFH
    GNSPGMLDFMIWPWWERSNTIKMLRGDQFTIPHDRFKRLLEWRSAMKENPAIRSNYLDTEIHAKYMQSRRAGTPQYDLIT
    D

    >gi|110756698|ref|XP_001120847.1| PREDICTED: similar to Phospholipid hydroperoxide glutathione peroxidase, mitochondrial precursor (PHGPx) (GPX-4) [Apis mellifera]
    MQKLIFLTVLFFCGVIGENCEDNNKKEECALAPLDQDKNWKSASTIYDFHAKDIHGNDVSLNKYRGHVCIIVNVASNCGL
    TDTNYRELVQLYEKYNEKEGLRILAFPSNEFGGQEPGTSVEILEFVKKYNVTFDLFEKINVNGDNAHPLWKWLKTQANGF
    ITDDIKWNFSKFIINKEGKVVSRFAPTVDPLQMESELKKYF

    >gi|110749706|ref|XP_001120368.1| PREDICTED: similar to CG13090-PA [Apis mellifera]
    MVFLYTLVKSQNLADRDINHQLPTFAQDCTGFIAHDTEAQLAALRRERQILQDYGLNNEEILRYSRQIFLPEIGIKGQIK
    LKNSAILIVGAGGLGCPAALYLASAGVGHIGIIDYDDIEINNLHRQLLYTESNIGISKVNAAVETLNRLNSTIKVIPYKI
    QLDSNNALDIIKCYDVILDATDNVATRYLLNDACVLNNKPLVSGSALKFEGHLSVFNYNGPCYRCIFPKPPPPETVTN
    CG
    DGGVFGPAVGTIGILQALEALKIVLDLPCILSGRLLLFDGLETKFRNISLRAKNVNCVVCGDHPTIHKLIDYEQFCGAKA
    NDKNPNLNLLKKEERISVEEYNIMKLDTKAHILIDVRSAEEFEICHLKNSINIPLNDINNDEKINFIKNKIEEMQKQYDK
    TTLYVI
    CRRGNDSQKAVINLQTMFKESNLEIKDIIGGIHAWSKKIDCTIPIY

    >gi|110764555|ref|XP_001123018.1| PREDICTED: similar to CG6852-PA [Apis mellifera]
    MPTTKEEVNQLIASHSIVIFSKTSCPFCKMAKQVFHNLQKEYTAIELNERNDGDEIQSILGEMTGARTVPRVFVNGVCLG
    GGTDVKKLYETGELQKMF

    >gi|48140590|ref|XP_393517.1| PREDICTED: similar to Thioredoxin reductase-1 CG2151-PA, isoform A isoform 1 [Apis mellifera]
    MDSDLSDQETEDYAKSLNNLTEEQNNLTADQKFMYDLIVIGGGSGGLAAAKEAVNFGAKVAVLDFVTPSPRGSTWGLGGT
    CVNVGCIPKKLMHQAALLGESIHDSVSYGWQLPDPKTIKNDWEALRTAVQNHVKSVNWVTRVELRTKKIEYFNALGYFKD
    QHTILGKLKNGEEKEFTAQNILIAVGGRPRYPDIPGALEYGITSDDIFSLEKAPGKTLIVGAGYIGLECAGFLNGLGYDA
    TVMVRSIVLRGFDQQMASTVAQEMERRGVHFIYEAKPSKIEKQADGRLLVHWVDKDRQTHQDTFDTVLFAIGRKPLTEEL
    KPENIGLKLVPETAKIDAIDEQTNVPNVYAVGDVLHKKPELTPVAIHAGRLLARRLFGNSTEQMDYVNVATTVFSPLEYG
    CVGLSEEAAIAIHGNDKIEIYHAYYKPTEFFIPQKDVSNCYLKVIAFRNGDQRVLGMHFIGPNAGEVIQGFAAAIKCNLT
    FPKLKDTVGIHPTVAEEFTRISVTKRSGLDPKPQSC
    CS

    >gi|110768510|ref|XP_001121905.1| PREDICTED: similar to Protein disulfide-isomerase precursor (PDI), partial [Apis mellifera]
    VLFVTINADESDHERILEYFGMKKSEVPAMRIIKFEQIMAKYKPEKPEISSENVLEFVTAFIEGKLKRHFLTQDLPEDWD
    KNPVKVLVGTNFHEVAYDKKKNVLVEFYAPW
    CGHCKQLAPIYEALGEKYKDSENLVIAKMDATANELKDVKVSSYPTITL
    YKKETNEAVEYNGERTLEGLSKFIDSDGAYGQAAEEAQEEDEDDDVPRKDEL

    >gi|110748925|ref|XP_623425.2| PREDICTED: similar to Thioredoxin reductase-1 CG2151-PA, isoform A isoform 2 [Apis mellifera]
    MPPIADQKFMYDLIVIGGGSGGLAAAKEAVNFGAKVAVLDFVTPSPRGSTWGLGGTCVNVGCIPKKLMHQAALLGESIHD
    SVSYGWQLPDPKTIKNDWEALRTAVQNHVKSVNWVTRVELRTKKIEYFNALGYFKDQHTILGKLKNGEEKEFTAQNILIA
    VGGRPRYPDIPGALEYGITSDDIFSLEKAPGKTLIVGAGYIGLECAGFLNGLGYDATVMVRSIVLRGFDQQMASTVAQEM
    ERRGVHFIYEAKPSKIEKQADGRLLVHWDRQTHQDTFDTVLFAIGRKPLTEELKPENIGLKLVPETAKIDAIDEQTNVPN
    VYAVGDVLHKKPELTPVAIHAGRLLARRLFGNSTEQMDYVNVATTVFSPLEYGCVGLSEEAAIAIHGNDKIEIYHAYYKP
    TEFFIPQKDVSNCYLKVIAFRNGDQRVLGMHFIGPNAGEVIQGFAAAIKCNLTFPKLKDTVGIHPTVAEEFTRISVTKRS
    GLDPKPQSC
    CS

    >gi|110768514|ref|XP_001121993.1| PREDICTED: similar to CG5027-PA, partial [Apis mellifera]
    MVIITKLMFIAVIYVFSGTFTSVIASRVLELSDRFLDIHKDGQWLVMMYAPWCAHCKRLEPIWAHVAQYLHATSIRVGRV
    DCTRFTNVAHAFKVKGFPTIIFLKGEQEFIYNGDRTRDEIVKFALRVSGPPVQGITKTQSFDTIKKEHDIYFLYVGERSG
    PLWEFYHKAANVFQPHAFFYQSHPNIVSKHAPVENTPALFVYKENIHYNFNHNIDDIEKLNETMYKWINGERFPTF

