Oryctolagus cuniculus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|291382821|ref|XP_002708129.1| PREDICTED: Thioredoxin-like [Oryctolagus cuniculus]
    MVKQIESKSAFQEVLDSAGDKLVVVDFSATWCGPCKMIKPFFHALSEKFNNVVFIEVDVDDCQDIAAECEVKCMPTFQFF
    KKGQKVGEFSGANKEKLEATINELL

    >gi|291383478|ref|XP_002708296.1| PREDICTED: HESB like domain containing 2-like [Oryctolagus cuniculus]
    MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSDSREAHARPGAHGRNRVTVTCFGVITWGK

    >gi|291383513|ref|XP_002708298.1| PREDICTED: hypothetical protein [Oryctolagus cuniculus]
    MAAPAPVTRQVLGGAALAPVPTGPERGQPLAAAVAELPVLDARGRLVPFGSLFRDRRAVVVFVRHFLCYVCKEYVEDLAK
    VPQSFLREADVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGRSPHIKSSLLSGSLRSLWR
    AVTGPLFDFQGDPAQQGGTLILGPGNNIHFMHLDRNRLDHKPINSVLQLVGVQQVNFTNRPSVMHV

    >gi|291383553|ref|XP_002708327.1| PREDICTED: nucleoredoxin-like 2 [Oryctolagus cuniculus]
    MVDLLGGRRLLTREGAAVEAEAALQNKVVALYFAAGRCAPSRDFTPLLCDFYTALVGAAPRPAPFEVVFVSADGSAEEML
    DFMRELHGAWLALPFHDPYRHELKKRYNITATPKLVIVKQSGEVITSRGRKQIRERGLACFQSWVEAAADVFQNFSG

    >gi|291385818|ref|XP_002709490.1| PREDICTED: methionine sulfoxide reductase A isoform 1 [Oryctolagus cuniculus]
    MLSATRTARQLLHSLVSVPRMGDSASKIVSPQEALPGRKEATPVAAKHHVNDNRTVEPFPEGTQMAVFGMGCFWGAERKF
    WTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVYRPEHIRFEELLKVFWENHDPTQGMRQGNDYGSQYRSAIY
    PTSAKQMEAALSSKEDYQQVLSKHGFGPITTDIREGQTFYYAEDYHQQYLSKNPDGYCGLGGTGVACPLGIQK

    >gi|291386071|ref|XP_002709393.1| PREDICTED: tumor suppressor candidate 3, partial [Oryctolagus cuniculus]
    RPMLAPVGTVFICAVTRIIQRICAVLSVSTVSPTVTLTRELGSPEHEEPSTNLLAEKVEQLMEWSSRRSIFRMNGDKFRK
    FIKAPPRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFP
    PKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVS
    LCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIIC
    IVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE

    >gi|291386200|ref|XP_002710060.1| PREDICTED: phosducin-like protein 3-like [Oryctolagus cuniculus]
    MQDPNADTEWNDILRKKGILPSKESLKELEKQAEEEEERALQQSVVKTYEDMTLEELEDNEDEFNEEDERAIEMYRQQRL
    AEWRATQEKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPL
    CALINQHFSALARKFPDVKFIKAISTTCIPNYP
    DRNLPTVFVYLEGEIKAQFVGPLVFGGMNLTRDELEWKLAKSGAIKTDLEENPRKPIEDVLLSSVRCSVPARRDSDSEGD


    >gi|291386210|ref|XP_002709997.1| PREDICTED: thioredoxin domain containing 9 [Oryctolagus cuniculus]
    MEADASVDMFSKVLENQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLEALRKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKKVVCHFYRDSTFR
    CKILDRHLVILSKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDYVVG
    FTDLGNSDDFTTETLEWRLGCSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGGKKYDSDSDDD

    >gi|291386615|ref|XP_002709844.1| PREDICTED: peroxiredoxin 1 [Oryctolagus cuniculus]
    MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYIVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGRKPGSDTIKPDVQKSKEYFSKQK

    >gi|291387352|ref|XP_002710147.1| PREDICTED: Protein Disulfide Isomerase family member (pdi-1)-like [Oryctolagus cuniculus]
    MRFFGWWQALLWVLGLPAQRPGGFGGSPGPTGEPRRPPPTEADSPAASAPPRSAAEAPALGSSPAEAGRAGACGGLPLER
    FRGVLERAGPRQVPRRRGWVPVPLIFGYIALVAEGSGHLWSEEQPVAPLQVGAVHLSEEEPPHNSRSQAGAAEEEDAVLG
    LDMLGHPMAVLSVVPGEAEDPLSAEPSVDGTCRADGEEGSRCQPRESLLSLDSAGASSHGRDQEEERYGEPEVAEPAPAP
    TEDSNSTESPKSPKVSCEERNVTGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPW
    CRFSASLAPHFNSLPRAFPAL
    HFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKVFIFNQTGIEAKKNVVVTPADQIGPLPSTLVK
    SVDWLLVFSLFFLISFIMYATIRTENIRWLIPGQEQEHVE

    >gi|291389049|ref|XP_002711025.1| PREDICTED: thioredoxin-related transmembrane protein 4 [Oryctolagus cuniculus]
    MAGGCCGRLLTTLLAAWLAAAAAAETPAGSEQASLPAEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWETF
    AKNGEVLHISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKWQSVEPLTGWKSPASLTM
    SGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLLMGLVLVVISECFCVPLPRDLSERSEQDQRSEDAHS
    AEQLQDAEEEKDDSNEEENKDSLVDDEEEKEDLADEDEAEEEEEEDNPTGNVDEEKNDTNDQGLLRQGSVSQAEVEPDNT
    DDLPEQPRVADIEGLEDSLRQRKSQPATKGL

    >gi|291389503|ref|XP_002711360.1| PREDICTED: methionine sulfoxide reductase B3-like [Oryctolagus cuniculus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVISSEVITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFA
    PAGSSSTTEGGSGLSSPAQADKAEL

    >gi|291389890|ref|XP_002711453.1| PREDICTED: mercaptopyruvate sulfurtransferase [Oryctolagus cuniculus]
    MAEPGGLEPEIRACSPSDTMAAPQLFRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFD
    IDQCSDRTSPYDHMLPGAEQFAEYAGRLGVGAATHVVVYDASEQGLYAAPRVWWMFRAFGHRTVSLLDGGLRHWLRQGLP
    LGSGKSHPAPAEFHAQLDPAFVKTYEDIKENLEARRFQVVDARAAGRFQGTEPEPRDGIEPGHIPGTVNIPFTEFMTPEG
    LEKSPEEIQRLFQEKKVDLSRPLVAT
    CGSGVTACHVALGAYLCGKPDVPIYDGSWVEWFMRARPEDIISEGRGKTH

    >gi|291389892|ref|XP_002711454.1| PREDICTED: Thiosulfate sulfurtransferase-like [Oryctolagus cuniculus]
    MVQQVLYRALVSTKWLAESVRAGKVGPGLRVLDASWYSPGTRQARQEYQERHVPGASFFDIEECRDTASPYEMMLPSEAG
    FADYVGRLGISNDTHVVVYDGDHLGSFYAPRVWWMFRVFGHRMVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLDRS
    LLKTYEQVLENLQSKRFQLVDSRAQGRYLGTEPEPDAVGLGSGHIRGSLNMPFMDFLTPEGFEKSPEELRAMFQAKQVDL
    SQPLIAT
    CRKGVTACHIALAAYLCGKPDVAVYDGSWSEWFRRAPPDTRVSQGEGGKA

