Penicillium chrysogenum Wisconsin 54 1255 uid39879

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|255930355|ref|XP_002556737.1| Pc06g01300 [Penicillium chrysogenum Wisconsin 54-1255]
    MPVIELTSKADFLEKILSPEDPVLLNCYADWCSHCKAIAPKIEELSNVYTQVKFYKVDVDKVEDVGQELGVQAKPTFMLF
    KGGDKITEVVGAHLPAIEEGIKSHLI

    >gi|255930541|ref|XP_002556830.1| Pc06g02280 [Penicillium chrysogenum Wisconsin 54-1255]
    MTSTMGGDCYGPPAPAPEPDVTPLTAPSEKTSSCQDSCCDSDDAEPLDAPAPGQKMPTPEKAYDCCSPDKCADNKTENHD
    DAPDCCRGKASPCCDTSCLDRLAMQECEMSATAAPGPVSQPDTCGGATDHKACSQHSLSALDRYGATLQALGCICRALIA
    LGQETCCELRERQSPDGKQCSKKSSARSLRTSLDPCSNGAVTKNQAVQNRPRLRRGSRESTRSVEKASADACVVSFFSCT
    DACCSSAVPDPGLEIGKASIQAITDIENHGTGKEHVVLSISGMT
    CTGCETKLSRTLVTIPAVKDLKTSLVLSRAEFDLDL
    RLGSVEEVMKHLERTTEFKCERVQNQGSSLDLIIPDEPSNFISQTWPDGVLDMVPVDKQTVRVAFDPNIVGARDLTEKIW
    GPPIELASPRGDPSLEAGSKHVRHVGYMTLLSAVLTIPVLVMAWASLPDREVAYSSASLALATIVQVVIAGPFYPKALKA
    LIFSRVIEMDLLIVLSTSAAYIFSVVSFAYLIAEQPLPTGQFFETSTLLVTLIMVGRWVAALARQRAVESISIRSLQTST
    AILVDQKSGTEREIDARLLQYGDTFKVLPDTRIPTDGTVINGSSEVDESMLTGESRPVEKYPKSVVVAGSINGSGVMTVR
    LNRLPSDNTINAIAAMVDEAKLSKPKLQDLADRVASYFVPVVLALTIITFVIWVAVGMTIRGYDGSEATIQAVTYAITVL
    IVSCPCAIGLAVPMVIVIASGVAAERGIIFKSADAIEVAHKTSHVVFDKTGTLTRGKLSVVATDCDNVDKLPLLLGLVEN
    SRHPVSVSVAAHLKGAGVMASTVPEPKSLTGKGVETTFNGRKLRAGNSRWLNLSENGVVQPMLAQGYTVFCFTIDNALQA
    VYGLEDELRPDAAETIETLQRRGVSVHVVSGDDDGAVQSLASKLSIPGGNVRSRSSPADKKDYIQTLLSTGIDRKKPVVV
    FCGDGTNDAVALAQATIGVHMNEGTDVAQSAADVVLMRPSLAGIPTMMDASRKSVNRIKFNFIWSFVYNIFAVLLAAGAF
    VNARIPPEFAGLGELVSVLPVIAAALLLRWSKI

    >gi|255930707|ref|XP_002556910.1| Pc12g00040 [Penicillium chrysogenum Wisconsin 54-1255]
    MSTLTEITSEADFSSHLSSLSPSALVVLYFHTPWAAPCAQMGAVLSALASQYPATAPPTISFVSINAEELPDISEEYDVS
    AVPFVVCLRSGQILESISGSDAVKVRDAVERHAGRGNVAGAVGPMDSAKANIPPPLSAVPREDGPLTATQAPVTASEPPA
    ADAANATPVASAPALTPEQSREALFARLEQLVKAASVMLFMKGTPSSPQ
    CGFSRQLVGILRERSVKYGFFNILADEDVRQ
    GLKEYAEWPTFPQLWVNGELVGGLDIVREEINSDPDFLKDHSVSKPTAAA

    >gi|255931385|ref|XP_002557249.1| Pc12g03690 [Penicillium chrysogenum Wisconsin 54-1255]
    MLLTWHWKKLFAVQALFALVWAQAPQENYDVIVIGGGPSGLSAASALSRVLRKVALFDSGEYRNNPTRHMHDVIGSDHVV
    PAEFREAARKQISFYNMTTFFDQKVITMQKTDNSFHATTANGTYTARKVILASGLKDDLPNVPGLRDAFGKGVFW
    CPWCD
    GFEHRDQPMGVLGDLSDAYDSVKELHPTLNKDIRIYANGTNNAAQLNRLNGKNRDWQKVFDAYNVTVNPKPILNITRTQS
    GSDFHDSAIRKEFDKFRVYFTDGTYEERGAFITNYGTSQASNLPEQLKVGLLGKKMDTTARGLRTTIPGVWGVGDANSDN
    STNVPHAMSSGKKAAVFCHVEMATEELAQVGGSPAKRAAMLDDRSIHERTARQMGDEVGDVYKRLAHF

    >gi|255931617|ref|XP_002557365.1| Pc12g05180 [Penicillium chrysogenum Wisconsin 54-1255]
    MAHLSTAGTSLAELPKSNVFTSKLPPDPAFDTPESSHKAPRETLGPRMVKGALFTYVRPEQTDEPELLGVSSKAMKDLGL
    KPGEEQTSRFKALVAGNEIWWNEEQGGVYPWAQCYGGWQFGSWAGQLGDGRAISLFECTNPQTDTRYELQLKGAGRTPYS
    RFADGKAVLRSSIREYVVSEALSALGIPTTRALSLTLIPNAKVLRERLEPGAIVARFAESWLRIGTFDLLRVRGDRELIR
    KLATYVAEDVFNGWESLPAVVSLRDQQSSTQIDNPQRGIPGDQVQEHEDVQENRFARLYREIARRNAKTVAAWQAYGFMN
    GVLNTDNTSIYGLSLDYGPFAFMDNFDPQYTPNHDDHMLRYAYRNQPSIIWWNLVRLGESLGELIGAGNRVDDESFVNDG
    VTEEFEPELIKRAEKIIERVGEEFKAVFLNEYKRLMGQRLGLKTQAESDFQNLFSEMLDTLETLELDFNHFFRRLSGLTL
    SNLESEEGRREAASVFFHAEGFGGIGYTEATARDRIAKWLDSWRLRVLEDWGPANDEERQKAMKSVNPNFVPRGWILDEV
    IERVERKGDRDILDRIMQMSLNPFNDEWGLHRQEEERFCGDVPKYKRAMMCS
    CSS

    >gi|255932459|ref|XP_002557786.1| Pc12g09590 [Penicillium chrysogenum Wisconsin 54-1255]
    MRSQLSRNLLSPLKHQTIPLRPAPTFGFSRFLSSTRKPPHSKTSTKALLAAPTIPFFGAFFSSNHSPVKPADAMSPPDKR
    SEDEWRAVLNPEQFRILREKGTERAGTGEYDSHYPSKGVYNCAGCDAPLYTADHKFKSGCGWPAYFDSIPGAVTRHVDNT
    FGMKRTEIVCSNCGGHLGHVFEGEGYPTPTDERH
    CVNSVSLRFTEDASAAKNPQAKA