    >gi|66522163|ref|XP_624571.1| PREDICTED: similar to CG9911-PA, isoform A [Apis mellifera]
    MLVFCDIFDFKVLIFACLLAFLPHNFANDTNEGALSLTQQNIDMTLATNELVFINFYAQWCRFSNSLAPIFEEAANKIKN
    AFPEPGKVVMAKVDCERESSIASRFHITKYPTLKVIRNGQPTKREYRGQRSVEAFEEFIKKQLEDPIKEFYDLKELTNLD
    DKKRMIIGYFDRKDVPEYEMFRRVATNLKDDCQFHVGFGNASKAMHPPGEPIIVFRSDKALSNDEDETYHGSLNNFDELN
    VWAQEKCVPFVREITFENAEELTEEDLPFLILFHAPDDVESVKMYKDVVSRTLLDEKQNVNFLTADGMKFAHPLHHLGKT
    PADLPLIAIDSFRHMYLFPNFNDIHVEGKLKAFLRDLYSGKLHREFHYGPDPSNEVREIVGQIKVPTTPPESTFKKLAPS
    KNRYTLLKDEL

    >gi|110774885|ref|XP_001121266.1| PREDICTED: hypothetical protein [Apis mellifera]
    MTLHTSVYNMSIQTLNAVQLQQWQQQNQDFVLLDVREDNEVQYAAIPGSIHIPMNMIPLRQNELPDDKPIVLYCHLGMRS
    MQVALYLQEAGFENLYNLNGGINAWSHEVDASVPTY

    >gi|66499056|ref|XP_395801.2| PREDICTED: similar to CG7430-PA [Apis mellifera]
    MMQACFWSLMTISGKPSRDKRVVPGLIAIQLNRYTTLDADLVVIGGGPGGYVASIKASQLGMKTICIEKEDNLGGTCLNT
    GCIPSKFLLHNSNYYNMASNKNYQSSGITVENVKVNVDKCMQQKQNVIRSLANGIVLLYKKNKINWVKGHGKITNPNQVT
    ALNPDGSIQSVINSKRIMIATGSEYTPLTGTSIDEKDIISSTGALSLSSTPTKFVTGGAGFVGLEMGSVWQRFGSDVTTI
    DSSSTIGGPNIDKEVSQILRNILTKQGIKFKMETKVTSANKSGNSINVSVENINDSSKKENISCNTFLICVGRRPYTHNL
    GLESVGIKKDNLGRIPVNSKFQTEVPTIYAIGDCIRGPMLAHKAEDEAVIAVENITGGTNNMDYNSIPHIIYTYPEVAWV
    GKTEETLKQERIDYKVGKFPNTSNSRARTNLETDGFVKVLADKRTDKILGVHMISSFAGELINEAALAVQCKVKAEDVAR
    TCHAHPTYSEAIKEACLTAYFGKPINL

    >gi|48142673|ref|XP_393603.1| PREDICTED: similar to CG8993-PA [Apis mellifera]
    MLRIGLRVIRTAIGSRAFANAPAQEQAISTTFKVQDPKDFNNRVKNSKVPVIVDFFATWCNPCRMLTPRIESVIAEKQGK
    VLLAKVDIDENSDLALDYEVGSVPVLIAMKDGKVLDRIVGLQDVDKLKQFVDKYSE

    >gi|110760297|ref|XP_393690.3| PREDICTED: similar to dihydropyrimidine dehydrogenase isoform 1 [Apis mellifera]
    MTSVTILSKDVPDIENLLHLNPKIKPFANVVPSAITKENKRKWKRNINENCSKCPPLTKNFDDIKHTTLSERGALKEAAR
    CLKCADAPCQKSCPTQLDIKSFITSISNKNYYGAAKAILSDNPLGLTCGMVCPTSDLCVGGCNLHASEEGPINIGGLQQF
    ATDIFKQMNISQTRIPGQNVSHADTKIALLGCGPASLSCATFLARLGYNNITIFEKQNYIGGLSSSEIPQYRLPYDIVNF
    EIDLVKDLGVKIELGKALSKDNLTIESLQNSGYKAIFLGIGLPDAKAIPIFSNLTEEMGFFTSKSFLPKVAKGSKPGMCA
    CKRNELPSLHGKVVVLGAGDTAFDCATSALRCGAKKIYVVFRKGFTNIRAVPEEFDLAKEEKCEFIPFQSPKQVIVRNGK
    IIAIEFYRTEENENDEWIEDKEQICRLKADFVISAFGSGLQNQDVIQAMVPIKMNKWNLPEVDSQTMSTSIPGVFCGGDL
    AGIAHTTVESVNDGKTAAWYIHKFIQNSYNLEVPKIPQLPKFHTPIDDVDLSIEICGLKFENPFGLASAPPTTSSTMIRR
    AFEAGWGFVVTKTFSLDKDLVTNVSPRIIKGTTSRHHYGPEQGSFLNIELISEKSEAYWCNSIRELKKDFPTKILIASIM
    CSYNRADWTELSQKAERAGADALELNLSCPHGMGESGMGLACGQDPVLVRNISRWIREAVKIPFFVKLTPNITDIVSIAK
    AAYEGHANGVSAINTVQSLMGLHADATPWPAVGIKKATTYGGMSGNATRPQALRAVSAISKALPGFPILGIGGIESADVA
    LQFLHCGASVLQVCSAVQNQDFTLIDDYITGLKALLYLKNLKQLKNWDGQSPPTFKHQKGKPVVLQHALGKNIPYFGEYQ
    KLREAKIAEIKAISNPLDNLVETTRSSPETITAIPSIKDVIGKALNYIGTYKDLNNKEQVIALIDDDMCINCGKCYIACA
    DSGYQAIKFDSETHIPTVTDDCTGCTLCLSVCPIIDCITMVPKRIPHVINRGVPLKECFNFEIE

    >gi|110771007|ref|XP_001121675.1| PREDICTED: similar to O-6-alkylguanine-DNA alkyltransferase CG1303-PA [Apis mellifera]
    MTPQEYKTNHRNFKIIYGFYPTPFGNCLIGITSTDNAIIYLGFVDKSNKEALTELKISTNDSILVLMKGTEFQIKVWKAL
    MFISDGTTITYEQIAQNIGKPKAVRAVGNAIMKNYIAYLVP
    CHRVVGKSGSNKYKWGTKRKENLLIHEQLVMNNINNLAS
    DRLIVKHTMTEEVLSTL

    >gi|66535525|ref|XP_624087.1| PREDICTED: similar to CG4511-PA [Apis mellifera]
    METILQKKIIEATHCVEKQLDAEIEKLDNLDISDFEKLREQRFKKLKLLQQQKQNWLSLGHGEYSELYDEKEFFEISKKS
    ENIVCLFYKDDSPR
    CKIVDYHFKILAKKHIEAKFCKLNVMQCPFLTERLRIKIIPTIALIVNGKTKDYIVGFTDLGNRDD
    FSTEMLEYRISLSGAITFEENISSENNKKSWLSHISKPKTIKGPNDSNSDDSDEN

    >gi|48104680|ref|XP_392963.1| PREDICTED: similar to thioredoxin-2 CG31884-PA, isoform A [Apis mellifera]
    MVYQIKNASDLKNQLEKAGNQLVVIDFFAMWCGPCKMIGPKVEELSMEMEDVIFLKVDVDECEDIAGEYEITSMPTFVFI
    KNNKVLENFSGANYDKLKSTIQKHK

