Pichia stipitis CBS 6054 uid18881

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|126132480|ref|XP_001382765.1| hypothetical protein PICST_87980 [Scheffersomyces stipitis CBS 6054]
    MTTSKISPTLSTTRTSKLLTLSAGCFWGVERVFRKQFPVGLVDVKVGYANGIPNVGEVNYEKVCTGATDFVESIQIAYEP
    SEVTAEQLLDIFFRMHDPTTVNSQGPDVGTQYRSAILTHEEEDAALAAAFKEDYQVKWYPKDKIVTIVEPIQIWYDAEDY
    HQQYLNKNPGGYECPSHFIRTKPKI

    >gi|150864170|ref|XP_001382888.2| hypothetical protein PICST_8389 [Scheffersomyces stipitis CBS 6054]
    MPELRRSARVSKSAAPVLDVEPPKKRAKKTSTASEPASVPADSNEIQVGDKIPDLTLLDEDENEINLKEAASKTKFLIIF
    AYPKASTPG
    CTRQVCGFQKNFEFLQKSDVTVFGLSADQPKSQKNFVTKQHLKYPLLSDPSKKLIGVLGAKKSPSGIKRSH
    WIFVDGILKVKKIQISPENSFNGAKLDI

    >gi|150863793|ref|XP_001382390.2| Oligosaccharyltransferase, gamma subunit [Scheffersomyces stipitis CBS 6054]
    MKSGLLRICLVVSTLVSFVLGALSNSQLQSLVKSQGRTKVITLTDENYEQILNGPRDYYLVVLLTSEAPQINCVLCKEFR
    PEFELLANSWVQDHPDGLTKKELEINDEDPPSILPKNVYFLRSEFMESRSFFQIFALNSIPKVFLFPPSEKAGPNNFIGE
    VKEYQFFAGSHSELLKAWVSDQTGHKLNIYIPTDYYRIGINVFSVVTLVSLLVRVRKQVASVVTSRVLWSGLSLIAILLL
    TTGYMFNQIRGVPYHKEHENGKIEYFMPGQQNQFGVETQIVSFIYGMLSLLVIVLIKRVPEIKSSSVFLTAVIFVSTLIF
    LFYSLLLSIFGVKGVGFPYKLLELF

    >gi|126131924|ref|XP_001382487.1| Rhodanese-related sulfurtransferase [Scheffersomyces stipitis CBS 6054]
    QTRAYSVLTETPVAKLYNYKDVKEIASNPQSYPGSVLVDVREPVEFNDGHIPGALNIPFKSSPGALDLSAEEFRENFGFD
    KPSPEKELVFY
    CLGGVRSTAAEELANTFGYTKRGNYVGSWEDWVANENA

    >gi|150863887|ref|XP_001382517.2| hypothetical protein PICST_65232 [Scheffersomyces stipitis CBS 6054]
    MSLQVGDKFPSNIEFQHIPINVSEVENNNVLKCEIPTLLKLDKVFEKLADTETPNVLIVAVPGAFTPTCTENHIPPYLEH
    LSDLKAEKHIGAVIIIATNDAFVLNAWGKLLIKDAIKNVASIKEANGPSVYFASDVNGSFSKSFDLASDKGTGIRTSRYA
    TVIDSKDKTVKYFGVEVERGVKFSGLDAVLGAKL

    >gi|150863891|ref|XP_001382524.2| hypothetical protein PICST_65236 [Scheffersomyces stipitis CBS 6054]
    MIKIRRPLVTTFLLFVIVSSVYYMTSSGGNTGSLGLSSPLNLSNFNPISDLTHDQGEEIVKDEVSDSISNLTNDHVKNGE
    DEKSKKKPKKAKKVESESEDGFTETPFMPKMADETLKAQLGNAAWKLFHTILARYPDKPSKQEQATLKQYINLFAQVYP
    C
    GDCARHFRKLLNKYPPQTSSRKNAALWGCDIHNKVNTRLNKPIYDCTNILEDYDCGCGEDEKEADFTLGNKTKEAKEHLN
    NIIISEKEEEPQLGG

    >gi|126132194|ref|XP_001382622.1| Peroxiredoxin TSA1 [Scheffersomyces stipitis CBS 6054]
    MVALIQKPAPAFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPTEIIAYSEAIKKFQDKDAEVLFASTDSEYSL
    LAWTNVARKDGGLGPINIPLLADTNHSLSKDYGVLLEEEGVALRGIFLIDPKGVLRQITVNDLPVGRSVEESLRLLEAFQ
    FTEKYGEVCPANWTPGAETIKPEVSSSKEYFGKVNKD