    >gi|255932919|ref|XP_002557930.1| Pc12g11100 [Penicillium chrysogenum Wisconsin 54-1255]
    MASRIGPQMFRAFRAAPRAPWSAQVPRAPAFRRFFSDKVEQPHLRLGSIAPNFKALTTQGEIDFHEFIGDKWTILFSHPA
    DFTPYQV
    CTTELGAFARLKNEFDKRGVKMIGLSANELGSHDQWVKDINEVGSTEVQFPIIADADRKVAFLYDMIDQDSIG
    QKEIAFTIRSVFIIDPSKKIRLTMMYPASTGRNSAEVLRVIDSLQTGDKKGVATPIDWTVGDDVIVPPSVSTPDAQKKFG
    EVREVKPYLRYTKV

    >gi|255933137|ref|XP_002558039.1| Pc12g12240 [Penicillium chrysogenum Wisconsin 54-1255]
    MDVDSETPGAPESRIYVDQQGRWKHLYNVLSKRGPFTDDDWNPGPEPINALEHSKILGAGGLGCEILKNLALSGFKDIHV
    IDMDTIDISNLNRQFLFRQADIGKPKAEVAAAFVQKRVKGVNITPYVGKIQDKDEDYYMQFNIVVCGLDSIEARRWINST
    LISMVDEDDPLSLKPLVDGGTEGFKGQARVILPSISSCIECQLDMHAPRPAVPL
    CTIATIPRQPQHCIEWAHQIAWQEKR
    KDDTFDNDNMEHISWIYNAAYERAQQFHIHGVTFQMTQGVVKNIIPAIASTNAVIAASTTSEVLKIATSCNPFLANYMMY
    AGEEGVYTYTFEAEKKPDCPVCGELARKMNVDPNMTLGEFIDSLGERAEAQLKKPSMRTEEKTLYQRFPPQLEEMSRPHL
    GKKLADLIEDGEEVAVSDPAYTTTFRFRLHFK

    >gi|255935011|ref|XP_002558532.1| Pc13g00850 [Penicillium chrysogenum Wisconsin 54-1255]
    MASTEQRLLSESRFSTILVNNLHCPSCVSTVNDTLFSLNPPPFSVSVSIVLHEIKVAHPIDLSTSQIVHALEDAAFDIDS
    VVESGDSTNGGPESESLRTWRSTRPSVVWRASDPDPHHESEQHIRQCDACSAQLATQSSRTGDDPPVIQKNLSPLVVESD
    SPRDNDLVSVVDDHLTGTRTRITLSISGMS
    CSSCVGKITNALNDQPWVQSADVNLLTSSAVIVLLDRSRVNEVLETITGS
    GYSAQLIDCEDLLPERQSKPSASTDIWRASYVIGGMTCSSCVGTVTDTLNRYEWVTKVDVNLVSGSATVELQGKEHLEEV
    IAIISELGYAAALGEAERSAPSEQRALNRSVTIQVEGMHCPNCPQRILDALSVFSNCLQVTDPLRKGRPRLTIAYTPDSP
    NFTIRHILHAIAQADKAFTVSIYHPPSLEERSQMMQRRHMWRIARRLLLAVLTAIPAFIIGIVYMSLVPGDNSGVMYLEQ
    PIWAGRVSRMEWALFIMATPVYFFAADLFHRRMLSELVVLWWPGSKTPILRRFYRFGSMDMLMSLGTTVAYFSSIAILGI
    NATQPADGLRVTHVESFFDSVVFLTMFLMIGRLLEAYSKAKAGDAVSLLGKLRPTTAVLVASKEAEPSSPSVTPHTVPID
    QLELNDVVSVANGASPPYDGIVVEGTSRFDESSLTGESKPVPKSIGDEVFSGTTNRANPVLVRITHLSGDSMLDQIISAV
    REGQVRRAPIERTADLITGYFVPLITLIAVLDWIIWLSLGVSGRLPLSWLEGGAGGWEFWSLQFAISVFVVACPCGIGLA
    GPTALFVGGGLAAQYGILVKGGGEAFQEASQLDCIVFDKTGTITEGVQPSVTDHKTTHEENIDEVWGAVLTLEQKSSHPI
    AQAMVSFAGSRRPPALTASAVDEIPGKGMKGSFPLGHRPSSILDVIVGNEALMLDHGITILSANAAILTAWKREAKSVVL
    VGTRVREGAGDIEKVHWVLSMMLAVADPVRPEAKEVLHALRNRGISVWMISGDNPTTAHAVGKIVGISPENIIAGILPEQ
    KAEKIRYLQKTVPRPSKRRWFNWGKGSRRTRPLVAMVGDGINDSPALTVADVGIAIGSGSEIAISSAEFVLISSGLTSLL
    TLIDLSRIVFNRVKYNFGWALVYNCIAIPVAAGVFYPIVSNGNHIRLDPVWASLAMALSSVSVVCSSLLMRTRLPLVGFR
    SAK

    >gi|255935177|ref|XP_002558615.1| Pc13g01700 [Penicillium chrysogenum Wisconsin 54-1255]
    MSAAKTRAQSLINDNAVVVFSKSYCPYCDSSKKLLDSLNAKYTTLELDLEEEGAAIQSALAEISSQRTVPNIFINKKHIG
    GNSDLQGKKDLKDLLKEAGAI

    >gi|255935505|ref|XP_002558779.1| Pc13g03420 [Penicillium chrysogenum Wisconsin 54-1255]
    MLHSASLLLVSLLAALPVNADGLYTKNSPVIQLNPKTYNSLIANSNYTSIVDSLPPQPSLTHPLRFYAPWCGHCKNLKPA
    YEKAAKNLDGLAKVAAINCDDDENKPFCGQMGVQGFPTLKIVTPSKKPGKPRVEDYQGARSAKGIVDAVVDRIPNHVKRA
    TDKDLDKWLGQNEDRPKAILFTEKGTTGALIRALAVDFLGAIDIAQVRNKESASVKKFDVTEFPTLVLIPSADAEPKIYA
    GDLKKKPITEFLSQAAAPNPDASPRSASNSKPKQKSKPASKPTSVVDDAEDLKPTASQDQDETDPSEKPVQVPIPAPPIP
    TLATPESVESACLTPKSGTCVLVILPETSEPDAALPAHATEALASVAEIGHKHALRGTHLFPLYAVPAINTASKTLREAL
    ELADGQTVEIIALNARRGWWRRFSGADADFGAVAVESWVDAIRLGDGTKEKLPEGIVVSVEAETESEAEVKPEAEAEVEP
    EAETVEAEAETKAETEEQAAEHDEL

    >gi|255936501|ref|XP_002559277.1| Pc13g08520 [Penicillium chrysogenum Wisconsin 54-1255]
    MHSNAIYTHVQDRYGDLADRSSTSEQERTEQKIAQAFGYEAADLSSIPQAANLGVSCGNPLALANLREGETVIDLGSGGG
    IDVLLAAKKVGPRGKAIGVDMTKSMLELARKNAEKAGASNVSFVEASITSIPLPDATASCIISNCVVNLVPTVDKHLAFK
    EMFRLLQPGGRLAISDILTRKELPQEVTNSLSFYVG
    CIAGASQVHEYEKYLSEAGFKDITIVDTRSDLNIYKDLVQEQMG
    LEKMSDKSERPGCCGVAQVNNAIEGDLLEHDFNEWAGESSRLFDCWTDTD