    >gi|110756016|ref|XP_624806.2| PREDICTED: similar to CG7217-PB, isoform B [Apis mellifera]
    MVTVGEKIPTIDLFEDSPTNKVNLAKISNGKKIIVFGVPGAFTPGCSKTHLPGYIQKASDLKSKGISEIFCISVNDPFVM
    AAWGKAQGAEGKVRMLADPAAQFTDALELSVDLPVLGGKRSKRYSMVLDNGIITELNIEPDNTGLSCSLVENIKV

    >gi|66531851|ref|XP_623831.1| PREDICTED: similar to Protein disulfide-isomerase precursor (PDI), partial [Apis mellifera]
    MKIFALTIVIICFFTFSLAKIEIEDSVLVLTKDNIEEAIEQNDYLLIEFYAPWCGHCKALAPEYAKAAKKLQDGGFPIKL
    AKVDAIIETELAEKHGVRGYPTLKFYRKGSAIDYSGGRQADDIVNWVIKKSGPAAKNLSTVEEAKSFIESHNIAIIGFFK
    DIESDGAKVFLEVGNAVDDHVFGISNNDKVFNEYGVEDGKIVLFKKFDEGRKEFNEELDVKKLQNFISVHSLPLVVDFNQ
    DTVQKIFSGDIKSHLLVFLSKEAGHFEI

    >gi|66553575|ref|XP_395837.2| PREDICTED: similar to ATP7 CG1886-PA [Apis mellifera]
    MRKIVNIDWRYKLLNVTKYLGDGDEDVDYEGSTHLVCIPRSQEIKDSSNASSTMKVNIEGMRCQSCVKNIEGTIGSRPEV
    LSIKIILEEKLGYIEYKANEITPEELVEAIEDMGFTASLFKEESNSIEKKQINHVSQSNISICSIHVDGMTCMSCVKTIT
    GVLSEKSGIKQVNVSLENKEARVSYSDNDVTAEQISGFIEEMGFNSFVKEVNGMVYNTTINLNINPPDSGNVSLELNGGG
    DVKKENQTAKCFLHITGMT
    CASCVAAIEKHCKKLYGVNSILIALMAAKAEITFDPDKIRAVDIASSISELGFPTTLIEEP
    GTGEGEVELKIAGMT
    CASCVNKIESTVKKLPGVHSAVVALATQRGKFKYDVEKIGIRDIIECINKLGFTAMLFSNRDKEN
    RDYLDQKEEINKWRTAFLVSLIFGIPCMLAMTYFMVDMSIGEKTHKDMCCIVPGLSLENLILFIFSTPVQFFGGWHFYVQ
    AYRALKHGTTNMDVLISMTTTISYLYSVAVLTAAMIMQEHVSPQTFFDTPPMLLVFISLGRWLEHVAKGKTSEALSKLLS
    LKATDAVLVSLGPNNEILSERLISIDLVQRGDILKVVQGAKVPVDGKVLSGHSTCDESLITGESMPVPKKKGSVVIGGSI
    NQNGPLLITATHTGEHTTLAQIVRLVEEAQTNKAPIQHLADKIAGYFIPLVIAVSIVTLIIWIIVGYININSLPISHNDQ
    INKQGMNREEIIFQYAFRSALCVLAIACPCALGLATPTAVMVGTGVGALNGILIKGAEPLENAHKVKCIVFDKTGTITHG
    VLMVTKISLFVNEKLCSLAKFLVIVCTAEANSEHPIASAIVRYVKETIASETTGKCMNFQAVAGCGLKCKVSYISNILID
    ALKSEKIINYINEVKKLSSGTYTLNNVPIDVTPITNTSQERQNLDLELLLNPDSHGDQSNPEDVYEICIGNREWMRRNGI
    NIPQEVELKMVAEEELGCTAVLAAVNNVLVAMISVADTVKPEAHLAVYTLKKMGLEVILLTGDNRKTAVSIARQVGITRV
    FAEVLPSHKVAKIQRLQDQGLRVAMVGDGVNDSPALAQSDVGIAISSGTDVAVEAADVVLMRNDLLDVIACLDLSRKTVL
    RIRLNFLFASIYNLLGIPIAAGIFSSFGFFLQPWMSSAAMALSSASVVGSSLLLKLYHKPTKATLETSEYLLAMHAHSTA
    RMIDLDTISLHRGLDDSVLPIMHRSTSTLSRLFRRSKDDIEGRLLSEDVDEIDLITDFSGYRKNIKDHTNITPL

    >gi|66535082|ref|XP_624361.1| PREDICTED: similar to Peroxiredoxin 2540 CG11765-PA [Apis mellifera]
    MRINSIVPNFEADTTQGQINFYDWQGDSWVVLFSHPADFTPVCTTELGRLAVHQPHFKRRNTKLLAHSVDKLQDHVDWVN
    DIKSYCQDIPGAFPYPIIADHDRTLAVKLDMIDEISKDDPEQALTVRALYIISPDHRLRLSMHYPTSTGRNVDEILRVID
    SLQLVDKRPEIATPANWVPGEKVMILPTVKDEELPKLFPKGVDKVSMPSGKIYVRTTTNY

    >gi|110761761|ref|XP_001121957.1| PREDICTED: similar to interferon gamma inducible protein 30 [Apis mellifera]
    MGLGIFRWKILLIILSVLLFWQSSKIWLNFTQGKSGIKAQLQDNQPVTLSQKDEKNAQKIHIAIYYEALCPDSRSFFIKQ
    LLPTYHRIPDNVRIEFIPYGKAMTLKTEDGYEFKCQHGPIECAANIIHACSIDILKNSSIKLEYLSCMIKNNMIPKKIME
    TCAKKMNIDYNPIFKCYNEEKGKELLAEYGKLTNVLIPRISFIPTVVINGSSENQARILKNLLQEVCSHFKIIPEGCIL

    >gi|66551889|ref|XP_395981.2| PREDICTED: similar to CaBP1 CG5809-PA isoform 1 [Apis mellifera]
    MQEFLGILLLISGAHCLYSNSDVINLKPNNFDNLVLNSDNVWVVEFFAPWCGHCQMLTPEYNKAATALKGIVKVGAINAD
    EHKSLGAKYGIQGFPTIKIFGIDNKPEDYNGPRTAAGIVDAALNVAGQKARKILGGKRSTGDFKSKDSKDVIELTDDTFD
    NIVMNSDDMWLIEFYAPW
    CGHCKNLAPIWASAATELKGKVKLGAIDATANRVKASQYEIKGYPTIKYFAPGKKSTDFVQE
    YDGGRTSSDIVNWALEKLAENVPAPEVLQIINEKGLREVCENKPLCVISVLPHILDCQSECRNGYLKILNELGEKYKQKM
    WGWVWTEAGAQPHIEEALEIGGFGYPALAAVNIKKMKYSLLKGSFSYDGINEFLRDLSYGRGGTAPLKGAQLPTILETKS
    WDGKDAELPQEEEIDLSDIDLDEKDEL