    >gi|291389908|ref|XP_002711458.1| PREDICTED: thioredoxin 2-like [Oryctolagus cuniculus]
    MAQRLLLRRFLAAAASRKPAQSRWAPLAFSAARTPPCGPGGHTGTPSPARTLHATGVLATTFNIQDGSDFQDRVVNSETP
    VVVDFHAQW
    CGPCKILGPRLEKMVAKQQGKVVMAKVDIDDHTDLALEYEVSAVPTVLAIKNGDVVDKFVGIKDEEQLEAF
    LKKLIG

    >gi|291390030|ref|XP_002711522.1| PREDICTED: thioredoxin domain containing 9-like [Oryctolagus cuniculus]
    MGQSGNKEECLLLTIKLEADASVDMFSKVLENQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKGKRLEALRKAQQQKQE
    WLSKGHGEYRETPSCRSPSSERDLFQEVKESKKVVCRFYRDSTFR
    CKILDRHLVILSKKHLETKFLKLNVEKAPFLCERL
    RIKVIPTLALVKDGKTQDYVVGFTDLGNSDDFTTETLEWRLGCSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGGK
    KYDSDSDDD

    >gi|291390115|ref|XP_002711552.1| PREDICTED: SUMO-1 activating enzyme subunit 2 [Oryctolagus cuniculus]
    MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESV
    LQFHPKANIIAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYE
    CHPKPTQRTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
    KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQEETNASDQQNEPQLGLKDQQVLDVKSYASL
    FSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLE
    GLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQ
    IEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQADD
    AAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSDNANISEEERSRKRKLDEKDSVSAKRSRTGEPEELADVIALD

    >gi|291390420|ref|XP_002711732.1| PREDICTED: thioredoxin-like 4B [Oryctolagus cuniculus]
    MSFLLPKLTSKREVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDRTPVYTQYFDISYIPS
    TVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

    >gi|291390649|ref|XP_002711813.1| PREDICTED: prolyl 4-hydroxylase, beta subunit-like [Oryctolagus cuniculus]
    MERLWMPLLLVASCVSTVHSSLEEESDFSSINITKPLHILEEGNLMVLTPAGLAQMLNQTRFLMVLFHNPSSKQSRNLAE
    ELGKAVDIMGKGKNGVGFGKVDITVEKELQQEFGVKKGPSLKLFFEGNRLEPICCKGVVESTALVVWLRRQISQKAFLFN
    NSQQVADFVSSRPLVIIGFFQDLEEEVAELFYDVIKDFPELTFGVIKIKNALGRFHVTLDSVLVFKKGKVVNRQELINDS
    TNKYDLNQVIKQHLTDLVIEYNTENKDLIYELHILNHMLLFASKSAESFGLIIQHYKLASKEFQNKILFILVDADEHRNR
    RVLEYFQLSEVNIPCVQILNLSSDARYKMPSDDITYQNLKKFGRNFLSKNAKKHLSSEEIPKYWDQGPVKQLVGKNFNLV
    VFDKERDVFVMFYAPWSEK
    CRVLFPLLEELGIKYQNHSTITIAKLDITANDIQLSPMDRYPFFRLFPTDSEQAVKYDGEH
    TMKGFSAFLESQVKTRAEEEVEELLPLDQNGVIEEEALAKEVEVPLVEAELPEQQLHELQNMTTLEEPAGQKETAEVEEE
    VAMPEGPPSQEKKPTVKEEL

    >gi|291390992|ref|XP_002712014.1| PREDICTED: protein disulfide isomerase A4 [Oryctolagus cuniculus]
    MTYTPSLIVLNGSPGDKSGLLASASTGDFHSDSSVTENAIEDEEEEEEDEDDEEEDDLEVNEENGVLVLNDANFDNFVAD
    KDTVLLEFYAPW
    CGHCKQFAPEYEKIAKVLKENDPPIAVAKIDATSASMLASRFDVSGYPTIKILKKGQAVDYEGSRTQE
    EIVAKVKEVSQPNWTPPPEVTLVLTKDNFDDVVNDADIILVEFYAPW
    CGHCKKLAPEYEKAAKELSKRTPPIPLAKVDAT
    AETDLAKRFDVSGYPTLKIFRKGKPFDYNGPREKYGIVDYMIEQSGPPSKEVPTLKQVQEFLKDGDDVIIIGVFKGESDP
    AYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSPGKLVVMQPEKFQSKYEPRTNVLDIQGSTEGSAIKDHVVKHALPLVG
    HRKTSNDAKRYTKRPLVVVYYGVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAAEVKDLGLSESGEDVNAAI
    LDESGRKFAMEPEEFDSDVLREFVTAFKKGKLKPVIKSQPVPKNNKGPVQVVVGKTFDSIVMDPKKDVLIEFYAPW
    CGHC
    KQLEPIYTSLAKKYKSHKGLVIAKMDATANDITSDRYKVDGFPTIYFAPRGDKKNPIKFEGGDRDLEHLSQFVDEHTTAQ
    SRTKEEL

    >gi|291391721|ref|XP_002712225.1| PREDICTED: methyltransferase like 8-like [Oryctolagus cuniculus]
    MNVIWRNRLFYLRLGTVPHRCQSGSHPTAPLGSRILTNPTKVFEHNMWDHMQWSKEEEAAARKRVEDNSAVRVLVEEQVK
    YESEASKYWNTFYKIHKNKFFKDRNWLLREFPEILPVDQKLKEKTEESSWDCVKTNSANCSSEMHYPTMPEGRTHYKKSS
    GSSDGQSKVGSNFSHPDSEEHRKSCLKAEFFPGSNATFRILEVGCGAGNSVFPILNTLRNIPGAFLYCCDFAPGAVELIK
    SHSSYRAAQCCAFVHDVCDESSPYPFPDGVLDAILLVFVLSSIHPDRMQSVVNRLSKLLKPGGMLLFRDYGRYDMTQLRF
    KEGH
    CLSENFYVRGDGTRAYFFTKGEVHSMFYKAGLDEKQNLVDRRLQVNRKKQVKMHRVWVQGKFQKPLRWTQNISKFM
    FSLLPPH

    >gi|291391863|ref|XP_002712370.1| PREDICTED: DnaJ (Hsp40) homolog, subfamily C, member 10 [Oryctolagus cuniculus]
    MGVCLNKDAYIRDLKRIGFCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPG
    CSH
    CHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVNFAMQHVRSTVTEL
    TTGNFVNSIQTAFAAGIGWLITFCSLEEDCLTTQTRLRLSGMLFLNSLDAKEIYLEIIHNLPDFELLSANTLEDRLAHHR
    WLLFFHFGKNEKDDPELKKLKTLLKNDHIQVGRFDCSSAPEVCSNLYVFQPCLAVFKGQGTKEYEFHHGKKILYDILAFA
    KESVNSHVTTLGPQNFPANDKEPWLVDFFAPW
    CPPCRALLPELRKASTLLYGQLKFGTLDCTIHEGLCNMYNIQAYPTTV
    VFNQSNIHEYEGHHSAEQILEFIEDLRNPSVISLTPTTFNELVKKRKYDEVWMVDFYSPW
    CHPCQVLMPEWKRMARALTG
    LINVGSIDCQQYHSFCTQENVQRYPEIRFFPQKSNKGFQYHSYNGWNRDAYSLRIWGLGFLPQVSIDLTPQTFNEKVLQG
    KNHWVVDFYAPW
    CGPCQNFAPEFELLARLIKGKVKAGKVDCQAYAQTCQKAGIKAYPTVKLYLYDRTKRNIWEEQIHSRD
    AKAIATLIDGKLETLQNQGKRDKDEL