    >gi|255937427|ref|XP_002559740.1| Pc13g13260 [Penicillium chrysogenum Wisconsin 54-1255]
    MAASINHSHPRHDVPDTGPKMVNRLHQSKSPYVRGHMNNPVAWQVWDAEAMELAKKHNRLIFLSIGYSACHWCHVMEKES
    FMSSEVASILNESFVPIKVDREERPDIDDVYMNYVQATTGSGGWPLNVFLTPSLEPVFGGTYWQGPNSTTFRGPEAIGFV
    EILEKLRDVWQTQQQRCLDSAKEITKQLREFAEEGTHTQQGDRDNDKDEEMDIELLEEAYQHFASRYDSVNGGFGRAPKF
    PTPSNLSFLLRLGAYPTQVMDVVGHDECEQATAMAVTTLVNMARGGIRDHIGHGFARYSVTADWGLPHFEKMLYDQAQLL
    DVYVDAFRLTHDPELLGAVYDLSAYLTSAPIQSPTGGFFSSEDADSYPHPNDTEKREGAFYVWSLKELTSVLGPRDAPVC
    AKHWGVLPDGNVPPEYDPHDEFMNQNVLSIRATPSKLAKDFGLSEEEVVKIIKSSKQKLHDHREQTRGRPDLDDKIIVAW
    NGLAIGALAKCSVLFEEIESSKAVHCREAAARAIGFIKDKLFDKATGQLWRIYRDGNRGDTPGFADDYAYLASGLLDMYD
    ATYDDSYLQFAERLQKYLNEYFLAQSGSTAAGYYSTPSVTTPGMPGPLLRLKTGTESATPSVNGVIARNLLRLSALLGDE
    SYRTLARQTCNTFAVEIIQHPFLFVGMLDVIVGLQIGTRTVTGVFSTADISSIPDPRGDSLLSRNDEPVSALDLIRRRLR
    AEAGVAVSSSIVVTSIVDIRPSHLKDFVGNQSFWLKSRNVLFQDLKAAEPAKNYLMVCETGRCQIIDL

    >gi|255939636|ref|XP_002560587.1| Pc16g02150 [Penicillium chrysogenum Wisconsin 54-1255]
    MPSSQRRLRLVVIAVIALLFMVFYYTGDATKIQNQKFYRSTIDAMKAKEQAKQAKAQEKIQHPVHAPGQNVAAGAGAGEK
    VPVAEVEKAAVPPATDNEDTEEVSIAGRTKMTVPKKANQDTPSEVQSELKSEEEKEREEKAKREREEKERKEAEATTELN
    AILKRAPVIVFSKSY
    CPYSKKAKLILLEHYSIEPKPLVVELDQHPLGPYLQALLAQSTGRRTVPNVLVSGKSIGGGDDIA
    ALDQRDELASTLRQMGGKWIVDVSHHEVEKSL

    >gi|255941716|ref|XP_002561627.1| Pc16g13280 [Penicillium chrysogenum Wisconsin 54-1255]
    MAPVETQQYDYIVLGGGSGGSGSARRAAGWYGKKTLIVESGRSGGTCVNVGCVPKKMTWNFATINEMLHIGKSYGYDIPD
    NVAMNYTHFKNTRDAVIKRLNGAYERNWGREGIDLVHGRAGFVEPHTIEVQLADGSGTARYTAPHILLATGGRPNIPSVP
    GAEHGITSDGFFELEELPPKIAVVGAGYIAVELAGVMNAVDVETHMFIRGENFLRKFDPMIQKTMTDRYAAAGVKLHRGH
    GGFKEVQLIRDGKGKDRLLKLIGHDGTELEVNELLWAVGRAPEVEDLHLDIPGVKLNAGGHVVVDEYQNTSAAGVYALGD
    VTGQAELTPVAIAAGRQLGSRLFGPPELKHSKISYENIPTVVFSHPEVGCVGLTEPEARQRYGDDKIKVYHTKFTAMFYD
    VGLSPEEKAKNPTEMKIICAGPHEKVVGLHILGLGVGEMLQGFGVAIKMGATKQDFDSCIAIHPTSAEELVTMR

    >gi|255942363|ref|XP_002561950.1| Pc18g01040 [Penicillium chrysogenum Wisconsin 54-1255]
    MSSVPNKSSDSEAAHQDLDAQTSVFFVSNVHCASCVAYITEVLSETPTVNNIEVTILTHEVRASHSTAVRPADLINALIH
    AAFEVQYVTTFDQRGRLTAELDTSSWNHRGSTLFSSPRTSVSSISSNIKERIQTSRHKRHIANCDACRKEELETFPRPSS
    SRTELGYLNEKSSQSPFRPLSRHNEQDISAAKLESTPENAVQESLRSFATSETKVQLDVPAPRLPTDIAEIPSPSAESAD
    EFTAQISIEGMS
    CASCANSITAQVQQLEFVKETIVNLLTNSATVIYVGPRGNVDEIVEQINDAGFNASLEEVNQAPKLPA
    SAELVANYVSEIAITGMTCGSCVGGVTRGLEELPFIRDVSVNLLSHSGRVEFEGRDNLDKIIEKIEDLGYDATVTSVSPL
    KVGTEKFSTAQIRTISIQVDGMFCHHCPQTILGAVKSVPDVTIEEALSEKSPILKVTYTPQPPLVTVRTIISAINSANDN
    FRAIVYHPPSIEDRSRAIQHHERSRLLARFLFVFITAIPTFLIGIVFMSLVSSENSVRMYLEQTMWSGSVSRIEWALFIM
    TTPVMFYGTDVFHARAVKEIYALWRPGSRVPILRRFYRFGSMNLLISAGTSVAYVSSLAVLIVDAVVGTKSSPHSTTYFD
    SVVFLTLFILAGRFLEAYSKAKTGDAVTSLGKLRPSEALLSDDTSEDGVKRTIVDLLEVGDVVSIPHGASPPADGVIVDR
    ASYQFDESSLTGESRPVKKTADDMVYTGSVNVGQPVRICITELGGSSMLDQIIAVVREGQSKRAPVERVADLLTSHFVPL
    ITLIAISTFIIWLALGHSGVLPADYLDVAHGGWTFWALEFAVAVFVVACPCGLALAAPTALFVGGGLAAKHGILVKGGGE
    AFQEASRLNAIVFDKTGTLTEGGSLKVSDHEILTSDPEVAKIAWALARKMEETSNHPIAQAITEFCKTQQSSSVKSSDVL
    EISGQGMKGNFTVSGSEDEEQYEAAIGNERLLKSLVSPETDTYFVSNLLAKYQSAGKSTAVLSLRQVHRSSTESSKFIPA
    IIFATSDTIRPEAVDVISQLQKRHVDVFMCTGDNQTTAHAVADMLGIPRSKVMANVLPAEKASFVRQIQERSPNATPADG
    ETSPTSSTPRPIVAFVGDGVNDSPALAAADVSIAMASGSDVAINSASFILLNSDLSTILQLVLLSRRVFNRVRMNFGWAV
    IYNLCLVPVAAGVLYPIVSGHHKKTIDGEMIMVNEHWRLSPVWAALAMALSSISVVLSSLALRIDKESIMKIVRRKK

    >gi|255942507|ref|XP_002562022.1| Pc18g01780 [Penicillium chrysogenum Wisconsin 54-1255]
    MSSATSFFDFEPVDKKGAPFPLSSLNGKVVLVVNTASKCGFTPQFEGLEKLYQELKAQYPEDFTIVGFPCNQFGSQDPGS
    DDEIQSFCQLNYGVTFPVLGKLDVNGDNAAPVWTFLKEQQPGIMGMKRVKWNFEKFLVSADGKAVNRWASLTKPEGLKDT
    IVKEIEKAKKEGTLASLKSEAGAEQAKLS