    >gi|66526646|ref|XP_623438.1| PREDICTED: similar to CG7430-PA isoform 1 [Apis mellifera]
    MMQATFWSLVTTSGKPSCVKRIVPGLIAAQQRRYTSTLEADLVVIGGGPGGYVASIKAAQLGMKTVCIEKDETLGGTCLN
    VGCIPSKSLLNNSHYYHMTHGDLQNRGIIVENVKLNLDKVMEQKRNVIKALTGGIAGLFKKNKIEWVKGHGKITGPNQVV
    ALSPDGSVVSTINTKNIIIATGSEVTPFPGIEFDEKQILSSTGALSLDTIPKKFIVIGAGVIGLELGSVWQRFGSQVTAI
    EYSPFIGGVAIDSEVSQTLQKILSKQGLNFKLGTKVTGAKKTGNEIIVSVEDAKDPSKKEDISCNVLLICIGRRPYTWNL
    GLEDIGIERDKLGRVPVNNRFQTVIPSIYAIGDCIHGPMLAHKAEEEGIITVEGIVGGAVHIDYNCVPNVIYTHPEVGWV
    GKTEEDLKKEGVEYKVGKFPHLANSRAKTNLETDGFVKVLADKNTDRLLGVHMIGSVAGELINEAVLAIEYGASAEDVAR
    TCHAHPTCSEAFKEACLAAYFGKPINF

    >gi|66526662|ref|XP_392102.2| PREDICTED: similar to CG1837-PA isoform 1 [Apis mellifera]
    MLSQVNSEEDHLYSVQYTKDNFSIEIQKKNHLVMFYAPWCGHCQRLEPIWEQIAKMSYNEDSNVKIAKVDCTTDSNLCAE
    HDVTGYPTLKFFKAGETKGIKFKGTRDLISLISFLTDHLGITFGSENIIPSPPEAVNGLLELTEDNFDKHVSSGYHFVKF
    YAPW
    CGHCQKLAPTWEELANSLRNDNYVSISKVDCTQHRSVCGQFDIKGYPTLLWIEDGKKVDKYTGQRTHEELKAYVSK
    MLEKENDQMDTKTDNSDSTTHAVLSLTGESFKHGIENGISFVKFFAPW
    CGHCKRLAPIWKDLGKKFLTNKNVKIVKVDCT
    LDISKELCNEQEVDGFPTLYLYRDGLKVSEYNGARNLDDLYEFIMIYVQPHDEL

    >gi|110764308|ref|XP_001120023.1| PREDICTED: similar to SelR CG6584-PA, isoform A [Apis mellifera]
    MTVEIDKEELKKRLTPLQWHVTQEKGTERPFSGCYNKFYEKGTYTCIICDQELFSSDTKYDSGCGWPAFNEVLDQGRVKL
    TKDTSHDMVRTEVTCSKCGAHLGHVFNDGPKPTRKRF
    CINSASINFHPAGEEKKITS

    >gi|66521517|ref|XP_395319.2| PREDICTED: similar to Peroxiredoxin-6 (Antioxidant protein 2) (1-
    MVLLGETFPNFVADSQMGPINFHDWLDNSWGILFSHPNDFTPVCTTELARVLKLMPEFEKLGVKVIALSCNSVDSHRKWI
    EDIKAYAGMTDKEFPYPIIEDETRKLATLLGMLDPLEVDNNGIPMTARAVFIIDPAKKMRLSILYPATTGRNFDEILRVI
    ESLQLTEKHKVATPVDWKIGEEVMIQPIVSDEEAKKLYNNIKFVSLPSGKSYVRIVSQPL

    >gi|66530247|ref|XP_397478.2| PREDICTED: similar to CG5554-PA [Apis mellifera]
    MSCTKFRFLFYITYSCLFLNLVNANIQTSSKNTFAEQLTEENWDRILIGEWMVEFYAPWCPACKALEPIWEHLASQKKNL
    NINVAKVDVTDSPGLSGRFMVTALPTIYHVKDGIFRQYKSPRDKDSLIEFVSEKTWEKIEPIPGWKSPTSIQMSLISQFF
    KMSQVLRGIHNKLMEDFGLPTWGSYLIFAIATIVLGAILGLFIVCLIDFIYPPKPVVLQDKKKQKEGSGGFMQEKSIQDE
    EIVKHVKDDLVDEESEQEGSETEEKEKDVNKDSKTEPSSPNVRKRKPRKAD

    >gi|66550509|ref|XP_624977.1| PREDICTED: similar to CG9796-PA [Apis mellifera]
    MRCYPFTSSSSIAAILLFLSYNDLVAGNTATNRLNVDVYYESLCPDSIRWIKQQLLPQYDILKDYISVSFIPYGKATYWQ
    DPNTQKWHFSCQHGIDECNGNKAQACGIHAIQNNESADKIQQLTVSLIGCAMTSRFPPSSILECAEKEGLNDQTQANINE
    CINSSLSNELLVEYGKKTQELKPDLSFVPTITINGVNSREIQSAAQNNFFKLICDSLDGTKPSQCSACK

    >gi|48103506|ref|XP_392870.1| PREDICTED: similar to thioredoxin-like 2 [Apis mellifera]
    MSVTNLNSQQEYENYVKSQDLSVIHFYAPWADQCSQINDVIEEMSKLTEYKEVKFAKIEAEKIPDVSLKAGISAVPTIIF
    TRNDTILDRVDGANPSAIADKIKHQLSKKDSISIETYKPKENLEERLKKLINQAPCMLFMKGSPINPR
    CGFSRTIVSILD
    SYKADYQSFDILQDNDVREGLKKFSDWPTYPQLYINGELIGGLDIIKEMSESGELENMLPKKS

    >gi|110748692|ref|XP_394140.3| PREDICTED: similar to CG7484-PB [Apis mellifera]
    MIGAIKRRMVNIVSTEFSADDCKSLGFNKANLLCSTCEEFNKHSLTEILNNCKECCLKDDDYDASGLKRYPRAVLEVCTC
    KFGAYPQIQAFIKSNRPNKYKNLQIKYVRGLDPIIKLFDADNKVEDILDIHKWDTDSVDEFLATHLSMD

    >gi|66546657|ref|XP_623282.1| PREDICTED: similar to ERp60 CG8983-PA, isoform A isoform 2 [Apis mellifera]
    MLFKYFNFLFLVFASVLAEEKDVVELTDETFSHELERLENTLVMFYAPWCGHCKRLKPEYAKAAEMLLDNDPSITLAKVD
    CTESGKDTCNKYSVSGYPTLKIFSKGDFVSDYNGPREAVGIAKYMKAQVGPASKELNEENCLKSFLDSDEVSVVGFFEKE
    DLSLATTFHAVSKKLKEKVRFAHTTAKSLMEKEGYKNTIVLYRPKILQNKFEANIVKYDETMGDIQEFINKNYFGIAGVR
    TRDNTAEFKNPLVVAYYAVDYIKNPKGTNYWRNRIIKVAKDFPNLNFAISSKDDFQHELNDFGIDFVKGDKPVILARNIN
    NQKFVMKDEFSVSTFEAFLKDMEAGVLEPYLKSEPIPEDNSGNVKIAVARNFDELVTNNDKDTLIEFYAPW
    CGHCKKLAP
    VYDELGEKLANEDVEIIKFDATANDVPGPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRKG
    KSVKPKSDEL