    >gi|291393323|ref|XP_002713123.1| PREDICTED: Thioredoxin reductase 3-like, partial [Oryctolagus cuniculus]
    SPSPQLLSSPGLAGSEVDALEPPPPPPPPPPPPSRALASPGPGRVGVSPNRRLDSVRGMPTSSPPGRRARVLSPGTSRPS
    SEAREELRRRLLELIEGNRVMIFSKSY
    CPHSARVKELFSSLGVDYNILELDQVDDGANVQEMLSEITNQKTVPNIFVNKV
    HMGGCDRTFQAHQSGLLQKILQEESAYEYDLIVIGGGSGGLSCAKEAAILGRKVMVLDFVVPSPRGTSWGLGGT
    CVNVGC
    IPKKLMHQAALLGQALRDSRKFGWEYSQQVKHNWETMTEAIQNHIGSLNWGYRLSLRERGVTYVNSYGEFVEHHTVKATN
    RKGQETYYTSANFVIATGERPRYLGIPGDKEF
    CITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDVTVMVRSIL
    LRGFDQEVAEKVGSYMQQHGVKFLRKFVPVMVQQLEKGSPGKLKVTAKSTEGPETIEGVYNTVLLAIGRDSCTRNIGLEK
    IGVRINEKNGKIPVNDVEQTNVPYVYAVGDVLEGKPELTPVAIQAGKLLARRLHGASSEKCDYFSIPTTVFTPLEYGCCG
    LSEEKATELYMKENLEVYHTLFWPLEWTVAGRDNNTCYAKIICNKLDQDRVIGFHVLGPNAGEITQGFAAAMKCGLTKQL
    LDETIGIHPTCGEVFTTLEITKSSGLAVTQQGC

    >gi|291393991|ref|XP_002713351.1| PREDICTED: ubiquitin-activating enzyme 3 isoform 1 [Oryctolagus cuniculus]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFSDTFYRQFH
    IIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRMLQWPKEQPFGEGIPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSP
    AITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|291393993|ref|XP_002713352.1| PREDICTED: ubiquitin-activating enzyme 3 isoform 2 [Oryctolagus cuniculus]
    MADGEEPMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFR
    QIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFSDTFYRQFHIIVCGLDSIIARRW
    INGMLISLLNYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVR
    MLQWPKEQPFGEGIPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATS
    AYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLY
    LQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|291394108|ref|XP_002713616.1| PREDICTED: thioredoxin domain-containing 2-like [Oryctolagus cuniculus]
    MPDKHCLGHVIKVSDVSGNNACEGVSTAFRHTVGPRTKAAMRLSDITVAQTEKNWSVQSSIGGIYAGPGVYLEEEVEMAS
    VKPGASEEPEMRLDSPEETNGSTLQILSSNVTPLVADFVDTAQAKGKAFKPMANNTLNMLREEPEVPQQSRQGDDSPISS
    ANTIQPKQSSVLKPSAKSIQPKQGDNPKPSVKSTQPRQDNSSNPLPKSIQPKEDDIPKRSTKPILPKEADIPKVSTKPIL
    PKEADVPKLSTKPIQPKEADVPKLSTKPIQPKEADIPKLSTKPIQPKEADVPKLSTKPIQSKDGDIPKLSTKPIQPKEAD
    IPKVSTKPIQPKEADIPKLSTKPIQPKEGDIPKLSTKPIQAKENVISKFSEETIYSKVGATPRFSKETIYSKDGATPRLS
    EETIYSKVGATPRFSKETIQSKDGATSKLSEETIYPKVGATPRFSKETIQSKDGATPRLSEETIYSKVGATPKFSKETIY
    PKDGATSKFSEETIYSKVGTTPRFSKETIYSKDGATPRLSEETIYSKVGATPRFSKETIQSKDGATSKLSEETIYPKVGA
    TPKFSKETIYSKDGATSKLSEETIHSKVGATPRFSKETIYSKDGATSKFSEETIYPKVGAISRFSKETIYSKDGATPRLS
    EETIYSKVGAIPKFSKETIQSKDGATSKLSEETIYPKEGTITKFSKETIQSKDGATPRFSEEAVYSKEGTTSKSAGETKE
    SKEGGIPTFLEDTIQSKEDTVSKFSEEPKDSTTTEPSAETEQPKEGSVPKVRQEPFLLQKAAAFTFSEESIQLEEESILK
    LKEAMESMQVDLVKVIVSKEDFEASLKEAGERLVAVDFSATW
    CGPCRAIRPRFHSLSMEHDDVVFLEVDADDCEEIIRDY
    EITCLPTFQFYKQEKKVGEFSGALTERLEAIIEELK

    >gi|291394403|ref|XP_002713592.1| PREDICTED: thioredoxin-like 1 [Oryctolagus cuniculus]
    MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFL
    FFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDLTFLESD
    CDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
    VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|291394688|ref|XP_002713720.1| PREDICTED: thioredoxin domain containing 3 [Oryctolagus cuniculus]
    MASKKREVQLQVVINSQSLWDEMLQNKGLTVIDVYQAWCGPCKAMQTLFRKLKNELNEEEILHFVVAEADSIATLQPFRD
    KCEPVFLFSLYGKIIAKIQGANAPLVSKKIINLINDERKIAAGEMARPQDLYSIVIIKPDGVISRKALQIKETITNAGFV
    IEAQDKTVLTEEQVRNFYSQMASQPDFEEFVSFMTSGLSWVLAVSQGSEPPVSWEESEHQPETEFKDTSESSPKADVKST
    TAVTKKKQNSLQEYLVKQNISQFCDVEENVTSSKLIDIFFPDFKIMKSVKLERTLALLRPDLFQQRKDDVLSIIKDEGFK
    ILMERQIVLSEREAQTLCKGYENEEYFEQLIEYMTSGPSLALVLLRDSGLQYWKQLLGPKTVQEANEYYPDSLCAQFAMG
    SLPINQLYGSDSTEVAEREIEYFFPVQSTLALIKPHVTREQREEILKIIKEAGFAFTQMKEMLLTPEYADKIYFKITGKD
    FYKDVLEALSEGPSLVMVLTKWNAIGDWRRLMGPTDPEEATLLSPNSIRAQFGISKLKNAVHGASNDSEAMESINGVFGE
    FVP

    >gi|291395026|ref|XP_002713972.1| PREDICTED: Glutaredoxin-1-like [Oryctolagus cuniculus]
    MAQEFVNSKIQPGKVVVFIKPTCPYCRKTQEILSELPFKQGLLEFVDITATSDMSEIQDYLQQLTGARTVPRVFLGKDCI
    GGCSDLIAMQEKGELLARLKEMGALRQ