    >gi|150864383|ref|XP_001383169.2| subunit of N- oligosaccharyltransferase complex [Scheffersomyces stipitis CBS 6054]
    MYGSFTYLTVVFTAFLTLVCGSSLQLQQLLLQSSDYEHNIIPIVQSDLSSLSGPRDYFTLMLLTSSDSKHQCDVCVEVQK
    IISRVADSWFAEYRTNSNLVFINVDIIDRENIKIFDALQITNIPHIWLFPPNIYKEHSTEKGLDFSLLEDPHYIYKVPEA
    PFEEQVREFARFLSENLNKSVAIKQKSPLNTFATTFIATLVIITLVKRKGPKVITQLPKKHVVTMLSVAMILLFVCGYQF
    SVSKGVPFVARNEKGLIFISGGTHYQFGIEVVFVAVNYLALGFAFLVLMYIGSYNVNSKSIIRSDDVKHVLIIVMNVIIY
    YLYSCLTSIVIRKDHDYPYSLTKLF

    >gi|150863974|ref|XP_001382635.2| hypothetical protein PICST_69865 [Scheffersomyces stipitis CBS 6054]
    MADSMLVDSPVPQEIDEGLYSRQLYVLGKEAMLKMQNASVLIIGLKGLGVEIAKNVALAGVKSLSLYDPEPVAISDLSSQ
    FFLDESAVGSNRAEVTAPRLAELNAYVPISVITDLSEATLSNYKCIVATNLSLEEQVRINTFTHERDIGFIAADNRGLFG
    QLFVDFGSSFTIIDQTGEEPHTGIVSDIEADGTVTMLDDNRHGLEDGDYVKFTEVEGMPKLNDGNPHKIEVLGPYAFRIN
    IDESYGKYVKNGLYTQVKVPKEIHFESLSSQLANPEYIISDYAKFDRPPQLHLGFQALQAFQTRHSGKLPRPYNSEDASE
    LFQLSQEIAVQFPTILGEASVDEKLIKELAHQATGDIPGIVAFFGGLIAQEVLKNCSSKFGPVKQWLYFDSLESLPSNEE
    FPRTAETTKPLGSRYDGQIAVFGKAFQEKIANLKVFLVGSGAIGCEMLKNWAMMGLGSGPDGKIIITDNDSIEKSNLNRQ
    FLFRPKDVGKNKSDVAAVAVQHMNPDLTGKIESKLDKVGHETENIFDDDFWKGLDFVTNALDNVEARTYVDRRCIFYKKP
    LLESGTLGTKGNTQVVIPNLTESYSSSQDPPEKSIPL
    CTLRSFPNKIDHTIAWAKSLFQGYFFDSPESVNLYLSQPNYVE
    QTLKQNPDIKGTLENISNLLNKRPYSFDDCIKWARLEFETKFNGDIKQLLYNFPKDAKTSTGAPFWSGPKRAPEPLVFDI
    NNSDHFNFVVGGANLLAYIYGLKAPVASFDDYKKVIDSTKIPEFTPRSGINIAATENEAEEQEKTLAGSIDDNEIRKIAA
    SLPEPSTLAGYRLNPIEFEKDDDTNHHIEFISAASNCRALNYAIETADAHKTKFIAGKIIPAIATTTALVTGLVCLELYK
    VVDGKDDIEQYKNGFINLALPFIGFSEPIKSARGKYNKKDFDQIWDRFDLEGNITLQQLLDHFKEKEGLEISMLSYGVSL
    LYASFFPPKKIKERLSLDLTTLIKQVSKKDIPDHVNYLIFEVCCDDEEGEDVEVPYICVSI

    >gi|126132266|ref|XP_001382658.1| mitochondrial protein required for iron metabolism [Scheffersomyces stipitis CBS 6054]
    QEDIDDFNATKLVHGKTDMQIAITKKASEKLNKIAVDDNNINTALKIGVESGGCHGFQYNLDLTDLEKELAQDEDDELLV
    FKRIDESGNIAQIILDESSLEILQDSKLDYTKELIGSSFKIVDSPYTSTSCGCGASFDFDFEKLQKTKRERAASK

    >gi|150864424|ref|XP_001383230.2| hypothetical protein PICST_81395 [Scheffersomyces stipitis CBS 6054]
    MAETNSREEELLRRIQELELENEVLKKKVAEVEYDAKYPKIDENFCLDEYKRYGRQMIVPEFGSLKSQIKLKNSSILVVG
    AGGLGCPALLYLSAAGIGKIGIVDDDIVDISNLHRQVLHTTDSIGMFKCDSAKKYICKLNPHVIVKTYPVRLHNDNAFDI
    VNDYDIVLDCTDTPAIRYLINDVSVLCRKTIVSGSGLKSDGQLSILNFNNEGPCYRCFYPKPPSAESITT
    CSDGGVIGPC
    IGLLGVSMAVETIKVLTGFYTKDNFKPFLSMYTGYPQQSFRVFKMRGRSDKCSVCGSFPTVSKEAILNNEIDYVAFCGKV
    DSNVLTPEDRITVQQFSDIVTRQSKAPVLLDVRTKEQFQIAKLPNSINIEWDPTFKKLESLDKYLPEDFDKDTDPVFVVC
    RYGNDSQLATRKMKQELDFKNAKDIIGGLNKWSDIVNPKFPKY