    >gi|66524909|ref|XP_396242.2| PREDICTED: similar to NHL repeat containing 2 [Apis mellifera]
    MNVRDTVEELTQIGIEIRGSLELLLDRKEQKELVLRHIKTFSNKNTRIADFQAGLEWFNVTEELSLYRHLNGKIIILDFF
    TYC
    CINCMHILPDLDDLEKRFPITDGLVVIGVHSAKFSNERDSKRLLSAIQRYNIKHPVVNDKTLSAWRNLGISCWPTLL
    MIGPTGELLAVFVGEGHRDELILFVEVALTYFKSLNKISKNDLPLQLECHLLATVDNKNLLFPSKLEIFQNEQGENLIIA
    DTGNNRILIVDTKGNVQHVIGGSNPDFRDGDFENARFNAPQGVCILDTFIYVADNENHAIRKIDLIKKMVTTVVGTGIQG
    HDYIGGKIGKDQILSSPWDLAIYKYEYNKNIIPILLIAMAGTHQIWALFLEDTIWWKKREYKAGTCIAIVGSGKEENRNN
    LYPHTAGLAQPSGLTVNKERKIAFFADSESSAIRSIDLESGQVSVVCGANRNPVDLHDYGDSDGIKYAAKLQHPLGITWH
    SKDNAVYITDTYNHKIKKIDVTTQNCKTIYGDGKPNEKFSFDEPSGIAISSEKDLLYVADTNNHEVKVIDTKKENITTLS
    INISTIEMNNSSKNIYFFDTTVNEKGAELNISFNIIFFERDLKLNLDAPQRWTLNLPINNSGWIARARNGELSNPISIKI
    PEGKETQEVCVILDIIACKTTECVSKKLSVTYRIHQEAHACNIVTEQKQLIVK

    >gi|110763326|ref|XP_392086.2| PREDICTED: similar to peroxiredoxin 3 isoform 1 [Apis mellifera]
    MLRFLASLHSHTCKAVYVATSNLVKTKQPTLVKHARNFCVSSKLFSCQLQIQKPAPEFSGTAVVDGDFKEIKLSDYKGKY
    VVLFFYPLDFTFV
    CPTELIAFSEKISEFKALNTQVIGVSTDSHFSHLAWTNTPRKQGGLGGNLDKEGILRQLSINDLPVG
    RSVDETLRLIKAFQFVEKHGEVCPANWQPDSKTIKPNPKDSKQYFESVN

    >gi|110760809|ref|XP_001120855.1| PREDICTED: similar to CG6000-PA, isoform A [Apis mellifera]
    MSEEYDVGYSDVLSAQKDRNILIIDVREKEEIGETGKIPGSINIPMSDVENTLINFSNKEFKNKFNKEKPSKNTKIIFCC
    KAGRRSGIIQKQMQKLGYKNSYNYSGGWRDWERRSKR

    >gi|66548188|ref|XP_393445.2| PREDICTED: similar to thioredoxin peroxidase 1 CG1633-PA, isoform A isoform 1 [Apis mellifera]
    MAPQLQKRAPDFRGTAVVNGEFKDISLSDYQGKYLVLFFYPLDFTFVCPTEIIAFSDRADEFEQIGCKLIAASTDSHFSH
    LAWVNTPRKQGGLGEMNIPLLADKSSKIARDYGVLDEESGVPFRGLFIIDDKQNLRQITINDLPVGRSVDETLRLVQAFQ
    YTDKHGEVCPAGWKPGKKTMKPDVVGSKEYFKDT

    >gi|66557006|ref|XP_624650.1| PREDICTED: similar to CG7830-PA, partial [Apis mellifera]
    TQGSSLSDRVQQLTELSLTRPVIKFNGAKFKEYVKTTPRNYSVIVMFTAMAPQRQCHICRHANDEFVIVANSFRYLQSHS
    KKLFFASVDFDEGSDVFQMMRLNAAPVYMHFPPKGKPKPADTMDIQRVGFGAEAIAKWISERTDIQIRVFRPPNYSGTVA
    IVMLLILIGG

    >gi|110748749|ref|XP_395584.3| PREDICTED: similar to DNaJ domain (prokaryotic heat shock protein) family member (dnj-8) [Apis mellifera]
    MKFSFFIVIFIVTTYLLSSVSGSESLGNPYKILGVHKRATLQEIRKAYKNLVKEWHPDKTDHPGAENKFVEITKAYEILT
    DPERRKKFDNHGITEENISRQRRDNSHFNNVFDPLEELFMSITYRSFENVIVPKTFRTPYLILFYSDW
    CFACLQIEPTWR
    RLIDELEPLGLGLATAHAEKESALARKLGIHSLPCLVVTIDGRTSVYKESLFSIQKIVDFLRSKFPYKLISNINKNNIDS
    FLSGWIDNRIRALIFDKKESVRLRYLFVAFYYRDRVAFGFVQMEKPETELIMTKYKISVDLDTLLLFNENSEKPMASVSM
    KDISSDTMHNIISNNKFLALPRLSNQAMLDSLCPPEWLRPQKRLCAVLISQQNSHFHDLARHKFRQAALESSYSTERVRY
    TYVFKDTQPEFVSALSTGEGSPLEPLLHIVIIWRRDANHLKYEWLPTGWIEAAQDESQWNETRRNLEQTIQRLLRASEAL
    PYAAVVGELADEHAQGTVDKLIGKALLAVDYISDSLTKEQILPLVSVIATLMLIGAAGYGMSYLAKLEEASIQAERAQCK
    NNSKPTPTQPQLRLHELRAEKYNGLVRLLKPGCRTIILLVDDQSRLKLLPAFHKAVWPYRKNKTLMFGHLSLERGLEWYK
    KLLSLTLPEQKELNINAKNCIGTVLSLNGHRKYFCMYHAKHPECIKGKGSKRIERMTKQLTRKTDDAEAGAFIGFDSSNE
    SDNGNNILCQDNLLDGLPMWLDRLFEGLTHRYYINYWPEFTAK

    >gi|66546646|ref|XP_623095.1| PREDICTED: similar to Phospholipid hydroperoxide glutathione peroxidase, mitochondrial precursor (PHGPx) (GPX-4) [Apis mellifera]
    MSGNDNYKEAKSIYDFTAKSIKGEDVFLSKYKGHVCLIVNVASKCGLTATNYKELNELYDEYAESKGLRILAFPCNQFNG
    QEPGNSEDICNFADRQKVKFDLFEKIDVNGDSAHPLWKYLKKEQGGILGDFIKWNFTKFIVNKEGKVVERHGPNVAPSNL
    KNHLEKYF