    >gi|291395359|ref|XP_002714080.1| PREDICTED: glutathione peroxidase 8-like [Oryctolagus cuniculus]
    MEPLSAYPVKCSGPKAKVFAVLLSMLLCTVTLFLLQLKFLKPKTNSFYAFEVKDAKGRTVSLEKFKGKVTLVVNVASDCQ
    LTDRNYLALKELHKEFGPYHFSVLAFPCNQFGDSEPRPSKEVESFARSTYGVTFPIFHKIKILGPEAEPAFRFLVDSSKK
    EPRWNFWKYLVNPDGQVVKFWRPEEPIDVMKPDIAALIRQIIIKKKEDL

    >gi|291395428|ref|XP_002714043.1| PREDICTED: Thioredoxin-like [Oryctolagus cuniculus]
    MVEQVDCKSAFQEVLDTAGDKRVVGKFSAMWYRPCKMIKPFFYSLSEKYSNVFLEVDVDDCWDTAAECAVRCRPAFRFFC
    FLVFKKRQKVGEFSGANKEKLEATINELFMFSENITSLQLFKTCKIFYLQKVNMETMHSTAI

    >gi|291395498|ref|XP_002714281.1| PREDICTED: CG1837-like [Oryctolagus cuniculus]
    MDLLGDFEISFRVGGALSRELGCGNSLDERGARRSRKDLAALASSLLATGPQQTARGRCACGGEPKADLPCAHGAKTGKR
    PGLGEARGTPLPQSLELLEARALHPFSSHKDAQYPHSKHLYTADMFTHGIQSAAHFVRFYQSIKYSPW
    CGHCQRLQPTWN
    DLGDKYNSMEDAKVYVAKVDCTASSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFQSLENWMLQTLKDEPATPAPQVE
    PPKAPELKQGLYELAASNFEQHITQGDHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYQLCSGNQVR
    GYPTLLWFRDGKKVDQYKGKRDLESLRDYVASQLQRPETGTPEASKPTEAPVLDAEPVADKDMVLALTEKNFDDTVAQGI
    TFVKFYAPW
    CGHCKNLAPTWEELSKKEFPGLAEVKIAKVDCTAEREICSRHAVRGYPTLLLFRGGKQVSEHSGGRDLDSL
    HGFVLRQARDEL

    >gi|291395607|ref|XP_002714310.1| PREDICTED: glutathione peroxidase 5-like [Oryctolagus cuniculus]
    MAAQLRASHLVPFLLAGLVLTDSKPEKMKMNCYKDVKGTIYNYEAFTLNGKQRIQFKQYAGKYVLFVNVATYCALTSQYP
    ELNALQEELKPFGLVVLGFPCNQFGKQEPGQNSEILPALKYVRPGKGFVPNFQLFEKGDVNGGKEQNIFTFLKHSCPHPS
    GILGSLRHISWEPIEVHDIRWNFEKFLVGPDGVPVMRWFHLAEVSTVKSDILAYLKQSKPKKESGVGGFAPPNPRSLNFR
    TSPVTVTNKMCCAASKSSVIVFKSCLMLAQAKSVPRLGKPTSNDQSLRSVRVKSRASQTPAETPPKGKYNLFGYFKVAKY
    FEKTKQGVTGLEPEGAFEEGRSAELRAGALR

    >gi|291395609|ref|XP_002714234.1| PREDICTED: glutathione peroxidase 6-like [Oryctolagus cuniculus]
    MIPQFWASCLFLLFLVSFAQETPEPQKMKMDCNKEVSGTIYEYGARTLNGEEDIQFQQYAGKYVLFVNVATYCANTAQYP
    ELNRLQEDLKNLSVIVLGFPCNQFGKQEPGRNSEILSGLKYVRPGGNFVPNFQLFEKGDVNGENEQKVFTFLKNSCPPTS
    ELLGSPRHLFWDPLKIHDIRWNFEKFLVGTDGIPVMRWFHAAPVSTVKADILKYVEQFNTQ

    >gi|126722635|ref|NP_001075580.1| chloride intracellular channel protein 1 [Oryctolagus cuniculus]
    MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVHKLCPGGQLPFLLYGTEVHTDTNKI
    EEFLEAVLCPPRYPKLAALNPESNTAGVDIFAKFSAYIKNSNPALNDNLEKGLLKALKILDNYLTSPLPEEVDETSAEDE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKNRGFTIPEVFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKAL
    K

    >gi|291396296|ref|XP_002714504.1| PREDICTED: chloride intracellular channel 5 [Oryctolagus cuniculus]
    MNDGDYSTIYDTIQPERMYELPDQPGENGGPFYDEVHKDLGPENSLYAPGLETPEHHPVSVSITGSGGQSLASPQPEAGG
    YLLPDEVDPEVSLTHSGELQEDRDISKEEPHSPTQDQEEPQENAVMRKEELPSPSSFAIQHSRAFSTSQHSPAFYSDANG
    LQENEATSTNPEIYLFVKAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKT
    DVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDTN
    TRGDEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADAEIELAYA
    DVAKRLSRS

    >gi|291397244|ref|XP_002715038.1| PREDICTED: peroxiredoxin 6 [Oryctolagus cuniculus]
    MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSVDSVEDHL
    AWSKDINAYNGDEPTEKLPFPIIDDKNRDLAILLGMLDPAERDEKNMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEI
    LRVVKSLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKTLFPKGVFTKELPSGKKYLRYTPQP

    >gi|291397312|ref|XP_002715057.1| PREDICTED: quiescin Q6 sulfhydryl oxidase 1 [Oryctolagus cuniculus]
    MRRCGRRSGPLLPLLLLLAAPGALAAPRSALYSPSDPLTLLQADTLRGAVRGSRSAWAVEFFASWCGHCIAFAPTWKALA
    RDVKDWRPALNLAALDCADETNSAVCRDFNIPGFPTVRFFKAFSKDGSGTTLPVAGADVPTLRERLIDALETHRDTWPTA
    CPPLEPARMKEIDGFFARSDKEYLALIFEKEGSYLGREVTLDLSQHQGMAVRRVLNTESDVVSRFGVTDFPSCYLLSRNG
    SVSRVPVLKETRAFYTAYLQRLSGLTREASRSTVAPTTAHRIAPTVWKSADRSKVYMADLESALHYILRVEVGRFSLLEG
    QRLVALKKFVAVLAKYFPGRPLVQNFLYSVNDWLKRQQKKKIPYSFLKTALDSRKEDAVLAKKVNWIGCQGSEPHFRGFP
    CSLWVLFHFLTVQASRRSANHPQEAVKGQEVLQAIRGYVRFFFG
    CRECAGHFEQMAAASMHKVGSPNDAVLWLWSSHNRV
    NARLAGAPSEDPQFPKVQWPPRELCSACHNELQGTPVWDVGATLNFLKGHFSPGNIALDPPPAGRAPRRGPQAVAAAPKL
    VVGALELTTGNATLEAESPRATVPGAAAQGPEAGHPEPEPQGAVLGQRRLSRRDTGAVLLAGNQPRGPSELRRVGRGAEL
    LAGILEEEPRAGARRAPGQWLQVLGGGFSHLDASLCVGLYSLSFMGLLAVYTFFRARIRALKGHAGHSAA

    >gi|291398705|ref|XP_002715604.1| PREDICTED: glutaredoxin 1-like [Oryctolagus cuniculus]
    MEAAVVSVAQQFVNSKIQPGKVVVFIKPTCSYCRRTQQILCQLPFKQGFLEFVNINAARDTRKIQDYLEQLTGARTVPRI
    FISKHCIGGCSELIAMHENGELWMQLKGIRALQL