    >gi|150864427|ref|XP_001383236.2| Protein with homology to mammalian ubiquitin activating (E1) enzyme [Scheffersomyces stipitis CBS 6054]
    MARDTYLKKVLGDECFGRVQRTRVVMVGAGGIGCELLKDLLLTGYGEIHIVDLDTVTLSNLNRQFLFRKKDIDKSKSLTI
    AKAVQSFNYFGAKLVPHHGNIMDTNQFPLTWWSQFSYVYNALDNLEARRYVNKMCLFLKKPLMESGTTGFEGQIQPIYPY
    YSECFDCQAKVTPKTFPV
    CTIRSTPSLPVHCITWAKEFLFHQLFDESEISSMNNEEQIRNETDDVQEKENLAKEANELID
    LRNQIKGLDGSAFIESLVVKIFQADIERLLLIDTLWKSRRKPIPLNFNALSTELQQLLHAKNNIISTDTKVWSVLENLFV
    LYKSGVALQSRLKSGKESFVSFDKDDDDTLNFVVAAANLRSSIFGIPLMSKFDIKEIAGNIIPAIATTNAIISGFSSLNG
    TKFFKHDYEQTGSVDFSPIVKESSTVFISIKPNKYITAASLVSPNESCPSSSLLSRGIMNLTNQELQENTLRWLVDELVK
    KYGYEDGDLSIIVGKSRLVYDVDFDDNIDSSLSELSGFEDGDLVLIQDENDELENLELYITVVNEPTTEKLPNIQLREKK
    AIKEKNEDEQGDSTIENNTNQDGTTMVIIEDEEDTDLVMIAEPASKKRRIAGEEYM

    >gi|126133569|ref|XP_001383309.1| hypothetical protein PICST_35383 [Scheffersomyces stipitis CBS 6054]
    MPEPIESKEAVTPSNTSKPEVGLTGRKIIYDKDGKPCRSCNSLLDFQFATGGIKGIGATKKEKYNPYPKDIPADVEVLGK
    SSWTLLHSIAAKYPEKPDTKRQQDLKQFLTLFGSFYP
    CWFCGEDFEKYIKKHEPKVETQDSFGKWLCEAHNEVNVKLGKP
    KFDCNLWKKRWKDGWEEDP

    >gi|126134331|ref|XP_001383690.1| hypothetical protein PICST_77026 [Scheffersomyces stipitis CBS 6054]
    MLSRVLIRSAAVRTALPRATPVFRPSIVGTRFYSFKQEDQPRIRIGSTAPNFEVNTTSGKIDFHSYIGDNWVVLFSHPAD
    FTPV
    CTTELGAFSKLKPEFDKRGVKLIGLSTEGVDSHNQWIKDIEEVVTGGEKFGFPIIADSTKEVAYKYDMVTEDDFKN
    LESGVVFTVRSVFVIDPAKKIRLTMTYPASTGRNTAEVLRVVDALQLADKRGIATPVDWTEGQDVIIPPTVSNEAAKEKF
    GSFKQVKPYLRFTKLD

    >gi|126134357|ref|XP_001383703.1| glutathione reductase [Scheffersomyces stipitis CBS 6054]
    MAPVSAHNTFDYLVIGGGSGGVASARRAAKYGARVLLIEGKYHKMGGTCVNVGCVPKKLMWHAADLAHKKHHMKSYGLAS
    SEEEIKYGDFNWGLMKEKRDAYVRKLNGIYENNLNREGVNYLFGYAKFINSEGDVEVTLSGDQEIKFLEEGKTFKKDEKL
    VFAGKKVLIATGGAPIVPPKVPGAELGITSDGFFELEKQPKSVAVVGAGYIGVEFSGVFNGLGSETHFIIRGDTVLRSFD
    DIIQTTITDYYTDKLGINIYKQSGGVTKVEKTADGKKKVFLGNGKTLEVDELVWTVGRKSLIDLSLDKVGVKLNDKLQVS
    TDEFQRTANPKIFSLGDVVGKVELTPVAIAAGRRLSNRLFGPEIFAEDKLDYNNVPSVIFSHPEAGSIGLSTKEAIAKYG
    EENIKVYNSKFTQMYYGLVDHDEFKSPTAYRIVCLLPEEKVVGLHIVGDSSAEILQGFGVAVKMGATKKDFDNCVAIHPT
    AAEELVTMV

    >gi|150864743|ref|XP_001383705.2| hypothetical protein PICST_30564 [Scheffersomyces stipitis CBS 6054]
    MFKVKQTRLVAVASLFILLVFVLYRSSGSDTSTNSVAQVVTTNNIIDSQNDDKKDDAINQKILLSENNVDEADEGKPEVS
    EDKPFDPAQSFLEIRTLAPMTIFSKSY
    CPFSKRLKELLKDNYQITPEPQIVELDKHSNGRELQTYIGEVTGRSTVPNVIV
    GATTESRGGCDDLVKLHESGELLSLLAEWGGKKMVVKKIDAPSNL