    >gi|66503969|ref|XP_623933.1| PREDICTED: similar to Ero1L CG1333-PB, isoform B [Apis mellifera]
    MKIESSENMFGVLILFTVFSPSIVHSNYFNTNNEKNDQCFCKLKGSIDDCSCNVDTVDYFNNMKIYPRVQSLLVKDYFRF
    YKVNLNHECPFWTDDSK
    CAIRYCHVQPCQDEDIPDGLKGDILRNVHFNENPMDKYKIRAQYDDCLYSAKDHNKELGYLNT
    TISSENYKDFELWQQYDDAQDNFCVKESSPGEYVDLLLNPERYTGYKGPSAHRIWKNIYMENCFRPENSPHNFIQSSKIN
    GMCLEKRVFYRVISGLHASINIHLCSKYLLSSKDNLGIVPGGQWGPNLQEFQKRFSPEETGSEGPNWLKNLYFTYLLELR
    ALAKAAPYLEREEYYTGNKVQDKDTRLAINDILNIIKSFPDHFNESVMFTGGSEAQLLKDQFKQHFRNISRIMDCVGCDK
    CKLWGKLQIHGLGTALKILFSGKFDRWESTLNNFNRRKFFLERSEIVALINAFGRLSESIFELDKFRQMLR

    >gi|110768962|ref|XP_001122282.1| PREDICTED: similar to Peroxiredoxin-2 (Thioredoxin peroxidase
    MVANVNTEIKPFNTTAFHNGKFVDISDADVKGKWSIFFFYPADFTFVCPTELGDLADHYEELQKLGVEVYSVSTDTHFTH
    KAWHDASDTIAKIKYFMLGDRNATLTTNFGVLREGQGSADRATFLVDPQGIIQCVEVTAEGIGREASDLVRKVKAAQYVA
    SHPGEVCPAKWKEGEKTLAPSLEL

    >gi|110763747|ref|XP_001120329.1| PREDICTED: similar to CG13623-PA [Apis mellifera]
    MAKLKHAIWDVSSNFVANRYFSRLLTSQWYNTSTVSLLNNTLIDSTVKDKNDIIITDSCVKRLKEITDDNAYLRVTVEGG
    G
    CSGFQYKFDLDTNINENDKVFQKDGAKVVIDSTSLEYIKGSTIEFHTELIRSAFRITNNPLAEQGCSCGASFSIKI

    >gi|110760140|ref|XP_393706.3| PREDICTED: similar to CG7650-PA isoform 1 [Apis mellifera]
    MSTLENKILGEKLHYYCSSSSEDEENDSADSDKETEDEKYPQIITDSIEPSFSEWDGTSSNTGPKGVIKDWQRYKQLQAE
    KRDEQDKERIKLIKKLSLTCRSSLDEEKEKIMQTDPDLAELLTDEFLLEYQKQRMKEMLAKTEKLRFGRIINLETADQFL
    EAVDNEEKSITIIVHIYENNIPG
    CEAMNGSLISVADDYPYVKFCKILGSVAGLSKHFKKEGVPALLVYKAGQIIGNFVHI
    TDYLGEDFYASDVETFLIEHGMLTDKNCIPVITIQDKHTLSDSE

    >gi|110760144|ref|XP_392715.3| PREDICTED: similar to Smt3 activating enzyme 2 CG7528-PA [Apis mellifera]
    MAANINGVFTENLQNAILQSKVLIVGAGGIGCEILKNLVMTGFTNIEIIDLDTIDVSNLNRQFLFQKKHVGKSKADVARE
    TALTFNPDTKIVHYHDSITTSDYGVSFFKKFTLVMNALDNRTARNHVNRMCLAADVPLIESGTAGYEGQVELIKKGLSQC
    YECTPKAAQKTFPG
    CTIRNTPSEPIHCIVWAKHLFNQLFGEEDPDQDVSPDTADPEAADSAGQNALNSKSNEKGNVDRTS
    TKIWAQSCNYDPEKLFTKLFHDDIKYLLSMDNLWKKRRPPIPLNWKELPDGGFKEINEPGLKDQQRWSISKCGKIFAESI
    KSLSNTLKVSQEKSSNNHLIWDKDDPSSMDFVAACANIRAYIFGIPQKTKFDIKSMAGNIIPAIATTNAIVAGLVVLHAF
    RILENNLKACRSVYLRSKMNHRNQLLVPEKNVNPPNPKCYVCAPMPEVILAIDTSKTTIKELLEIVLKSRLNMIAPDVMI
    DGTGSVVISSEEGETEENNDKLLEELGIKDGTILKVDDFQQNYSLTITIIYRERPSLKGDSPDFLILADEKDLKPKEDND
    LIKPSTSNGQVESSKENVMIVETETVSLDTVKKRKTNSLEEIVSPKKRKMEVHNVDDDISIIENDITNDAGNTKSNIKIH
    KNSEDDDCLIVHDDNMQTTTTSQ

    >gi|66559527|ref|XP_624993.1| PREDICTED: similar to lethal (1) G0136 CG8198-PA [Apis mellifera]
    MASSMVAAATVRAVKGRKILATRAALTLTPSAVKKIKELLKDKSEFIGLRVSVKQRGCNGLSYTLDYAKEKSKLDEEVVQ
    DGVCIMIDKKAQLSLLGTEMDYIETKLSSEFIFNNPNIKGTCGCGESFSV

    >gi|66519264|ref|XP_625213.1| PREDICTED: similar to CG14407-PA [Apis mellifera]
    MIPFRSFIVRSFSTTSNKIANLVKKNKVVVFMKGVPDSPKCGFSNAVVQILRMHNVKYDAHNVLEDEQLRQGIKDFSNWP
    TIPQVFINGEFVGGCDILLEMHRNGELIAELKKAGITSALLEEDESPEKKTKD

    >gi|48103956|ref|XP_392909.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 [Apis mellifera]
    MGSDHMHRRWSNLRKVLERSGPFCRPDFEPSTETLQFLLDNCKILVVGAGGLGCELLKNLALMGFRQIHVIDMDTIELSN
    LNRQFLFHHKDIGSSKAEVAAKFVNNRIPGCNVISHCCKIQDKDEEFYRQFHIVICGLDSIVARRWINGMLLSLLIYENG
    ELDRSSVIPMIDGGTEGFKGNARVILPGLTACIECTLDLYPPQVTYPL
    CTIANTPRLPEHCIEYVKVIQWPKENPFDCAI
    DGDDPQHINWIYEKSNERAAQFGIQGLTYRLVQGVVKNIIPAVASTNAVIAATCATEAFKLASSCSASLNNYMVLNNVDG
    IYTYTYEAEKKEDCVACSQVPKEIKINNPKFKLKDLIELLCERSDLQMKNPGLTTYIDGKNKTLYMQTVASIEERTRENL
    TKTLIELGLRNDSEINVADITTPNTIVLKLKFLYCNIDV