    >gi|291398880|ref|XP_002715136.1| PREDICTED: glutathione peroxidase 7-like [Oryctolagus cuniculus]
    MVAAVAVAWLLLWATACAQQEQDFYDFKVVNIRGKLVSLEKYRGSVSLVVNVASECGFTEQNYRDLQQLQRDLGPRHFNV
    LAFPCNQFGQQEPDSNKEIESFARRTYGVSFPMFSKVAVTGTGAHPAFKYLIETSGKEPTWNFWKYLVAPDGKVIGAWDP
    TVPVEEIRPQITALVRKLILRNREDL

    >gi|291399010|ref|XP_002715184.1| PREDICTED: peroxiredoxin 1 [Oryctolagus cuniculus]
    MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYIVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|291399244|ref|XP_002716062.1| PREDICTED: chloride intracellular channel 4 [Oryctolagus cuniculus]
    MWGVADECFAKWEGGWQLFDSLEAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFN
    SEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPD
    EIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVE
    IAYSDVAKRLTK

    >gi|291399853|ref|XP_002716614.1| PREDICTED: thioredoxin domain containing 6 [Oryctolagus cuniculus]
    MLSSKGLTVVDVYQGWCGPCKPAVSLFQKLRLEVGPDLLHFALAEADSLDVLNKYRGRCEPTFLFYAIKDEALSDEDGCL
    SRGKDGRADEDVVSSEKTCTLAIIKPDAVVHGKADEIMVKIQEAGFDILTSEERTMTEAEMRLFYQHRAGEEAFEKLVRH
    MCSGPSHLLILTRTEGAEDVVTAWRDFMGPCDPHVARREQPESLRAQYGTEMPCNAVHGSRDREDANKELALLFPNFRFT
    DTETPQGKSCRQSGEAEGEVGTPKVLPSREDVA

    >gi|291400533|ref|XP_002716857.1| PREDICTED: protein disulfide isomerase A5 [Oryctolagus cuniculus]
    MDISLDWWHMDTGICPRSDSKEQLTENAECCQAQEQCPLPPDRARIINVVIVVLKVGDCDLRESVGRRLARLPRLLELHD
    TITTVLRMGEAAFGDSTGQACDNGCHLSRLSSRTDISPGLLVAPGGRNGGVEAADPSWGPVSQASCRGAQFPRSLPPCPA
    VVPHKLALLTWLSSAKVSSLIERISDPKDLKKLLRTRNNILVLYSKSEAAAQSHLKLLSTVAQAVKGQGTICWVDCGDAE
    SRKLCKKMKVDLSPKDKAVELFHYQDGAFHTEYNRALTFKSIVAFLKDPKGPPLWEEDPGAKDVVHIDSEKDFRRLLKKE
    DRPLLLMFYAPW
    CSMCKRMMPHFQQAATQLRGHAVLAGMNVYPSEFENIKEDYGVRGYPTICYFEKGQFLFQYDNYGATA
    EDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHASVLVMFHAPW
    CGHCKKMKPEFEKAAEVLHGDADSS
    GVLAAVDATVNKGLAERFHISEFPTLKYFKNGEKHEVPALRTKKKFIEWMQNPEAPPPPEPTWEEQQTSVLHLAGDSFRE
    TLKKKKHTLVMFYAPW
    CPHCKKVIPQFTAAADAFKDDRKIACAAVDCVRDKNQDLCQQEAVKAYPTFHYYHYGKFVEKYD
    SDRTESGFTNFIRALREGDLERLGKRKEEL

    >gi|291401785|ref|XP_002717125.1| PREDICTED: phosducin-like 2 [Oryctolagus cuniculus]
    MEGDTLTERRFITDPNEDTEWNEILRDFGILPPKEEPKDEIEEMVLRLQKEAMVKPYEKMTLAQLKEAEDDFDEEDMQAI
    EAYREKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDVWVIIHLYRSSIPM
    CLLVNQHLSLLARKFPETKFVKAIV
    NSCIQHYHDNCLPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEANPKKGIVDMMMSSIRNTSIYD
    DSNSSNSDNDTK

    >gi|291402030|ref|XP_002717658.1| PREDICTED: selenophosphate synthetase 1 [Oryctolagus cuniculus]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLAVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|291402722|ref|XP_002717716.1| PREDICTED: GLRX2 protein-like [Oryctolagus cuniculus]
    MGSGRETISDNCVVIFSKTTCSYCTMAKKLFRDMNVNCKVVELDTLEYGSQFQDALYRMTGERTVPRIFVNGTFIGGATD
    THRLHKEGKLLPLVHQCYLKKK

    >gi|291402743|ref|XP_002717743.1| PREDICTED: phosducin-like [Oryctolagus cuniculus]
    MEEAKSHSLEEDFEGQATHTGPKGVINDWRKFKLESEDSDSVPPSKKEILRQMSSPQSKDDKDAKDRLGRKMSIQEYELI
    HQDKEDENCLRRYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKITTIVVHIYEDGIKG
    CDALNSSLTCLAA
    EYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREMQALEQTNT
    DEDME

    >gi|284005547|ref|NP_001164786.1| protein disulfide-isomerase A3 [Oryctolagus cuniculus]
    MRLAMFPGVALLLAAARLAAASDVLELTDDNFESRITDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKV
    DCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLGTEEDFKKFISDKDASVVGFFKDL
    FSEAHSEFLKAASNLRDKYRFAHTNVESLVKEYDDDGEGITLFRPSHLTNKFEDKTVAYTEQKMTTGKIKKFIQENIFGI
    CPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESSTGEV
    PVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYA
    PW
    CGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLSPKKYEGGRELSDFISYLQRE
    ATNPPIIQDEKPKKKKKAQEDL

    >gi|291403856|ref|XP_002718287.1| PREDICTED: thioredoxin-related transmembrane protein 1-like [Oryctolagus cuniculus]
    MAPPGSPVLPLTVLVLLLWGAPCTYGRRSDVRVITDENWRELLEGEWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNV
    GKVDVTEQTGLSGRFIITALPTIYHCKDGEFRRYQGPRSKKDFINFISEKEWKSIEPVSSWFGPGSVLMSSMSALFQLSM
    YIRTCHNYFIEDLGLPVWGSYTVFALATLLSGLLLGLCMIFLADCLCPSKRRRPQPYPSKKSLPEFSQPLKKVEEEQEAD
    EEDVSEEEAKNGGGAKKDFVQADALRQRAVGPSQAADQS

    >gi|291403873|ref|XP_002718351.1| PREDICTED: ERO1-like [Oryctolagus cuniculus]
    MLHSGAGAKQLSSTGLHKFLNSGCPESTQEKQLIQQVVSGYLDDCTCDVETIDKFNNYRLFPRLQKLLESDYFRYYKVNL
    KRPCPFWNDISQ
    CGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDS
    SDNFCEADDIQSPDAEYVDLLLNPERYTGYKGPDTWKIWNVIYEENCFKPQTIKRPLNPLASGQGKSKENTFYSWLEGLC
    VEKRAFYRLISGLHASINVHLSARYLLQDTWLEKKWGHNITEFQQRFDGVLTEGEGPRRLKNLYFLYLIELRALSKVLPF
    FERPDFQLFTGNKIQDAENKKLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWG
    KLQTQGLGTALKILFSEKLIANMPESGPSYEFQLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH

    >gi|291404751|ref|XP_002718682.1| PREDICTED: arsenic (+3 oxidation state) methyltransferase [Oryctolagus cuniculus]
    MTADADGYDVVPGLDGPKARGPRAQQVRGAWRSAVAALRDAEIRKDVQDYYGQTLKKSADLQTNACVTPARPVLKHVGEA
    LRNVHEEVALRYYGCGLVIPERLENCWVLDLGSGSGRDCYALSQLVGEKGRVTGIDMTRGQVEVAKKYLDYHMEKFGFQT
    PNVTFVHGYIEKLGEAGIKDESYDIVISNCVVNLVPDKQQVLQEVYRVLKHGGELYFSDVYASLELPEEVRTHGVLWGE
    C
    LGGALYWKDLANFAKNIGFCPPRLVTANLITIQNKELERVVGDCRFVSATFRLFKLPKTGPAERCQVIYSGGITGHEKEL
    IFDANFTFKKGELLEVDEETAIILKNSRFAEDFLFQPIAEKPPASGACPVLEAKDIITDPFQLAGQPDAVKSSCVPDAAG
    GCCGKKKRC

    >gi|291404791|ref|XP_002718774.1| PREDICTED: glutathione-S-transferase omega 1 [Oryctolagus cuniculus]
    MSGDATKSLGKGSPPPGPVPEGVIRLYSMRFCPFAERTRLVLKAKGIRHEIININLKNKPDWFFKKNPLGLVPVLEDSKG
    QVVYESVITCEYLDEVYPGKKLWPEDPYEKARQKMIFEVFTTIPPLSSSYTRKHKTEDCSGLKENLRKEFSKLEEILANK
    KTTFFGGSSVSMTDYLIWPWFERLEGLELTDCLDHTPKLKLWMAAMKKDPTAAALLLNVNHQRHFLELYLKNSHEACDYG
    L

    >gi|291404793|ref|XP_002718747.1| PREDICTED: glutathione S-transferase omega 2 [Oryctolagus cuniculus]
    MSKDATRTLGKGSCPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKGIRHEVININLKNKPEWYYTKHPYGQIPVLENSQC
    QLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECSDLKTALRQEFCNLEEILDY
    QNTTFFGGDCISMIDYLLWPWFERLDVYGIADCVNHTPTLRLWIAAMKQDPTVCALLIDKNIFLGFLNLYFQNNPNAFDF
    GLVC

    >gi|291404901|ref|XP_002718732.1| PREDICTED: peroxiredoxin 3-like isoform 1 [Oryctolagus cuniculus]
    MAAAVARLLRAPLARHVGAVPRGRLASAAPRPAASGTLCLTHILRSGAKLAFSTSPSHRAPAVTQPAPYFKGTAVVNGEF
    KDLSLDDFKGKYLVLFFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPGKSGGLGHMNIALLS
    DLTKQIARDYGVLLEGPGLALRGLFIIDPNGIIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPESPTIKP
    HPTASKEYFEKVNQ

    >gi|291404903|ref|XP_002718733.1| PREDICTED: peroxiredoxin 3-like isoform 2 [Oryctolagus cuniculus]
    MAAAVARLLRAPLARHVGAVPRGRLASAAPRPAASGTLCLTHILRSGAKLPAPYFKGTAVVNGEFKDLSLDDFKGKYLVL
    FFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPGKSGGLGHMNIALLSDLTKQIARDYGVLLE
    GPGLALRGLFIIDPNGIIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPESPTIKPHPTASKEYFEKVNQ

    >gi|291405421|ref|XP_002718941.1| PREDICTED: nucleoredoxin [Oryctolagus cuniculus]
    MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGAGPGPGAGAAA
    EPEPRSRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDP
    EGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAGQKFEIIFVSADR
    SEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDS
    NAVQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKVIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTIL
    DMSARAKYVMDVEEITPAIVEAFVNDFLAEKLKPEPI

    >gi|291405956|ref|XP_002719179.1| PREDICTED: hypothetical protein [Oryctolagus cuniculus]
    MGTAWALVRLRRRSGPCLPSLAQDASSPAAVQGAHRVASHAEAAAGAEPAAMSGEPGPTSAAPSPGEVEPGSGVRIVVEY
    CEP
    CGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGEPLEKITNSR
    PPCTIL

    >gi|291406711|ref|XP_002719675.1| PREDICTED: glutathione transferase zeta 1 [Oryctolagus cuniculus]
    MQAAKPILYSYFRSSCSWRVRIALVLKGINYETVPIDLIKDGGQQFSEEFRALNPMMQVPTLKIDGLILGQSLAIIEYLE
    ETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEQNQLPWAQKVISSGFKALEQILQSTAGKYCVGDEVS
    MADLCLVPQVANAERYKVDLSPYPTINRINKTLLALEAFQVTHPCRQPDTPAELRA

    >gi|291406767|ref|XP_002719694.1| PREDICTED: iron-sulfur cluster assembly 2 homolog [Oryctolagus cuniculus]
    MAAARVLSLAASALKAVARWPRGRLLAASPGLQARREASSSGPEAGEEQIRLTDSCVQRLLEITEGSEFLRLEVEGGGCS
    GFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSVKL

    >gi|291406884|ref|XP_002719772.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3, partial [Oryctolagus cuniculus]
    MGGCFSKPKPVELKIEVVLPEKERSKEELVASGKGSPRTYQGNGTARHFHAEEHLPAPHPYPGPQDCVEAAVCHVKDLEN
    SQMREVELGWGKVLLVKDGGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEK
    EKVYVRASKQALQMQRRTKMMAKCISPSAGHSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSK
    SLDAQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTP
    EDANRV

    >gi|291407221|ref|XP_002720008.1| PREDICTED: peroxiredoxin 4 [Oryctolagus cuniculus]
    MDHRSRPRSIGLNRILGTQSRAPRAPLPLHVEQEAREGEECEREPPRQRTPTYSYGPPESEELPDLVMVSKPAPYWEGTA
    VINGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPI
    KIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPG
    SETIIPDPAGKLKYFDKLN

    >gi|126722847|ref|NP_001075840.1| ubiquitin-like modifier-activating enzyme 1 [Oryctolagus cuniculus]
    MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLPQVPSAPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGL
    RGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQ
    VVVLTNSPLEDQLRVGEFCHSRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSTMVSMVTKDNPGVVTCLDEARH
    GFESGDFVSFSEVQGMTELNGNQPIEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLSASLAEPDFVMTDF
    AKFSRPAQLHIGFQALHKFCAQHSRPPRPRNEEDAAELVTLARAVNSKASSAVQQDSLDEDLIRNLAFVAAGDLAPINAF
    IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKESLTEDKCLPRQNRYDGQVAVFGSDLQEKLGRQKYFLVGAGAIG
    CELLKNFAMIGLGCGENGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVHQMNPHIRVTSHQNRVGPDTERIY
    DDDFFQTLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQLPQSWADCVTWACHHWHTQYSN
    NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVSNPLHLDYVMAAANLFAQTYGLAGSQDRAAVATLLQSVQVPEFT
    PKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPPADR
    HKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRHLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
    QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCC
    NDESGEDVEVPYVRYTIR