    >gi|255942701|ref|XP_002562119.1| Pc18g02780 [Penicillium chrysogenum Wisconsin 54-1255]
    MADRAAPLRLGSTAPNFKALTTQGEIDFHEWIGDKWAILFSHPADFTPVCTTELGAFSKLEPEFTKRGVQLIGLSANALD
    SHEEWIKDINEVNSTQLKFPIIADAERKIAFLYDMIDEQDLTNVDSKGIAFTIRSVFIIDPAKKIRLIMSYPASTGRNTA
    EVLRVVDSLQTGDKRGVTTPINWLPGDDVIVPPTVNNEAAKEKFGEFREVKPYLRFTTLKE

    >gi|255942847|ref|XP_002562192.1| Pc18g03540 [Penicillium chrysogenum Wisconsin 54-1255]
    MSVIEISSKEQFTSLLSSSRLVVADFHADWCGPCKAIAPAYNSLATQLSRPNLITFTKINVDHQQELAQAYGVTAMPTFI
    VFKNGRVNQTVKGANPAQLNQIVQKLASEASQSDEAATGEGSSSGEPWIGGAVPKGYSDITDQVDVKGLELLNRDTDTAE
    PRALFNISKPSGLAAKGKAKAAGQPDWTESDTDEQLMLYVPFNAMLKVHSIQITSFPPAEADGDDDETPMRPRNLHIYKN
    TSHVLGFDEADGIPPVQKVEIKPGDWDVKTGTATVPLRFVNFQNVTSLVMFFVDGDGDSEKLRVDRIRVIGEAGANRSMG
    KLEKIGDEPGE

    >gi|255942999|ref|XP_002562268.1| Pc18g04330 [Penicillium chrysogenum Wisconsin 54-1255]
    MSGTETATVAAGCFWGVEHLYRKNFGNGKGLLDAKVGYCGGAVSSPSYQAVCSGTTGHAEALRIVFDPSIVTYRQLLEFF
    YRMHDPTTENRQGPDVGTQYRSAVFTHGDEQQKIAEEITDKVSKQWYKTPLSTKVLPAGQWWDAEEYHQLYLQNNPAGYE
    CPAQYVSLSSEFYLIRLLTSCLLASSDLSLLWRID

    >gi|255943645|ref|XP_002562590.1| Pc20g00260 [Penicillium chrysogenum Wisconsin 54-1255]
    MFSRAVASAFRPVSRPTFLRPVRSAIQFPSGPSIPSVLHARLLSNETRTAIDKAVSSAPVVLFMKGTPETPQCGFSRATI
    QILGLQGVDPKKFVAFNVLEDAELRSGVKEYSEWPTIPQLYLEKEFIGGCDILMSMHQNGELAKLLETKGVLVAADE

    >gi|255943653|ref|XP_002562594.1| Pc20g00300 [Penicillium chrysogenum Wisconsin 54-1255]
    MVELRKRKAPAPLLVAEKKTKQAPKPKQDADATDNDTEKRPAQKVPEVDDIIDIETFSGEFETNEGEKTTLKKLLEESKS
    GVVFFTYPKASTPG
    CTKQACLFRDNYTHLTSTGLSIYGLSGDSPKANTTFKTRQNLPYPLMCDPKATLIAAIGFKKSPKG
    TTRGIFAVDKKGKVLLRAAGGPDATVDAVQKIVANAPSVEDSKEEGDETA

    >gi|255943749|ref|XP_002562642.1| Pc20g00800 [Penicillium chrysogenum Wisconsin 54-1255]
    MPDSDDDALFAALENEDDTHYRDQRIHQLNAELAATKNNHSARATSGNTGLIQNEVYPTLSTDQSVLDFTTRTSRCLVHF
    AHPDFLR
    CAVMDMKLGELANAHYEVSFARVDVRNTPFIAQKLGIKVLPCVIGFKDGVGVDRVVGFEGLEARGFDGVEGFD
    VKVLEKRLVFKGILLAVKIGAGDDDDVREEEESDDGAGGRGFGRKKGRRGIRGSNPNVRNRGDDDDDDWD

    >gi|255944361|ref|XP_002562948.1| Pc20g03980 [Penicillium chrysogenum Wisconsin 54-1255]
    MSSVPPEQVNSQYKDMSSMFNQQNPAASASSSKPAGDDSKPPLPKGVVLDKDGKPCRTCTSVASWRALTKQADLKSANSN
    STSTPTSSTSKMTTPTAGLAAAATPSPSETPSDCPPDVEELGRSTWTLLHSMAATYPEKADAEHQANMSGFLKFFSKLYP
    CWVCADDFRAWMAHPSGRNQPKLGSRKEFGWWMCEAHNEVNRKLGKKEFDCRLWEERWRTGWKDGRCD

    >gi|255944493|ref|XP_002563014.1| Pc20g04720 [Penicillium chrysogenum Wisconsin 54-1255]
    MFRAVLPRATPRSALRHAGPRAIPNNFATSMIFIGQSKRGFASEAGDHDLVIIGGGVAGYVAAIKAGQEGLKTACIEKRG
    KLGGT
    CLNVGCIPSKSLLNNSHLYHQVLHDTKKRGIEVGDVKLNLTQMMKAKDTSVDGLTKGIEFLLKKNGVDYVKGAGS
    FVDANTIKVALNEGGEQTLRAKNIIIATGSEATGFPGLNIDEKRIITSTGALALTEVPKKMTVIGGGIIGLEMASVWSRL
    GAEVTVVEFLGQIGGPGMDAEIAKQAQKILGKQGIKFKTGTKVVSGDDSGSTISLNIEAAKGGKEEVLDADVVLVAIGRR
    PYTEGLNLEQVGIEKDDRGRLVIDQEYRTKLPHIRVVGDCTFGPMLAHKAEEEAVAAIEYIKTGYGHVNYAAIPSVMYTH
    PEVAWVGQNEAEIKASGVKYRVGSFPFSANSRAKTNLDTEGVVKFIADAETDRVLGVHIIGPGAGEMIAEATLAIEYGAS
    SEDIARTCHAHPTLSEAFKEAAMATYSKPIHF

    >gi|255945621|ref|XP_002563578.1| Pc20g10890 [Penicillium chrysogenum Wisconsin 54-1255]
    MRSAARLLYAAAFAFAGLSHASVHNPSLDPTKCALEPSAMVSDACVSYGEINGMNDLVFTTINSLTQETDFFSYYRLNLF
    NKECPFWNDANSM
    CGNIACAVNTIDSEEDIPLTWRAEELSKLEGPKANHPSRNIQAERPKERPLQGELGEDVGESCVVEY
    DDECDERDYCIPEDEGSAGKGDYVSLVDNPERFTGYSGAGAHQVWNAIYSENCFLKPVADELDEQSLNVPMGGLQAASDF
    RNVLHKESQRVEGLPLDNECLEKRVFHRLLSGMHASISTHLCWDYLNQTTGQWHPNVQCFKERLLDHPERISNMYFNYAL
    VSRAVAKLRKHLDGYTYCASDPGQDRETKKRVNKLTATLTELPQIFDEKIMFQDPNALGLKEDFRNRFRNVSRLMDCVGC
    DKCRLWGKLQVNGYGTALKVLFDYDETKNGENPPLRRTELVALINTLGRISHSLAASRSMQRALLTGTTHMFPVHGAVPS
    SHHANALGNNRRVFRDGNNNFYLEGEGVEDEYVYGRGEAPERYPWERKPPNPDDGFLEDFMTEWNMIWGTVGYIWQSWMD
    IPYTLFQIGASEFIRLYNYWLGLPVPPRMWKMKTPRPRPHTQRAAYANRDEL