    >gi|110760858|ref|XP_001121155.1| PREDICTED: similar to CG4670-PA [Apis mellifera]
    MNRFDVSLLWKLWLISIITVNCNAAVPKEPYQNQIPTQGLYNTSDDVVILNVTNFKSSVYEDTKSWLVEFYNSWCGYCLR
    FAPIWKDFANDIYAWRDIVVVAAIDCADDDNNPICREYEIMHYPMLKYFSVNAHSPSLGLVMEKYNKLNELRHSLIDLLE
    REQQEGRGISWPNIAPYRYYETTNIWKAIPNTVKYFFLLFEKTDSHLGAEVILDMHKIKILQMRRVLSDNELLCETNKIT
    NFPSLIVLGRNETQKNLKIRIPTREGIYNVIKEFITSKGEIIHENTFKNYSIKNENHKLSISTTKQLQIIEQQKNIEKNE
    DYLYQLDLENTLKYSISHEIPLHKMIKDKKMDALKKYLNVLAEYFPLKYGNIFLETIRDIILKRSNISGEEFSQIVKSIE
    EEMSPIYSGPSKWIGCKGSKEEYRGYPCGLWTMFHMLTVNFAILNKDAEHEPRKILEAMYGYIQYFFG
    CADCSQHFVQMA
    SKNKMFEVSNINDSILWLWSAHNEVNARLSGDNTEDPEYKKIQYPAKIYCPNCRYENSTWNEENVLHYLKTNICVVLYVA
    SAIILILVCIKFAVKRTYRKRNYIYGFNYCLK

    >gi|66507327|ref|XP_623205.1| PREDICTED: similar to ubiquitin-activating enzyme E1C [Apis mellifera]
    MGFRQIHVIDMDTIELSNLNRQFLFHHKDIGSSKAEVAAKFVNNRIPGCNVISHCCKIQDKDEEFYRQFHIVICGLDSIV
    ARRWINGMLLSLLIYENGELDRSSVIPMIDGGTEGFKGNARVILPGLTACIECTLDLYPPQVTYPL
    CTIANTPRLPEHCI
    EYVKVIQWPKENPFDCAIDGDDPQHINWIYEKSNERAAQFGIQGLTYRLVQGVVKNIIPAVASTNAVIAATCATEAFKLA
    SSCSASLNNYMVLNNVDGIYTYTYEAEKKEDCVACSQVPKEIKINNPKFKLKDLIELLCERSDLQMKNPGLTTYIDGKNK
    TLYMQTVASIEERTRENLTKTLIELGLRNDSEINVADITTPNTIVLKLKFLYCNIDV

    >gi|110768415|ref|XP_001122693.1| PREDICTED: similar to Suppressor of ref(2)P sterility CG4086-PA [Apis mellifera]
    MSILQRLSKLPQNLYCFTNIQRYPKRNESFLSASRQSSLLKTIFKASLVGISIGFPVGIIITTGYSWYINKKAAKTYHLE
    GKEKKIKVLQEKPSVPVSREVVSPMDSTELKLTLFQYQT
    CPFCCKVRVFLDYYGISYDIVEVDPVLRKEISWSSYKKVPI
    LLAQIEERKWRQWVDDEFVHTLSPNVYRTLSEAYKTFNWFSEVGKWEEYFPMWERLIIINIGAIAMWFISKRLKKRHNLK
    DDVRQSLYDEINKWLYAIKKHGGTFMGGKKPNLSDLAVYGILKSIEGCSAFKDALENTKLCTWYDAMTKEVETHSGSKYL
    MAK

    >gi|110759446|ref|XP_001120016.1| PREDICTED: similar to erv1-like growth factor [Apis mellifera]
    MSNEKPCRACMDFKSWAKSQRKTLESEKESEEKKKKSPSVNKVKRNDCPLDKDELGSVTWSFLHTMAAYYPNNPSEEQKS
    DMKQFFHIFSKFYP
    CNVCAEDLQEQLKHSPPETNSQEQLSQWLCKIHNEVNRKLGKPEFDCKLVDQKWKYGWLDGSCD

    >gi|110755129|ref|XP_001121486.1| PREDICTED: similar to CG18130-PA [Apis mellifera]
    MARRKEAVLQVEIESEDDWKQLLEKKGLILIDVFSSWCGPCVAMVSMLRSVKMEVGDAINYAIVKNDYISDLERFRERSE
    PVWMFLENGQMVNMMFGANCPQLRKLIMAEIKRVQYKEEPEMQQPVSTRTAEEEIAWQEKEAVRKAIEERERAKEEAERL
    EKYEAFLAQMIFELSEFTALVFYPWVFKDEQGRHRDNAGLTDGRTIAMRLKGRRPHPDWPVPFPFECPKGVKRCPTREIN
    DVENYLIHLLTSKEPLLQGNVVPFNTNDSYMERHVYVHEPDPEDEEDFPRSHPAVWVPPQARSKVHVYTSLFASYMELVH
    PYEEPVPPPPFCAFKFYYAKFPILSETCALFPDAVEYFGAFEFDAPPIARRIASSPEDFERKAKYQTGNEIFVIILRRVS
    EDAFLSFASIEPYFVTEDHEKAEAMIDEYFPEGAEDAILELYLEDEMEEEEEYYEEEEDIDHDIEIRKEEEEVFATYEFM


    >gi|110766774|ref|XP_623429.2| PREDICTED: similar to SelT-like protein precursor isoform 1 [Apis mellifera]
    MLRRMKLILCFCIILCAIGNKADDNQVSLTKLGTKTGPTLKFFYCYSCGYRKVFEEYVNILKQKYPELQINGENYIPSHT
    KMLIAKLLSFVKISLIVLIKDISYHQELLKYILMMFLCGPNWKLEEYHNHLSYFK

    >gi|66513481|ref|XP_394434.2| PREDICTED: similar to Ubiquitin activating enzyme 1 CG1782-PA isoform 1 [Apis mellifera]
    MSSAEVVESSVDPPAKKRRVAATTGGADDSTTIADMAKNGSTSRASAEIDEGLYSRQLYVLGHDAMRCMASSDVLISGLG
    GLGVEIAKNVILGGVKSVTLHDDALCQISDLGSQFYLTEADIGKNRAIACCQRLSELNNYVPTRHYSGPLTDCYIKKFKV
    VVLTETSLKEQLRISEITHANNIALIIADTRGLFSQVFCDFGEKFTIVDINGEPPVSAMVASISQDTEGVVTCLDDTRHG
    MEDGDYVTFSEVQGMTELNGCDPIKIKVLGPYTFSIGDTSKYSEYIRGGIVTQVKMPKILQFASLKDALKKPKFQITDFG
    KFDYPEQIHLAFMTLHNYIEENRKLPRPWNQEDANEFLSLARTLKEEVGSETEINIELFDIFAKICSGNLNPMNATIGGI
    VAQEVMKACSGKFCPIFQWLYFDAIECLPTDRSEFTEEDCCSIGSRYDSQIAVFGRKFQSKIGNLKYFVVGAGAIGCELL
    KNFAMLGVGAENGSVIVTDMDLIEKSNLNRQFLFRPSDVQQSKSSTAAKVIKSMNPSMKVIAHENRVCPETEKIYNDDFF
    EVLDGVANALDNVNARIYMDRRCVYYRKPLLESGTLGTKGNTQVVVPFLTESYSSSQDPPEKSIPI
    CTLKNFPNAIEHTL
    QWARDNFEGLFRQAAENAAQYISDPQFVERTIKLPGVQPLEVLESVKTALVDERPKSFADCVAWARCHWQEQYSNQIRQL
    LFNFPPDQVTSSGQLFWSGPKRCPEPLTFNVNDPLHLDYIVAAANLKAKVYGIPINRNREEIARIVSTVQVPNFTPKSGV
    KIAETDSQVQVSNGSGNIDHERLTQLQEELPRVEDLNGLVIYPQEFEKDDDTNFHIDFIVAASNLRATNYKIPPADRHKS
    KLIAGKIIPAIATTTSVVAGLVCLELIKLTRGVKDLSIYKNGFVNLALPFFGFSEPIAAPKLKYYDTDWTLWDRFEVKGE
    LTLKEFLDYFKEHHNLEVTMLSQGVCMLYSFFMAKPKCQERMSLLMSEVVKKVSKKKLEPHVRALVFELCCNDTDGNDVE
    VPYVRYTLP