    >gi|150864838|ref|XP_001383821.2| hypothetical protein PICST_43698 [Scheffersomyces stipitis CBS 6054]
    MSKLSELPKTSSFSSYIEPDGKIASTEVAAKNEDGIINKPRILSSGGFSYSLPELRKEYRFLTANEAALNDLGLDPEQVN
    DKEFQELVSGEFYLMYKDTFQDKGYPFPYSQAYAGWQFGQFAGQLGDGRVVNLFEVPKAKVQSNNRHKYEVQLKGSGKTP
    YSRFADGKAVLRSSIREYIISEHLNAIGIPTTRALSLTYLPATYAQRHAAEKCAIVSRFAESWIRLGTFDLYRWRGDRSG
    IRKLSDYVIDELFTVEGTKFCNFENLLREKSDFFDNTTESLGELTDYDKMYYETIVRNATTTALTQSYGFLNGVLNTDNT
    SILGLTMDFGPFSIMDKYSPTYTPNSEDHEQRYGYRNTPTAIWWNLTRLGEDLAELIGAGSKLLSDPKFERGEIDKDWED
    AIIKRATKIIEIGGDVYQYAFTKKYVETFFARLGISPKIIDYTNIDKHNVELIAPLLEVLYKVKCDYNKFFLILQDQKFD
    AENYNPDAIADNILAPSYDENDNRYSKKELTDEIKSWLGVYRAHLEESRAIDPTFSRLESKKYNPVFLPRNWILDQVIAH
    VQDSGAYDLSYLKKLERMSFYPFDSTKWGDDLKELEQSWLLQGDKGEDYSMLQCS
    CAS

    >gi|150864844|ref|XP_001383828.2| protein required for protein disulfide bond formation in the ER [Scheffersomyces stipitis CBS 6054]
    MNFSYFVLLVQVLVLSVSASSSQSLPQFKFSPFDSPDFCSQIITPTCNTTFSYIDDVNKAIRPSMRDLIKTSYFRYFKVN
    LDKQCKFWNAQHF
    CATENCAVEILSPEQYNWTKVKNENLNPSKLGKIERVGSTARDGALETEEPETCEDLDYSHIDDDHQ
    CVYVNLLENPERFTGYGGNQSFDVWKAIYSENCFPNTNPMSMIGEEKEQCIEKNLFYRLVSGLHASIAVHLSNEYLEPET
    GEFYPNLQVFMNRVGSFNDRLANIYFNYALVAQSLVRLAEVLPLKEFIHSGYDDISPAQQKHLLESNVLDPEEKYDDLLL
    NDIIPALASNSLFNTSTLFDPSSVDPKLKDEFRARFKNISAIMDCVGCDRCRMWGKIQTIGYGTALKILFESEDPKNHDI
    LKFRRIEIVALLNTFDRLSKSVEAINNFKSMYLEHLEDVKKGLAKPGDYETKHSNKGGFDFPFFSTPDSSASSKGSESTV
    AKKRLPPQPKKTSEGSNKLYYVESEKLYDVSKRTFSDEFKIAANEVWDALKFVLLSYKELPANLAEIALSKLITYWNLLI
    GKQVVFDYKSEVPLVDEQQQYDQLFSE

    >gi|150864683|ref|XP_001383618.2| hypothetical protein PICST_88514 [Scheffersomyces stipitis CBS 6054]
    MKFWKFSSSVLATLLAVVSVQASGPAEGDAVADPNSAVVKLTAETYKQFLDENPLVLAEYFAPWCGYCKMLGPEYAKAAN
    SLNETNPNIKLAQIDCTEEEELCRDQGIRGYPTLKVVSNGAYADYDGPRDAAGIANYMVKQSLPAVQVPADADALTAAIE
    EQTKPYVIQVGASTDSDAASAYEQVAKANRNDYSFFSVEEPALVKELNTKFTNVKVTGKSPSYYVVHPGQLDDVREFEGK
    DINADTLTSFVTTEVVPYFGDINRDTYLTYMGSPLPLGYYFYNTAEQRAAFADEFSKLGKQYRGKINFVGLDATQFGKHA
    ESINMDPAIVPLFAIQDTPNNKKYGVNQKENPEGPSLKTIKQFVADYLDDKLTPIVKSEDLPTEEEKKANPVVKLVGHNH
    NEIIEDVSKDIFVKYYAPW
    CGHCKKMAPIWEELASVFGSNKDDAKVVVADIDHTNNDVVLPFEIEGYPTLVLYPANGEVD
    EKTGLRKPVVFSGARELDAFIDFVKENGALGVDGHVLKAAQDKAAAEAAPEEEEEAAEEVKEEAAEDEDVEHDEL

    >gi|126135146|ref|XP_001384097.1| Iron Sulfur Assembly [Scheffersomyces stipitis CBS 6054]
    TSTKKKRVLRPRKALITLTSNAVDHLQALLNQPQPKLIRIGVRNRGCSGLTYNLEYVDQPGKFDELIEQDGVKVLIDSKA
    LFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV

    >gi|150865361|ref|XP_001384545.2| hypothetical protein PICST_67636 [Scheffersomyces stipitis CBS 6054]
    MRLLKLAVASLALPVVLASPATIPKIENEVQKDDGGISDPAELIVDAKANSNDNNINKNDSGNSPDSAISNSEKSQEDTK
    KKTDEQEGETNDSIQMPSQLTMADFDSSTSKQLSFIEFYSPY
    CHHCKALAPIWERAYKSIYPELAKLNIQMRQVNCVESG
    DLCEREDIAYYPNLRLYAPARDKKTGELIPGKSKDVDGFPRSLTRTSENFVKYLKKSVAEYNAGEIDMDSASELISTDAM
    LDIMAGDISEPHFVTFFPATDKQWTTTESTGKSQFDKACYDCNEVKQLWDKLSNHVLSVTKTGHFNCQSNPSICKSLGFS
    ELSKVNSKYLPKFAMFLPKRTGKIRFDYNGELSIPKMKSFVTRLFENSQYESLSARGLADVMSYRKSLPAEPLESYPKDG
    VVSIVFYYNEKTITEEDRAVLPYLLDYVTKSPFNVKLYTSKQDKIESNVLVQAESLVQFINYDHNEPHKQFNKAMHLATT
    LTSKPTLLVFKDNSLITTVFQSFAPEDIRNEKKIKEFIEDNQYPLYNELTPELLPYYFSDKTEKRADKIVVTFIDSNDAV
    ATNKAIFNMSLAAHEYNYLKKTFYFDDLLKNRSAKDKVVAKLKQSNADSLKIIAAMRKEIPHLFTNSEVLFTYVDISKID
    QFKHSAFKFNPDHYKPGDSIVISKDNRYYWDENTQGAQLTNDPHMLKPVLLSLLDSSRGPSINTKLVSSPYGGPLNFMNK
    IHDRGFIGYIGFFACIYFIAVIARRIVKQRRFASRQSRGIIGNNVPKKD

    >gi|150865437|ref|XP_001384654.2| Thioredoxin (Trx) [Scheffersomyces stipitis CBS 6054]
    MPYTPDSNVKHLTSLEELNDLISIRDKLTVVDFHAPWCGPCRAFEPVFEEIAEKVPEIQFAKVNIEVAKDIALRYKVASL
    PTFIYFKNGKKVDISVGVGGNRLFHLIKLNTGLDISTRIVKKMDRNQIE

    >gi|150865715|ref|XP_001385047.2| hypothetical protein PICST_46734 [Scheffersomyces stipitis CBS 6054]
    MSVATHSARDISSIESILRNIGPYNEVPDEYNADEAAEALRTTTVLVIGAGGLGCEILKNLALTGFKKIHVIDMDTIDVS
    NLNRQFLFRPKDVGHSKAEVAARFIQERIGDEELKITPYFGKIQDKPLEYYRQFGVIVCGLDSIEARRWINATVVSLVDS
    ELNNLIPMVDGGTEGFRGQSRVILPTLTSCYECTLDLLSPKTTYPV
    CTIANTPRLPEHCIEFASVIEWPKHFPGRKFDAD
    DPESVQWMYETALARAKLFNIQGVTKQLTLGVVKNIIPAIASTNAIIAASCCNEAFKIVTNTNPILNNYMMYAGDESIFT
    YTYAHSRRPNCPVCGNMSKKVIAKNWWTLDRFIEEISGKQEIQMSSPSLTTAEKSLYLRNPPNLEQATRPNLAKKFNTLV
    RAGDEVVITDPNLPISLRLTVEFTGPEVEPDDVNSSLM

    >gi|126136339|ref|XP_001384693.1| glutathione peroxidase [Scheffersomyces stipitis CBS 6054]
    MSKFYELTPKDAKGNDFPFVELKGKVVVIVNVASKCGFTPQYKELEELNKKYEGKNVQIIGFPCNQFGHQEPGTADEIAS
    FCQLNYGVTFPVLAKVEVNGDNADPVYKFLKGEKSGVLGLTRIKWNFEKFLIDKNGKVVERFSSLASPSSLGPKIDQLLK


    >gi|126136615|ref|XP_001384831.1| Thioredoxin reductase [Scheffersomyces stipitis CBS 6054]
    MVHHRVTIIGSGPAAHTAAIYLARAEIKPTMYEGMLANGIAAGGQLTTTTDIENFPGFPNGINGTTLMEQMKEQSERFGT
    EIITETISKVDFSARPFKLWTEWNEDSEPVTTDAVIIATGASAKRMHIPGEETYWQQGISA
    CAVCDGAVPIFRNKPLAVI
    GGGDSACEEALFLTKYASKVYLLVRRDVLRASTIMQRRVENNEKLEILWNTEAKEAKGDGKLLQSLSIFNNKTNVTSDLP
    VNGLFYAIGHTPATQVFANQLKTDSEGYIVTTPGTAETSIEGVYAAGDVQDKKYRQAITSAGTGCMAALDCEKFLSEQE