    >gi|255945857|ref|XP_002563696.1| Pc20g12110 [Penicillium chrysogenum Wisconsin 54-1255]
    MVYLKSSFWRFCLLCLPLSSALIIPQSVLAEDAEDTVSDVTRQLETNEVEFNITDYTSPGEWEPTAWDYDVAIVGGGPAG
    LAASMSLARVARTSILYDSQEYRNGQTRYMHDVLGQDGEVPLKFRAAVRKQIDELYPDYSFWATRKTKVIGIIPLEKGFR
    VYDDKGGTVTAKRVIMATGIKDVLPNKPGFAEAFGRGVFW
    CPWCDGHDYKDRKMVVYGKLASAIGSALNVRKLTTDITIV
    TGGPLTKEDKDAAEARWPGWETVIKNTYKIPIRENEITKIERTTTKMEPKDDEYRVHLNGGSPNPIVTNGMLISVPTTQT
    SSLHKQLRLEMDGSSVKVKKNMESSTSGLYVVGDANNDGSTNAYHAMWSAKRAAVSAHVSMSKQEYLDAVPTAMVAAAGG
    DEDFYRLQIQDLEFQVGDDVEQMFKALGG

    >gi|255953111|ref|XP_002567308.1| Pc21g02440 [Penicillium chrysogenum Wisconsin 54-1255]
    MTDVKMQVENPQETIEAIKHGDIDESLYSRQLYVLGHEAMKRMGSSNVLIVGLKGLGVEIAKNIALAGVKSLTLYDPAPV
    AISDLSSQFFLQPEDVGKPRAEVTAPRVAELNSYVPVTVHEGESLVGDLEQLKRYQAVVLTQTPLKEQLAIADFCHKNKI
    YLTITDTFGLFGYIFNDFGKNFTVGDPNGEEPASGIVADIDEEGLVSALDETRHGLEDGDFVTFTEVKGMEGLNNSDPRK
    VTVKGPYTFTIGDVSGLGSYQGGGLFTQVKMPKFIDFQPLEDQLKNPEIVMSDPAKFDRPQQLHIGIQALHKFAETRDGQ
    LPRPHNDSDAQEVLKIANNLAAAGEEKVELDEKIIKELSYQARGDLNPLAAFFGGIAAQEVLKAVSGKFGPVHQWLYFDS
    LESLPSSVTRSEESCKPLGTRYDGQIAVFGKEYQDKLANVTQFLVGSGAIGCETLKNWAMMGLGTGPKGKIYVTDMDQIE
    KSNLNRQFLFRSKDVGRLKSECASAAAQAMNPDLTNKIVTLRDRVGPDTEHIFNEDFWNGLDGVTNALDNVDARTYVDRR
    CVFFRKPLLESGTLGTKCNTQVVLPFVTESYSSSQDPPEKSFPM
    CTLKSFPNRIEHTIAWARDVFQTYFVGPPESVNMYL
    SQSDYIQQTLKQGGNEKQTLEHLRDFLVTEKPLTFDDCVVWARQQFEAQYNNAIQQLLYNFPRDSKTSSGQLFWSGPKRA
    PTPLKFDSTNPTHLGFVVAGANLHAFNYGIKNPGADKDYYRRVVDDMIVPEFTPSSNVKIQANENDPDPNAQPAGSSTDD
    QEIQKLVASLPSPKSLAGFRLQPVEFEKDDDTNHHIDFITAASNLRADNYEIPQADRHKTKFIAGKIIPAIATTTALATG
    LVALELYKVVDGKDDIEQYKNGFVNLALPLFSFSEPIGSEKGTYQGKQGEVTIDRLWDRFEVEDIPLQEFIDFFAEKGLD
    ITMVSSGVSLLYASFYPPSKVKDRLPLPMSKLVEHVSKKPVPEHQKNIIFEVTAEDQTEEDVEVPYVMVKLTK

    >gi|255953259|ref|XP_002567382.1| Pc21g03180 [Penicillium chrysogenum Wisconsin 54-1255]
    MDVSLYVYDLSKGLARMYSLALTGTQMDAIYHTSIVLNGIEYYFGQGIQTAAPGSTHHGQPMEIVKLGSTELPSEVIEEY
    LGSLATIYTPESYDLFLHNCNNFTQDLAMFLVGKSIPQHIINLPRTFLETPFGQMMKPQIEMALKGVTQGTGTGPAPGPS
    VQPTTARAVPPAPQPVAPSGAGTVRMVSNLSQLQTELSSASHSCAVIFFTSST
    CPPCKAVYPTYDELAAEAGERGTLIKV
    DIGVARDVGMKYSVRSTPTFMTFLKGQKLDEWSGATPAKLVGNVRMLLEMAHPAHPHRQLRLPSLQREITTFVMYKKVPP
    LEKLLQKLPVAFKEGPGVAQVIEFVKLRHSATEPVADIRVPDLHIFATTLTSIYSTLPNDTHFAVVDLVRLLLLDPRASG
    YFAEEAQHATLLTLLAPLSQDDLSSCPYNLRIVALQLVCNLFSTPLYPEQLTSSSSPLRETCLRLATNALLDSQTSLRVV
    AASFAYNLAAFNHNARLDGKPDPLSEEDQVELTASLLEAVSRENESLEALHGLLSALGLLVYEAPMDGSLIDLCRAMGVT
    DTISGKMKVEAVQKEPLLKVIGELFSKGL

    >gi|255953807|ref|XP_002567656.1| Pc21g06110 [Penicillium chrysogenum Wisconsin 54-1255]
    MPYTLVIISQDIVLYNITDNPANTPHSVAEYKEKVTDATGPVVVDFHATWCGPCKAIAPALEKLSETHTGIQFYKVDVDE
    LSEVAASNGVSAMPTFHFYKGGERKQEVKGANPAAIQAGVKAILE

    >gi|255954061|ref|XP_002567783.1| Pc21g07430 [Penicillium chrysogenum Wisconsin 54-1255]
    MARLSFLLLGALSALSGVATASNSAVKDLLPSNFDDVVLTGKPALVEFFAPWCGHCKTLAPIYEELGQTFAFAEDKVTIA
    KVDADENRSLGKRFGIQGFPTVKWFDGKSDKPEEYKGGRDLESLSAFITEKTGIKPRSAQKEASKVEMLNDASFKTVVGG
    DKDVLVAFTAPW
    CGHCKTLAPTWETLAKDFALEPNVVIAKVDAEAENSRALSKEQGITGFPTIKFFPKGSTEAEPYSGAR
    SEEAFVKFVNEKAGTHRAVGGGLDSLAGTIAVLDEIVTKNVAAQKFDILVAEVKKAAEGLQDKYAEYYVKAADKLSKNKG
    YAAKELTRLQKVLAKGNSAPEKLDDILSRSNILRRFVGEEKHDEL

    >gi|255954405|ref|XP_002567955.1| Pc21g09160 [Penicillium chrysogenum Wisconsin 54-1255]
    MANRQITRRIITSAAIALCLIFFLFIRPQGPPSPAVRAPGHIDHSAAASAPGITIEDSTLKGDVVMPKLGNETVKAELGR
    ATWKYFHTVMARFPEKPTEDQKEALRSYIYLFARLYP
    CGECAEHFMQHLSKYPPQVSSRNAASGWACFVHNEVNAMLGKP
    EFDCANLGESYDCGCGGDEEGSEGKEGLAASRSDAGKGSPEHHDGPAVEISKEELVTSPASILTA