    >gi|66566513|ref|XP_395605.2| PREDICTED: similar to CG7830-PA [Apis mellifera]
    MDYKKFIILLGIILSLSYVCCQYRMKNTQGSSLSDRVQQLTELSLTRPVIKFNGAKFKEYVKTTPRNYSVIVMFTAMAPQ
    RQ
    CHICRHANDEFVIVANSFRYLQSHSKKLFFASVDFDEGSDVFQMMRLNAAPVYMHFPPKGKPKPADTMDIQRVGFGAE
    AIAKWISERTDIQIRVFRPPNYSGTVAIVMLLILIGGFLYLRRNNLDFIYNKTIWGLSALFFTLTMISGQMWNHIRGPPF
    IHRSASGNVAYIHASSQGQFILETYIVMVLNGAVVLGMILMIEAASRKGDVKKRRIFATIGAGLVAIFFSLLLSIFRNKA
    QGYPYSLLFK

    >gi|66524108|ref|XP_623128.1| PREDICTED: similar to Thioredoxin-like CG5495-PA isoform 1 [Apis mellifera]
    MGAVRVINDDGQFYGEMASAGTKLVVVDFTATWCGPCQRIAPIFEQLSLKYPNAVFLKVDVDKCAETAAMQGVSAMPTFI
    FYRNQTKLGLCQGADPTGLESKILQFYGSGDLEDSESPVSGHMDLATFITKAQSECLNESDDHNFLQCLNTDDGYLESEC
    DEQLILSIAFSQAVKVHSLKIKAPKDKGPKNIKLFINQPRTIDFDMADSNTSIQDLTLSAKDIEEGNPIALRYVKFQNVQ
    NIQIFVKDNQTGNEVTRIDHLAIFGSPISTTNMGEFKRVNGKKGESH

    >gi|110755878|ref|XP_394510.3| PREDICTED: similar to viral IAP-associated factor CG18593-PA [Apis mellifera]
    MAYDLVFGSGYKTWPWSSTAARSTGFPDYNRLNVVNEDSRKYQDPNEDTEWNDILRRKGIIPEKPKEVTEEQIVDIVENT
    INEKTGCAPNDLENKTLDELDELEDEEDEKVLLEYRRKRIAEMKELANKSKYGEVKEISAEDYVQEVNNAGDDIWVILHL
    YKSGIPL
    CTLINQHLINLAKKFPTTKFLKSISTTCIPNWPDSNLPTIFIYHNGNMVKQFIGPIELRGMKLTEAELEWMLG
    QAEAIPTKITKDPKPKIRDVLFSSLRYENDDVADNCYTCYSMNYETYNPLSAIHESDSYENIFDINDNEVDICNTTLYSS
    LTDNEQDEKNISIRKFMMSPDYRSEDLSFSSDNKSKCSSDSFCNYCFEDCVSNWIETSAASIHSEAFNDIKQSNLDSSSF
    HTSKYNEYLTDDREYNSRRSSLTESECSLDITDDIDSLLTEFEHDNGTSINKDKYKCLSCSLKFSNARTLAMHQAGAHGG
    MYIILCESCGRLFNRKYHFNRHFIHCGRLKEPFKCDMCFKMYRHKSSLIHHLKVVHHIHYARNRTATFVCNVCNKIYSKF
    GAFENHMKSHKNEPDCMDTPNDVTS

    >gi|66514111|ref|XP_394865.2| PREDICTED: similar to CG11007-PA [Apis mellifera]
    MPFKKDLRLLLKPYYFINILLSLSYIISKRISIICNYVFAQAECELDGRETEILFFLMIVIMIRTRKTGSVTMISYLSSS
    FVYTKVANLILWFYADIRMGIIFAIIFILCGLMFPEPTYQGPEKVTYLRGANGLQEELYRDTKVIWLVAFYTAWNPA
    CVN
    FAPIFSELSAEYALENLKFGKIDIGRYPDAALKYHISDASTSKQLPTLILFKEGKEIERRPHVDHKGKLIKFLFSLDNIK
    AAFDLNNIYRDCKKNPIKKKEKKIVKTE

    >gi|110762777|ref|XP_393604.3| PREDICTED: similar to thioredoxin domain containing 11 isoform 1 [Apis mellifera]
    MLKEELESSTRNGDNSHTTTPDSGSNDVAKESYQKVAIEERLASKMFSYARKIIRFFLAIIFTTLAALHSSSPKVSKPPL
    AKPFFNQSSVVLDFYKGHLGAMIERVTEADFSFVMYYAPWDAESQTIRQEFEMVAQYYHSQIFFAAINCWHPSSECRAQY
    NKIQSYPVLMLYPSRDSGIEYRGIRTWPYMIKFLNTIMNPIVRVTDKEQLMNLRVNYDAVVVGYFNFTRLDKTPGYKEFY
    KAALRTLEEDPNRELVFAIVTNALSSEIDYNIYKFPSANLFMWSDSLRYPENSEWTSENILNWISSSIHQPVLWLQPPGV
    KALTLAPYLREGPVLFLFTPRNPLHPENYNYNLIREIGLQYYNCADNVLAKEIIERLSFKRRVAIAKHLERNNQCAKYLK
    EMKNQTNESINNISIQKWINDSCCVNVIMNKCFLCKKNILDNAEMETSICKLTSKKLNHVCKSSDIFKFLVMQNLQQKRE
    ICCNEDHITIKYEERFKTKRWITGNKYHQPIFPRDKLEHPNINLTKSVCKTNKTLTLIAIDSLHYYYFAEALGIDLLKKK
    DKTAIVILDVAHESQYVMQEDFSRYTLIQFINNYTQGFLQRTLRSNNSRRFVQKFKSKVNCKTKDAQNVCIPELTTETFL
    NTILDSTKDVVVMYHSPYCAF
    CSAIFYVYLTVAHYLHKMDHLLFVRVDGDNNDLPWEYNMNRFPKEDSTVYPFSLPITIP
    NLINFILANLDGDSHIEALVNICQSGAAGVIPDACIARTRWLCLDIIQQLLRDYRKLIRHISLLGRISVRNKKKIILLKL
    AHIKDIHLILGSTIDLKEEQHKIAK