    >gi|150865580|ref|XP_001384854.2| hypothetical protein PICST_32213 [Scheffersomyces stipitis CBS 6054]
    MLFKRVILFLSIALSVSARAEGDEYASDPNIYELTPSNFDKVIQKTNYTSIVKFYAPWCGYCQQLKPAYKKLGKYLHQDS
    QYAVNVAAVNCDKDYNKPLCAQYKISGFPTVMVFRPPKHVDGKEYRKNEKHASEVYNGERSLKAMVQFLNSRLKNYVKKI
    PGFASETFNSWTTADDSFSKVILLTKSQQVSPLLKSLAIDFLNSVKFGMISSKSLKGDEVIVDGKEFALPKNEDGSIALP
    ALFYYDKEKGELVHYKNDGKLNDKKKISQWVVSVSGATPAEGPLSKKEQKYYYKYRTGKKAKKNVEHDEL

    >gi|150865869|ref|XP_001385258.2| thiosulfate sulfurtransferase [Scheffersomyces stipitis CBS 6054]
    MSRTILSTLSPAAFRALLGTATSASRVVPVDATWYMPNSGKNGLQEFLEQERIPNAGFFDLDAISLPGSKYPHMLPTYSI
    FNQAIQELGIRKNDTLVVYDKSGIFSSPRAAWTFALFGHPRVYLLDNYITYKQAEYQLDLKPVDTLSTPLPISEAEFKTK
    YDEQVIEYEELLDLVQTNKLAQDYYAFDARPHDRYTGKVPEPRPGLSSGHVPSSLSLPFSKVINADNKTYKSKEELLEIF
    KRDFDLDLSNSDFLKGKKGIIVM
    CGSGVTAVVLRFAIQSVIGLDVPIRVYDGSWTEWASRAPSELIVKTH

    >gi|126137531|ref|XP_001385289.1| Glutaredoxin [Scheffersomyces stipitis CBS 6054]
    TDKVVVYSKTYCPYCTSTKNLFQGLGQEFKLVELDINSNGSEIQRGLQELTGQRTVPNVFINGKHIGGNSDLQALNSSGK
    LKGLLA

    >gi|126138388|ref|XP_001385717.1| hypothetical protein PICST_48859 [Scheffersomyces stipitis CBS 6054]
    QSRFISTEIKDAIDKAVASSPVVLFMKGTPEFPQCGFSRATIQMLGQQGVDPEKFAAYNVLEDPELRDGIKEYSSWPTIP
    QLYVNKEFVGGCDIVMSMAQSGELAELLEANDALVPEDVEEEPQAANVKPSERS

    >gi|126138146|ref|XP_001385596.1| hypothetical protein PICST_73480 [Scheffersomyces stipitis CBS 6054]
    MTTTLRLGSEAPDFTAETSNGSISFHDFIGDSWVVLFSHPDDFTPVCTTELGAFAKLEPEFAKRGVKLIGLSANNADSHK
    AWIKDIDEVTGSKLTFPIIADPERKVAHLFDMIDYQDATNVDDKGVQFTIRSVFVIDPKKKIRLILAYPASTGRNTAEVL
    RVVDSLQTGDKYRVTTPINWVPGDDVIVHPSVSNEEAKTLFPKFRIIKPYLRLTPLEVKEQ

    >gi|126139135|ref|XP_001386090.1| FAD flavoprotein [Scheffersomyces stipitis CBS 6054]
    MAQFVRYASTKYDVVVIGGGPGGYVAAIKAAQLGYNTACIEKRGALGGTCLNVGCIPSKSLLNNSHLYHQIKHDSENRGI
    AIDGEVSVNFPKLMEAKEKAVKQLTGGIEMLFKKNKVTYIKGSGAFVDEKKVSVTPIDGSEELELEADHFIVATGSEPTP
    FPGITIDEERIVTSTGVLALKEIPKRLSIIGGGIIGLEMASVYSRLGSEVTVIEFQNAIGAGMDAEVAKTSQKLLAKQGL
    KFKLGTKVVSGVRDGEVVKIEVEDVKSGKKEDLEADVLLVAIGRRPYTEGLALEKAGLELDNKGRLVIDSQYRTKHDHIR
    VIGDVTFGPMLAHKAEEEGIAAAEYIKHGHGHVNYGNIPSVMYTHPEVAWVGLNEEQLKEQGIKYKVGKFPFIANSRAKT
    NLDTDGFVKFLADAETQRVLGVHIVGPNAGEMIAEAGLALEYGASTEDIARTCHAHPTLSEAFKEAALSTFDKPINF

    >gi|150866710|ref|XP_001386391.2| hypothetical protein PICST_37090 [Scheffersomyces stipitis CBS 6054]
    MDSKQSALIERFQDSKLNQIRGNNDDNDDDVHSESEDDLLATLDDDDDDVMAKYRESRIQQLSKEFSKINDTVKSTNESE
    LGNVILMESEKQVMDYVTSNEIVLVHFFQPNFAK
    CKLMNSQLDQLAEKHLELNVVKIKAENAPFLVVKLEIRVLPVVVIY
    RDAKVISRIVGFADLGSNPDSFTYEQLENYMAWKNVISRKTISYKHIRSNKKEESDDDFDYFE