    >gi|255954505|ref|XP_002568005.1| Pc21g09690 [Penicillium chrysogenum Wisconsin 54-1255]
    MGSLDETCASLRAQITATEAQLAGLKRDLANAEQAAQAETATTAEIQPEDRNGDGRRWPLLQEEYKRYGRQMIVSQVGLK
    GQLKLRSAKVLLVGAGGLGCPAAQYLAGAGVGTIGLIDGDTVEVSNLHRQVLHRTKNVGKYKVDSAIESLRELNPHPTYI
    AHRTHLTPEAAPAVFQDYDLILDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNNPPGAPGDKTGGPCYRCVF
    PKPPPADSVVS
    CADGGILGPVVGTMGVLQALEAIKVITAPEINAASDVTTARPRDPPSLHIFSAYSSPLVRTIRLRSRRA
    NCAVCSAEATVTLDTIKSGSTDYVFFCGSASLPSLLGPEERISAREYNERRLAVTSDSSRLHSIIDVRDEAQFGICSLEN
    SINIPISKILSSGHSAGSQGADNEQQAAQIPSWLPSEVASSESTNPIYVVCRLGNDSQIFVKKMKELGLDQHGKRFIGDI
    RGGLRSWKEQVDSSFPEY

    >gi|255954585|ref|XP_002568045.1| Pc21g10100 [Penicillium chrysogenum Wisconsin 54-1255]
    MSSPKIILYTNRLCPWAHRAHIALKEIGLDYEEVTIDLSTPREPWYLEINPRGLVPTISYNGNIITESGIVAQFLADAHQ
    SHLLPASSPTENALYRARLSFFVDAFFSKVLPSFFASIRAADDAERDAAAEQLVAAVVKEVEPLLADTEGKGPFFGGSEK
    LTLAEVQAGSFLLRILSFAKPEHGLVSAKLPTLLEQVPRFKRWAEATAAHESVNFIYDEKLVADKMRAKFAPAPKV

    >gi|255954687|ref|XP_002568096.1| Pc21g10640 [Penicillium chrysogenum Wisconsin 54-1255]
    MGRSCCGSTPPQADAIDKAEVKKPDTCSVDCNGGTSSEISGQENSRENSAVQNNDNSNTTSSAKIADPWCEEPTETSKGK
    APPGACEGGCCGDQSAEAVGIKNVPSLGSSASKEACCAENPNTKAGILNCSVSSSYTPTHASSGTPRPSETATSAKPTVA
    ECCEGKSSPCCNETCLDRLALRECDTGSNIPCMEAAGHFFPSTSRQEAATLKRRACDGHHRSVREQYSAKLTALGCICRA
    LVALGKDSCCEPRKASPLEKGRCSQGVLKQTSSLGSIGSRCTSGTSTSQSPLRRTNQGRKNRNARGVQKCASQGCCKPNL
    TTPSDNFNDLCVSETDEGKIKSTDDSCADICCTSKVPSLPKDNNSGLVSISRDLEGQAIGVEHVVLSISGMT
    CTGCETKL
    NRTLATVTGVKNLKTSLVLSRAEFDLDLNLSTVDFVIKHLERTTEFKCETITSNGSTMDIIVSGDPSSIVNQAWPEGVTD
    ISLVENCTLRVSFDPEVVGARDLIEKHWSEIANLAPICGDPALAAGSKHVRHSGLMTLLSAVLTIPVLVMAWAPIPEREI
    AYSSASLALATVIQVVIAGPFYPKALKALVFSRVIEMDLLIVLSTSAAYVFSVVSFGFLVAGNPLSTGQFFETSTLLVTL
    IMFGRYIATLARQKAVESISIRSLQAQTALLVGESNSSGAREIDVRLLQYGDTFKVLPDMRIPTDGTVSSGSSEVNESML
    TGESRPVEKNPKSRVIAGTINGSGSLFVRLTRLPGDNAINTIAAMVDEAKLSKPKIQELADNVASYFVPVIVGLTIITFV
    IWVAVGIAMQGKTGSEATVQAVTYAITVLIVSCPCAIGLAVPMVVVICSGIAAERGVIFKSAHSIEVAHKASHVVLDKTG
    TLTQGKLSVAVEHYFGNGESCLSILSGLVGDSKHPVSVAVGNHLKQKGIVATAVPDVKSLTSRGVEANLAGQRLQAGNSR
    WLGVSTHPLVQPVLTQGYTAFCFTIDGVLLAVFGLEDSLRSDATHVVESLQRRGVSVHVVSGDDEGAVQNVATKLGIPEG
    NVHARSSPADKQAYIKRLLGNSSHGKAPIVIFCGDGTNDAVALAQATIGVHMNEGSDVAQSAADVVLMRPELSGLLTVMN
    ASKVSVRRIKFNFVWSFVYNTFAVLLAAGAFVNARIPPQFAGLGELISVLPVIAAAVLLRWSKI

    >gi|255954815|ref|XP_002568160.1| Pc21g11280 [Penicillium chrysogenum Wisconsin 54-1255]
    MRSFAPLVLSLLGATAAVHAAEPEVADADANVVTLTTDTFNDFIKEHPLVLAEFYAPWCGHCKALAPKYEEAATELKAKD
    IPVVKVDCTEEEELCRTYEVDGYPTLKVFRGPDSHKPYAGARKADAIVSYMTKQSMPAVSNVNEENLEEFKALDKIVIIG
    YVASDDKAANKSFTSFAESQRDNFLFAASNDAALAKAEGAKQPSIVLYKDFDEKKAVYDGKLDEEAILEWVKTASTPLVG
    ELGPETYSKYMAAGIPLAYIFAETAEEREQFAADFRPIAESHRGAINIVTLDAKLFGAHAGNLNLEPEKFPAFAIQDTTK
    NAKYPYDQTKKVDAKDIGKFIKDVLDGKVEPSLKSEPIPETQEGPVTVVVGRNYQEVVIDNEKDVLVEFYAPW
    CGHCKSL
    APKYEELAALFADVPELNEKVTVAKVDATANDVPDSITGFPTIKLYPAGAKDSPIEYAGSRTVEDLVTFIKENGKYQVDG
    LADGAKTPEERAEVTAAPKATESPASEEKDSHDEL

    >gi|255954841|ref|XP_002568173.1| Pc21g11410 [Penicillium chrysogenum Wisconsin 54-1255]
    MKLWAGLFLLLSFVSGVLSASSTQDKFATYQSLSRSGPVDLDSASYEDLTSTPRDYYAAVILTATDPRFGCLLCRDFESE
    WDLIARSWTKGPKPDELKVVFGTLDFDNGKAVFQKLMLQTAPVILVFPPTIGPFAKVEGNPLRFDFTGPISADQVYSWIG
    RHLPEGPKPELVRPINYMRIVSVTTILMAVVTATTVLSPYLLPIVQNRNLWAAVSLIAILLFTSGQMFNHIRKVPYVAGD
    GKGGISYFAGGFQNQFGMETQIVAAIYAVLSFATIALALKVPRMEDVKGQQLAVLIWATVLFATYSFLLSVFKTKNGGYP
    FYLPPF

    >gi|255955283|ref|XP_002568394.1| Pc21g13770 [Penicillium chrysogenum Wisconsin 54-1255]
    MSISTGLHSQRNVSFSSYLVTPKQLNEALKKNPPTKISTSPRVIPLCAAWFMPNDPEGRKGIDSFRNSRIPQARFFDLDA
    VKDQDSPYPHMLPTCETFAEAMSELGIRRDDSVVVYDTADLGIFSAPRVGWTLRVFGHPNVHILNNYRLWIKEGFPTESG
    EAAVTEKSKYPVPTYDSRLVISFREMKELALDYGKEGAEEIEILDARSYGRWAGTDPEPRPGLSSGHIPGSKSMPFQELL
    DPETKTYLPAEDLRKVFEDHKVDPNQSIISS
    CGTGVTASIIETALNEAEYGDPNLRRVYDGSWTEWAQRVKESDGLIKKV
    KS