    >gi|291407892|ref|XP_002720270.1| PREDICTED: magnesium transporter 1 [Oryctolagus cuniculus]
    MPHNGISHVSKEHPLNLLEMAFSNLDPGTGCDHCYQGVIASILFRDYRKGKGPVCCSHAPPSGPVRGKFSLAKGRATNMA
    APRWFWCASATMAVALLLIYEVPLASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQ
    LHRQ
    CVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFS
    AEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGP
    PYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIALVVLFFSWMLSIFR
    SKYHGYPYRFHNPLP

    >gi|291407896|ref|XP_002720177.1| PREDICTED: ATPase, Cu++ transporting, alpha polypeptide-like [Oryctolagus cuniculus]
    MDSNMNVHSITISVEGMTCNSCVRTIEQQIEKVNGVHHIKVSLEEKNATIIYDPELQTPKTLQEAINDMGFDAILHNANP
    LLVSTDTVFLTVTSSLAPPWDHIQSILLKTKGVTDIKISPQQRTAVVTIIPSIVNANQIVEQVPDLSLDTGALDRKSGSE
    DHSMAQAGEVMMKMKVEGMT
    CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLITAEEIKKQIEAAGFPAFIKKQ
    PKYLKLGAIDVERLKNTPVKSPEGSQQRTLSHTSDSTTTFLIDGMHCKSCVSNIESALSTLQYVSNIVVSLENRSAIVKY
    NASLVTPETLRKAIEAVSPGQYRVSIASEVESSPNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISK
    KPGVKSIRVSLANNSGTIEYDPLLTSPETLREAIEDMGFDATLSDMNEPLVVIAQPSSDMPLLTSTNEFYPKMMTPIHDK
    EEAKTSSKCYIQVTGMT
    CASCVANIERNLRREEGIYSVLVALMAGKAEIRYNPTVIQPPMIAEFIRDLGFGATVIESASE
    GDGVLELVVRGMT
    CASCVHKIESTLTKHRGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSSSHL
    DHKREIRQWRRSFLVSLFFCIPVMGLMIYMMIMDHHLATLHHHQNISNEEMINIHSSMFLERQIMPGLSIMNLLSFLLCV
    PVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFSYSLVILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIA
    KGKTSEALAKLISLQATEATVVTLGSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPV
    AKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLVVWIIIGF
    LNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVV
    VFDKTGTITHGTPVVNQVKVLVESNKISRNKILAIVGTAESNSEHPLGAAITKYCKQELDTETLGTCIDFQVVPGCGISC
    KVTNIEGLLRKNNWKIEENNIKNASLVQIDASNEQSSTSSSMIIEVQNSNALNSQQYKVLIGNREWMIRNGLVIGNDVDA
    SMTEHERKGRTAVLVAVDDELCSLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSH
    KVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVF
    ALIYNLVGIPIAAGVFMPVGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHAQSQIGQKSPSEISVHVGID
    DTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTTL

    >gi|291408521|ref|XP_002720587.1| PREDICTED: Thioredoxin-like [Oryctolagus cuniculus]
    MVKQIESKSAFQEVLDSAGDKLVVVDFSATWCGPCKMIKPFFHALSEKFNNVVFIEVDVDDCQDIAAECEVKCMPTFQFF
    KKGQKVGEFSGANKEKLEATINELL

    >gi|291408586|ref|XP_002720591.1| PREDICTED: electron-transferring-flavoprotein dehydrogenase [Oryctolagus cuniculus]
    MLAPLARRSCPAFLCIHALKIKKNCLPLCTSRWTSTSVIPRITTHYTVYPREKDKRWEGVNMERFAEEADVVIVGAGPAG
    LSAAVRLKQLAAEQEKDIRVCLVEKAAQIGAHTLSGA
    CLDPGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPI
    LPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAK
    VTVFAEGCHGHLAKQLFKKFDLRANCEPQTYGIGLKELWLIDEKKWRPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVA
    LGLVVGLDYQNPYLSPFREFQRWKHHPSIQPTLEGGKRIAYGARALNEGGLQSIPKLTFPGGLLIGCSPGFMNVPKIKGS
    HTAMKSGILAAESIFNQLTTENLQSKTIGLHVTEYEDNLKKSWVWKELYAVRNIRPSCHGVLGVYGGMIYTGIFYWIFRG
    MEPWTLKHKGSDSDKLKPAKDCTPIEYPKPDGRISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLSIYDGPEQRF
    CPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM

    >gi|291408803|ref|XP_002720700.1| PREDICTED: magnesium transporter 1-like [Oryctolagus cuniculus]
    MLAIKVNRLTKQAKKDGILRMSNTMFYYFVLEAPRNYSVVVLFTVLDQFRTCTMCAPAAKEFQILVNSWRHPSAFTNRVF
    FALVDYDESPEIFQMFQLRTVPKLFHFSAERTFAPDDISHVSEMGITAEQMAEWVAKKTKVSINVRRPPRYGRLAVGVLV
    SLLGGSALLWSWSRKLVHSRVLWAVLALSFVIVMTSGQMWTRIKGASYGERNYHTGRIHYIARMNSLQFIPETYIISLFH
    ACITLGVVLLDKAATCRMGAIKTTMLCVTGMCLVVIFLGWLLSVFKFKQPRYPYGFSLG

    >gi|291408995|ref|XP_002720800.1| PREDICTED: ATPase, Cu++ transporting, beta polypeptide [Oryctolagus cuniculus]
    MEKAGGEVPQNLKQSFLATLSDPEVTLLSVHKRWSLKRSPRARGSARMVSLEEEGSFQSEKAEFPQRVLNGTRILSKLSL
    PARAWEAAMKQSFAFDNVGYEGGLDSMCPSPTTTGIVSILGMTCQSCVKSIEDRISSLKGIVSIKISLEQASATVKYVPS
    VMSLQQVCHHIGDMGYEASVTEGKAASWPSRSLPAQEAVIKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGNQEAVI
    TYQPYLIQPEDLRDHVNDMGFEATIKNKMAPLSLGPIDIERLQNTNLKRPSVSTNQNLNNSETSAHPGSQVATLQLRVDG
    MH
    CKSCVLNIEGNIGQLPGVQNIQVFLENRTAQVQYDPSHVTPESLQKAIEALPPGNFKVSLPDGAEERGTENRSSNGHS
    PVSPQRGQVQSTCSTLVLTIVGMTCASCVQSIEGVISQREGVQRISVSLAEGTGTVLYDPSVISPEELRAAVEDMGFEAS
    VIPENGSTNHTGNHGAENSMAWIKSGAPVSVPDMVPHTGELPKNHHPGRSSKSPQSTGMVVPQKCFLQIRGMT
    CASCVSN
    IERNLQKEDGILSVLVALMAGKAEIKYNPEVIQPPEIAQLIQDLGFEATVMEDATGSDGDIELIITGMT
    CASCVHNIESN
    LTRTNGITYASVALATSKAHVKFDPEIIGPRDIVKIIEEIGFHASLAQRNPNAHHLDHKVEIKQWKKSFLCSLVFGIPVM
    GLMIYMLIPSNQPHESMILDHNIIPGLSILNLIFFILCTFVQFLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSL
    IILVVAVAEQAERSPVTFFDTPPMLFVFISLGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELV
    QRGDIIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLITATHVGNDTTLAQIVRLVEE
    AQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPNPNKHISQTEIILRFAFQTSITVLCIACPC
    SLGLATPTAVMVGTGVAAQHGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVLRVLLLVDMATLPLRKVLAMVGTAEA
    SSEHPLGIAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGLLAHSERLLSEQSGHVNRLGSLPAEKDAASQTFC
    VLIGNREWMRRNGLTISSDINDAMTDHEMKGQTAILVAIDGVLCGMIAIADSVKPEAALAVHTLKSMGVDVVLITGDNRK
    TARAIATQVGINKVFAEVLPSHKVAKVQELQNEGKKVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLL
    DVVASIHLSKRTVRRIRVNLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDVERYE
    AQAHGRMKPLTASQVSVHVGMDDRRRGDSPRATSWDQVSYVSQVSLSSLTSDRLSRHSPAVDDAGDKWSLLLNDRDEEQY
    I