    >gi|126139745|ref|XP_001386395.1| hypothetical protein PICST_49425 [Scheffersomyces stipitis CBS 6054]
    MKNLFYSFVSGSEYLVLVALDTEGCVYYASAGELNSQASMVELMEKDFLKAPEFRVNSLNSASSSLVNKKSEVKIKDTLE
    KFKSLIDFENKDEKIPYKVVFGTPLQRKVWDYLVNELPVGSISTYQKIAQHLGMPNSSRAIGNCVGANRIAVVIP
    CHRVI
    GSSGKITGYRYGTNIKKTILQNELGSKYGSTITN

    >gi|150866753|ref|XP_001386450.2| hypothetical protein PICST_50192 [Scheffersomyces stipitis CBS 6054]
    SNLLQVNDKNFKEIVIDSGKFTFVDFYADWCRHCKNLMPTIEELADVFEPFQDQVQVVKINGDKDGKKMSKKYVFKGYPT
    MLLFHGNDEPVEYDGIRDLQALSNFVQQITGVRLASIKPEGEVEESKVEQEPTGLIRLNDINFEDKIRETPYSIVVFTAT
    W
    CQFCQKLKPVLETLVDVVFANEKEKIQIAIVELDTEPGDKLSDRYHISTLPTILFFSNEYDEPSIYDGEKELLPLLASI
    NEFTDSHRDVEGRLSNTAGRIQEVDNLISQKILQGFKGDLSTAGIELLGEISHLSNENYEMLPYYKKLVSKIINNEMDFF
    KNEFSRLATILENDISKLTPNTIDSMQKRSNILSSFI

    >gi|126273947|ref|XP_001387353.1| predicted protein [Scheffersomyces stipitis CBS 6054]
    MVSQATTEKVKTLIKTKPVFIASKSYCPYCKATKATIGAITQEAYVIELDEIADGAEIQEALFELTGQKTVPNVFIGGEH
    IGGNSDVQVLKSQDKLDDKIKAVL

    >gi|150951463|ref|XP_001387786.2| thioredoxin [Scheffersomyces stipitis CBS 6054]
    MSIQFVKSTKDFDDYVKANKYLVANFTASWCGPCQSIKPIIDQLYTDTNARYEHIEIVRVDLDSQQELAAKFQISSVPSF
    VFLESGAEVKRVTGANVPELISSLDELNKKARDDPQAGRAGNGATAEKLSESSVYKDIDQYIPKGFEALNGTIDFGGFEA
    LNVVPLFKAESDADVKNAFRLDYKKEQSTVVSDADSQVLFYVPLLNISKVYSILLKFRPGKDIAEESDADAELELDADEL
    NDETQPPKLIKLWVNKNSILSFDDAASDSSAPHIEKIAIDGESVWYECKLKFVRFQNVQSLNIFIDGDDEDSHTTLDKII
    LVGVNGETKDQGKLSKDE

    >gi|150951491|ref|XP_001387817.2| Hydroperoxide resistance conferring gene. Sensor and transduc
    MVPHVSSPSQLAVDSDSGSSKNQTESPFYSFKVANSAGKLIDIANYKGKVVLVVNVASLCGFTPQYKDLETLYQKYKDRG
    FEILAFPCNQFGSQEPEDEDKIVVYCQRNFGVTFPIMQKLDVNGYFEAPIYTWLKNEKRGVVGFKGLRWNFEKFLVDRSG
    NVVSRYLSTVPPLEFEDAIVKLLKA

    >gi|126274152|ref|XP_001387857.1| putative thioredoxin peroxidase [Scheffersomyces stipitis CBS 6054]
    MSIRSISVGAKIPSTIVYENSPGNQVNLAEEVAEGKSIIIGVPGAFSPACSSSHVPGFIKRLRGFNEKGFQKFFVVAVND
    AFVTKAWGDALLGSTVAGAQIKFLADPSGAFTKDLDLLFDATKFFGNERSRRYALIVEDGTVTKTFVEPDNTSVVVSDSA
    NVLEEA

    >gi|150951554|ref|XP_001387891.2| thioredoxin [Scheffersomyces stipitis CBS 6054]
    MSSAPSKIQEIPDLAQFNKFIASGEKLTVIDFYATWCGPCKALEPIFELLAERVPEVQFGRVDVDQAQDVSTEYGISSMP
    TIIYFKNGAKVDTVIGANPPKIVQLISQHSGVDVASR