    >gi|255956517|ref|XP_002569011.1| Pc21g20210 [Penicillium chrysogenum Wisconsin 54-1255]
    MRDSSIKRSLGVDLTRSLKESRVLLVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFLFRHEHIKKSKALVAK
    EVAQKFRSDAKLEAYHANIMDAQFDVSWFESFNVVFNALDNIAARRHVNKMCLVANVPLIESGTTGFNGQVQVIQKSETE
    CYDCNVKETPKSFPV
    CTIRSNPKEPIHCIVWAKSYLLPELFGNSDDEAPEVDSTEDADNAKEIADLRKEALELKELRQSI
    DTEEAHQKVFDKVFGKDIIRLQGMTDLWKEKEPPKLLDLAQLQKESDSIASTVSAQDQRVWTLGENFSVFRDSLNRLARR
    LKQLQETKLPDQDSPILTFDKDDVDTLDFVTATANLRAAIFHLELKSKFDVKQMAGNIIPAIATTNAMTAGLCVLQSLKV
    FQDNLMQAKMVFLERSGARAINSDSLKPPNPDCPVCSRLVVPVEIDPELATLEHLVHDVLQLELGYGRDISLLIGDRLVY
    DQEFDDALPDKLFDMGIKNGSFITVKDDNESARVNLDVVIKTRSEPSSEDSKPATLQKMVEIPLKPKQPAQPPTDDAQNP
    EQPAPPSTDDAAVTGKRKREGSDDDVEPNSHDAKRLASASVPDSNGIKAIVLDDEEEGAIMIDD

    >gi|255947142|ref|XP_002564338.1| thioredoxin reductase TrxB-Penicillium chrysogenum [Penicillium chrysogenum Wisconsin 54-1255]
    MVHSKVVIIGSGPGAHTAAIYLSRAELQPVLYEGMLANGTAAGGQLTTTTDVENFPGFPSGIGGAELMDNMRAQSERFGT
    EIITETISKLDLSSRPFKMWTEWNDDEGSEPVRTADAVIIATGANARRLNLPGEETYWQNGISA
    CAVCDGAVPIFRNKPL
    YVIGGGDSAAEEAMFLAKYGSSVTVLVRKDKLRASNIMADRLLAHPKCKVRFNTVATEVIGENKPNGLMTHLRVKDVLSN
    AEEVVEANGLFYAVGHDPASGLVKGQVELDDEGYIITKPGTSFTNVEGVFACGDVQDKRYRQAITSAGSGCVAALEAEKF
    IAETETHQEAKPVL

    >gi|255947428|ref|XP_002564481.1| Pc22g04430 [Penicillium chrysogenum Wisconsin 54-1255]
    MFARRIATNIPRVRAQASLFHSTAPAFVQKGDAIPNLDVLVENSPGNKVNLAKEIKNKAVIIGTPAAFSPACSSTHVPGF
    INHPKLKEAGQAFVISVNDPFVTKAWADSLDPSGKSGIRFLGDPSGEFTKALDLSFESSAIFGNDRSKRYVLLVEDGKVK
    EAFVEPDNTGLDVSAAEKVLG

    >gi|255947518|ref|XP_002564526.1| Pc22g04890 [Penicillium chrysogenum Wisconsin 54-1255]
    MDSELRLSSPRLGSSIQINDQSNLQLGQFDPESQTFGSFRPPTEAESQLQNATHAFIRPPRQGEPATNFITTSQSTQHQS
    HQGHPSNGLASHLQPQGQPSSGIHQSQGYNDGIAHAANMSGALHGAAAGQMAPPASLSQNELAMGNNAHQANNSLTTLQS
    SSQPFQPDFTGLDPGPTDPVAFTGPGELQGFKLVPNPPHLDYWRERLFNVDEMITLSEEEFQTYFPHVDNVYSHRSTQRY
    KRKPFVSHYWDCRLKGRPPGTPKSDDPEKKKRKRTARERDLCHVKIKVVEYFPSSEIANTTHAVEPLPSNILPGMYTFSL
    NDDPAIRNAQTFGMLTPNPGLPPNHPGSNGGRYFTIQRVNGNGANGKNDGVGGGHQHTLEESDRVKKSSVQRYVLKEKKD
    KRTRTDRIMSRAGQKSYHTKATGLAAETAIKHSADVNLRLYGSCF
    CPFVQRVWIALELKGIPYQYIEVDPYEKPQSLLEV
    NPRGLVPALRHDDWGCYESSVLLEYLEDLGVGATMLPADPKLRAHCRLWADHVNRHIVPSFYRILQEQDQQKQIEKTQEL
    RDAMEKLLEAAHPKGPFFMGPQMSLVDIQAAPWIIRLRRVLKPYRGWPDAEEGTRLASWVNAIETNQHVQATTSTDELYH
    DSYERYAQNRPNTSQVANAINAGRGLP

    >gi|255947932|ref|XP_002564733.1| Pc22g07080 [Penicillium chrysogenum Wisconsin 54-1255]
    MQRSVTSSATLLRWAKPSAGCLRTFSSYGNAYLSSKRDMQTATAYRPHTLPSSFPPPRSTGGADTSISAEFPPSDMKSYQ
    NTSQGALSNVSLRESEAQKSKPNFASPSTSKTSPKPRRPLRARKAAMKLSPVAVEQLRKLMAQPEPKFIRVGVKNRG
    CSG
    LAYHLEYVEKPGKFDETVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEECGCGESFMV

    >gi|255948648|ref|XP_002565091.1| Pc22g11440 [Penicillium chrysogenum Wisconsin 54-1255]
    MTNFQVQIISDTICPWCYVGYRRLSRAITRHQATYPADTFSLTWKAFYLNPAGAEYPGVNKAEMYARKFGAERMEAIFAR
    LSAVGKDEGIQFSFGGNSGLTRDSHRLLWFAGQREAEEAKKEGVNGGVVGGLQTRVAEQLFRAYFEEEKNITDLKVLLEA
    GVGAGLDRETVKKMLNEDVGAQEVDLEAKTAARRLVSGVPYISVQGKYHVEGADEPEVFMEIFEKVKAEQKE

    >gi|255948688|ref|XP_002565111.1| Pc22g11650 [Penicillium chrysogenum Wisconsin 54-1255]
    MPAHPDSNLYPEASGPAKTLVDQHRAEQPLKLYAGWFCPFVQRVWLALEEKKIPYEYIEVNPYNKPDSLLKLNPRGLVPT
    LSTPAGPHPRPLYESTVILEYLEEAYPDHKPRFLPEDAYERARARIWIDYVSSRIIPSFHRFLQYQPADGSAQNPDAGLD
    QARQEFLNHLKTWTKEMHAEGPFFLGGDIGLPDLVLAPWAVRLWAFDEFKNGGLGIPSEGKGGPEEEIWSRWRTWLAAIE
    SRRSVKETTSDLAHYLPIYKRYADNTAQSELAKATRAGRGVP

    >gi|255949222|ref|XP_002565378.1| Pc22g14570 [Penicillium chrysogenum Wisconsin 54-1255]
    MRPSLYLLSLLGATTTAFTANIRTKNSDVVSLTQETFHGFMEEHDLVLANFYAPWCRHSRNLAPKFEQAATELKNDNIPL
    VKIDCTREERLCSDFAIGAYPTLNVFRGPESHEPYHGSRRAESRFTLGLGEACIFKPMIEIVPWTERGLSSFWFTFRHTV
    WDQVHLAIVAQTMTYGF