    >gi|150951208|ref|XP_001387489.2| copper-transporting P-type ATPase [Scheffersomyces stipitis CBS 6054]
    MACCVVAAGVYVALNSFYDKTKFDVSSNVVIGLPEPDHKFPYEAVKSVTMEVSGMTCSSCVSSIEDRINAIAGVTGVKVS
    LLLETCIIAYDPGMVANLDEFKEAIEEIGFEASFAKENRQQKSHEQRKLESLKKTYSFFVLAGVLAASTWVSKLLSRVAF
    LIDIRPFFIVLSVLLASVAQFYIGPIFYKPTWNTIKNRKPFTMDTLVALSTTLTYIISFTYVVDFFLETSTTLKEAYLDN
    LCFDLSSGILFVILGGKYYENLGKLKLSSNLSNLKKLLPESALRVNEDNSVVQIPCSVLKKGDMVLVRPGTKVPIDGQVV
    KGASFVDELCITGEPTPVRKEPNSIVIAGTYNKTSTLTVITTDAVQDSKLAHLFSFIGDTSTTKSRLTDYIQQTVNFFVP
    SIIVLSILTYVYWMYVSDVDSQLSGSQYARLRALAVVTVACPCALGLAVPAAITQGMNYASVKGCYVRGSGLDILMRISG
    IKNRTRAFVLFDKTGTLTSRNVVISDFRFKKKMNSILFWKLIIAAESFEDHPIAYTIVEYGQKQLAKLEDTESSDPNCVE
    FQYIPAKGIECQVTKDSRSYEIKVGNANILPDSSLRTSSDLWFLVDGEVIAECNLINPIRPESEVLLKYLSENNFEYGVV
    SGDRNEATARLCKKLGITNFWGECTPEDKFKVTRRIQEEYGLPVVMIGDGMNDAAALTQADLGVSLSAAHQLSIDSSEIV
    LMNDDLLSLIDLLRISVLTKSKMMFNIWVCIIYNIVMVPLAMGFFTPWGVSISPQWSSTLMSFNSVFVLVNSLRIGREMS
    AAKS

    >gi|126274416|ref|XP_001387955.1| predicted protein [Scheffersomyces stipitis CBS 6054]
    MAVIEIQSEAQFSELTKSDPSKLIALYFHTPWAGPCKTMNSVFKTLADSKAADPTILFLSINADDLSEISEVFEVSAVPY
    FILIRNSTILKELSGADPKEFINALNQFSNSAPAAVAAAAKEEAPINNGVGNGAGDVSESEEALDERLKKLTAAAPIMLF
    MKGSPSSPQ
    CGFSRQMVAILREHQVRFGFFDILKDDSVRQGLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDDQFFER
    ALAA

    >gi|150951285|ref|XP_001387583.2| predicted protein [Scheffersomyces stipitis CBS 6054]
    MGLTNDDKFPTTPKPKYIPYSKANDSLTACANPIELDLAKEFAGKTVVITAVPGAFTPTCTEQHIPDYLKNLEKFKAKGV
    SKIVVLSANDPFVMAAWGKALGYKDEENYIVFATDPLAKISSELGDSYVADLSSAGFGVRTARYAALVVDGEISFLENED
    SLGFTEISSAKNLLDRI

    >gi|150951300|ref|XP_001387603.2| predicted protein [Scheffersomyces stipitis CBS 6054]
    MSKTDEEWRAILSPAQFKVLRRSATEAPYTGEYTSTPASETGYYECAGCQQPLYKASTKFIAHCGWPAFYEAIPGSITVH
    RDTTAGMVREEMRCSNCDGHLGHIFRGEGYKTPTDERH
    CVNSISLKLNTGESK

    >gi|308198302|ref|XP_001387215.2| Glutathione reductase (GR) (GRase) [Scheffersomyces stipitis CBS 6054]
    MSLNYDLIVLGSGPAGAIAALAAAKFGKRVAIVCPRIGGTCINVGCIPKKIMWEAASLSKAMPYAPYFGIRKPVSTVEYG
    DINWDVLASKRDEVTGRINTHYEQEYADQGVDVIYGYGKFINEEADIQVSLSGQTIRGKTYKKDDKLDLSASYVIIAVGN
    QAVIPQNVLGAELGGISDTFFSWHEQPRTVAIVGGGYIGTELAQMLSIFGTKVTVITKGNSLLTRFDDSIQERLTAALKE
    DGVEIVTNATVSAIKQLDNLKEVKISNGTSLQVESVIWAIGRKPQINLGYSSANIKLGDSGEVIIDDFHQTTNLKVYASG
    DIINKINLTPVGLQTGARISRHLFGKKKIAKYDYDQPYPSAIPAVIFSHPEVATLGLSSKEAEDKFGKDNVKVYEQAFPS
    SFYIVAPQDKQKKNYYKYITAGKDEKIVGLHLIGDNVTEEIQGYVLALKLGATRRDLLDTIFVHPTVAEWKHHDF

    >gi|126276235|ref|XP_001387216.1| thioredoxin [Scheffersomyces stipitis CBS 6054]
    MVATVASKQEFTEALTHDGLVVVDFFATWCGPCKMIAPLLEKFSKEYTTAKFIKVDVDELGEIAQEYEVSSMPTIIFFKG
    GKIVTKVIGANPAALKQAIAANA