    >gi|255949234|ref|XP_002565384.1| Pc22g14630 [Penicillium chrysogenum Wisconsin 54-1255]
    MSHGKVTEIDNQVIFKALTSSGPVVVDFFATWCGPCKAVAPVVGKLSEQYQNVRFIQVDVDKLQSVARELGVNAMPTFVV
    FKDGKEVNRVVGGDMKKLEAQIKEISA

    >gi|255950378|ref|XP_002565956.1| Pc22g20560 [Penicillium chrysogenum Wisconsin 54-1255]
    MSRSLFSSSAVRRLSQPQTCRLFSTSRPALRLSAFPGGEIVPRRPSTTASSALPLKRSAPQSSTPRSIRQQNASFSSSSA
    RPAAKVTQNPRTGDDGQSLMIGISPRAVERLREITDPTTSPSAIKEENPYHHLRITVTSGG
    CHGFQYMMSLEGASKIDPE
    EDTVFEGEADEAATESSGEAKVVMDEPSLELLHGSTVDYTTELIGSQFKIVDNPRATSNCGCGTSFDVSD

    >gi|255950436|ref|XP_002565985.1| Pc22g20860 [Penicillium chrysogenum Wisconsin 54-1255]
    MKPSWLGWSLLSLLVAPALGTPSDASSDQESGDALVKRGGRGVDSDTPTTFNDIKVPPLTQLTPENFEEVTKDGYWMIKH
    YSPT
    CPHCRTAAPMYQTLYEYYYTSNPLFLSGLKPGELASLDSFTGYYNLHFGSINCLAFGDFCTKLNVEFFPAWAFYDM
    GVQNGRPVGAKTMSEIAAMIEAKLETIKPGSRPSQGVQIPKAGAKSMEMTAKPEVVKPGAKTAVEKQSIETAELEGVSPE
    SVKAKLQGRPANPQGVSIPLTAESFQSLVTTTHDPWIIKFYVPW
    CHHCQALAPNWNSMAKEMKDTLNVGEVNCDLEKRLC
    EDARVNAYPTIYFFRGGERVEYTGLRGLGDLIAYTNKAVGVGSSIQDVDATTFKRLEETEEVLFLYLYDHATTSEDFEAM
    NRLTLSLVGHARIVKSDSAALSERFKISTWPRLLVVRDGRPNYYNALAPKDMRDFRQILSWMQTVWLPIVPELTASNAQE
    IMNGKFVVLGLLSRRRSDDFKQSKRELKEAALEWMDKQVQLFRLERAELRDSKQLRIEEADDRNDQRALRAAKNMRITIR
    EDDKKQVAFAWVDGDFWERWLRTTYGIDVENSDRVIINDQDNRRYWDTASSGAPIMASRTSILETIPLVVASPSKLSPKS
    TIGTFETILFFTRSLLGSHPILFFIILGAVVAVATIFGRGRLRRGAARGGIIGNTNNNGGFFHLDGKEGFLNGGSTDKVD


    >gi|255950812|ref|XP_002566173.1| Pc22g22790 [Penicillium chrysogenum Wisconsin 54-1255]
    MRHFSAVEERSVDEARRLRVVIIGAGISGILACIRFRQRIPNLDICVYEKNADIGGTWFENRYPGCACDIPAHTYQATFE
    PNKEWSTFYAKGEEIHQYWKHVAGKYGCMEHIKLRQQISEAVWNEEQSKWNLRIQDLASSSTYTDRCDVVIQATGALNNW
    KWPNIPGLEQFKGKLMHSASWDQTYDYKGNRVAVVGNGSSGIQIVPALLPDVPHIDHYARSRTWISPSFGREQIEKRGRG
    LDNYVELELQSIHGITLTGHSMQLGEQEVFTENMKRRLANKPGLIDELLPSFPPACRRLTPGPGYLEALTDDKVDLITSD
    IVKVDETGIITADGQHRPVDMLVCATGFDTSCTPRFVIRGREGVTLSEQWEQTPETYLSIATDGFPNYFISLGPNAGLGE
    GNLLLLIERALDYITECVHKMQRDNIRAMSVRREAVKRFTHYCDAYFAGTVFSSKCRSWYKGGTEDGRVTALWPGSSLHS
    MKVFANPRWEDFEYCYVNDNVFGWLGDGWTENEKHNNINVDYLDDNMVDFPRPMNIAK

    >gi|255950816|ref|XP_002566175.1| Pc22g22810 [Penicillium chrysogenum Wisconsin 54-1255]
    MVFSKATFASAFVSLLACAAAVEVPKTDYEVIVVGGGPAGLSALSGVSRVRRTALLIDSQEYRNGVTREMHDVIGNDGTP
    PAAFRGLAREQISKYPTAHFSNETVESIVPIDGEYTAFTVTDGTGKSYTARKIVLGTGVRDILPPTPGLRENWGKGIFW
    C
    PWCDGYEHRDQPFGMIGDISDMLGNVLETHTQYSDIIAFVNGSQTAEGEARAAEKYPDWEEQLAAWNTTIDNRTIASIER
    LEDGGDNRGENGDQQFDKFRLHFTTGDPVERNALMVNYPTEQASPLPAKMGLVIVDDKINVTAAMRTSEEGVFAIGDCNS
    DGSTNVPHAMYSGKKAAVYLHVEMSREESKSNISKRTGLSHSELEEEAVREIGDNLEPVWKRAQE

    >gi|255951000|ref|XP_002566267.1| Pc22g23760 [Penicillium chrysogenum Wisconsin 54-1255]
    MSTKGFNSGDAFPQDVVFSYIPWTEEAGEITSCGIPINYYASKEWADKKVILFALPGAFTPVCSANHVPEYIQKLPELRA
    KGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPDAKFSKSIGWADEEGRTYRYVIIIDHGKVTYAAKEAAKNTLEL
    SSADAVLKQL

    >gi|255951170|ref|XP_002566352.1| Pc22g24640 [Penicillium chrysogenum Wisconsin 54-1255]
    MTTLKPGDSFPSDVVFKYIPWSEESDEITSCGIPINYNASQEWANKKVVLFSVPGAFTPTCSVNHVPGYIQNLPKLREKG
    VDIVAVVAFNDPFVMSAWGKANAVRGDDILFLSDPDAKFSKSIGWADEASGRTGRYAIVIDHGKVGYAQIETEKGVVKKS
    GADAILASL

    >gi|255931353|ref|XP_002557233.1| Pc12g03480 [Penicillium chrysogenum Wisconsin 54-1255]
    MKLLTKFVLLALGVCVIARDPDRPVCIVGAGPAGLSAAAELELKGYRTVTFEKQSAVGGKCQAVYENSTFSPLGALIFTP
    PTYRESIKLLLKTGVNSVPFVSGEKWQYNASSGSIWAKQPLPPQAMQLFMQEVRRYVDWWNKNFVLYNIAPGYPHGIPTE
    LTVPAAEWLARNGYQTLQAAFVQSMVAYGYGDYRQVPIVYMLQYLTPSVLMTLLKVQQGSMIEIADFHRALQIFADRFIT
    GKIHLDTTISRIDRTGESPIITYQTSSDSTPKTQSCAALILAFPPTLSSLQNAGLDVTDEEREVFTPVGTHSFYSGAVRL
    STPHAMTFGAASAHPGLPPDATGDPVVFAKLHGNLDIAITSSWGPYRGSLTRDKAYARLKSTLSAFNKDPRDAGVSAGAV
    SDEDVLAFQENDYFPHYDSQQLREGYYELFEALQGQKGTYYASGFNMFELVEYALRAGQDVTKRFF