    >gi|291409168|ref|XP_002720892.1| PREDICTED: anterior gradient homolog 3-like [Oryctolagus cuniculus]
    MLHYALALCLLLITVSSNLAIAIKKGKRPPQTLSRGWGDDITWVQTYEEGLFHAHKSNKPLMVIHHLEDCQYCQALKKVF
    ARSEEIQEMAQNNFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADLTGRYSNRLYTYEPQDLPILIENMKKALRL
    IQSEL

    >gi|291409170|ref|XP_002720893.1| PREDICTED: anterior gradient 2 homolog [Oryctolagus cuniculus]
    MEKISLSAVLLLVALSYTLAKDTTVKPGAKKDAKDSQPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDE
    CPHSQALKKVFAENKDIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPSDINLL
    LDNMKKARKLLKTEL

    >gi|291409453|ref|XP_002721019.1| PREDICTED: hypothetical protein [Oryctolagus cuniculus]
    MSFLQDPSFFTMGMWSIGAGALGAAAVALLLANTDMFLSKPQKAALEYLEDIDLKTLGKEPRTFKAKELWEKNGAVIMAV
    RRPG
    CFLCREEAADLSSLKPKLDELGVPLYAVVKEDIRSEVKNFQPYFKGEIFLDEKKRFYGPQKRKMLFMGFVRLGVWY
    SFFRAWNGGFSGNLEGEGVILGGVFVMGSGKQGVLLEHREKEFGDKVNLPSVLEAAKKITSQTSASEKK

    >gi|126723068|ref|NP_001075473.1| chloride intracellular channel protein 6 [Oryctolagus cuniculus]
    MAETAEPEGGAPSPQGPPEGSALLEERPGEPDPAGPEASEGAAKAPSGEGAGAAAKAGATEEASGGRDGEGAGEQAPDAG
    TESGGETPDAKGAQIEAEGAPEGTKAPQLGEEGSGGKQVEESGPDCELRGEAAREAEGQAAAPAAPGAQEEAVPGDSVDA
    EGSIDAGGSVDAAGSVDAGGSIDAGGSMDAGGSVDAGGSIDTGGSVDAAGSVDAGGSIDTGRNVDAGGSIDAGGSVDAGG
    SMDAEGPAGGAHGAGGEPQDLGAGSPQPRSEAVEVAAAENEGHSPGESVEDAAAEEAAGTREPEGSEDAAGEDGDQGRPQ
    EETEQQAERQEPGPETQSEEEERPPDRSPDGEAAASTRAAQPEAELSNHLAAEEGGQRGEGPANGRGEDGEASEEGDPGQ
    EHDITLFVKAGYDGESIGN
    CPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGDVKTDVNKIEEFL
    EEKLAPPRYPKLATQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKSLLKALKKLDAYLNSPLPDEVDAYSTEDVAVSG
    RKFLDGDDLTLADCNLLPKLHIIKIVAKKYRDFEFPPEMTGIWRYLNNAYARDEFINTCPADQEIEHAYSDVAKRMK

    >gi|291412321|ref|XP_002722431.1| PREDICTED: glutaredoxin 3 [Oryctolagus cuniculus]
    MRPRARVRAAPRARRAHGHAPFRTCPVRANEEAEGVGRRGQHVSLRGGGRRQDGERPGGALLRLRLEGRGSAGRAVGETE
    ARPAAEGLPASAAVVPRGSRTQTPLFDGFSRGGPWAEPGRQRAPERPSGVSRKPDLEQSSYDWNLRSRVDAARKLQLKAA
    HRPAPPKCVLLMDRSLLVVHFWAPWAPQ
    CAQMNDVMAELAKEHLQVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKI
    DRLDGAHAPELTRKVERHACSGSFPPSAAEQPKEELSVRLKKLTHAAPCMLFMKGTPQEPR
    CGFSKQMVEILHKHNIQFS
    SFDIFSDEEVRQGLKAYSNWPTYPQLYVSGELIGGLDIIKELEASDELDTICPKAPKLEERLKVLTNQAAVMLFMKGNKQ
    EAK
    CGFSKQILEILNSTGIEYETFDILEDEEVRQGLKAYSSWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

    >gi|291412325|ref|XP_002722433.1| PREDICTED: 0(6)-methylguanine-DNA methyltransferase=DNA-repair methyltransferase-like [Oryctolagus cuniculus]
    MTHDELGGMDKTCDLKYKTLASPLGAIELSGCERGLHSIRLPGKKTPEADPAEAPATPEGLGGPKRTPEPLVQCEAWLHA
    YFHEPSAIPELPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVVSYQQLAALAGNPKAARAVGGAMRSNPVPILIP
    CHRV
    ICSSGAVGNYSGGGLAVKEWLLAHEGARK

    >gi|291412335|ref|XP_002722440.1| PREDICTED: protein disulfide isomerase A6 [Oryctolagus cuniculus]
    MRGENTPDGPLPEETMRSPRGHPGSERDRNAQATWPRPQRPRLPPPPPRAGRGGGGAAELRRRRQGRQAPALGMARLGLG
    LVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPW
    CGHCQRLTPEWKKAASALKDVVKVGAVDADKHQ
    ALGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGSHSSGRQGRGDSASKKDVIELTD
    DSFDENVLESDDIWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQMLSSRYGIRGFPTIKIFQKGE
    SPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIVNEDVAKRACEEHQLCIVAVLPHILDTGAAGRNSYLDVLLKLADKY
    KKKMWGWLWTEAGAQAELESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGVFPAIS
    VRDPWDGQDGVLPVEDDIDLSDVELDDLEKDEL

    >gi|291412946|ref|XP_002722736.1| PREDICTED: molybdenum cofactor synthesis 3 [Oryctolagus cuniculus]
    MAAREEVLALQAQVAQREEELESLKQRLAAALAAEREPESEQPAPVSPLPPRASLSRDEILRYSRQLVLPELGVQGQLRL
    AAASVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHDEALAGQAKVFSAAASLRCLNSAVECVPYAQA
    LTAATALDLVRRYDVVADCSDNAPTRYLVSDACVLAGRPLVSASALRFEGQITVYHYGGGPCYRCVFPQPPPADTVTS
    CA
    DGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGRLLLFDALSGCFRCVRLRGRRPDCAACGERPTVTALQDYEALCGSSA
    TEKCRSLQLLGPEERISVTDYKRLLDAGAPHLLLDVRPRVEVDICRLPHALHVPLTLLERRDAESLRLLGDAIREQGRAV
    PEGAALRVYVICKLGNDSQKAVRLLQALPRVPELASLRVQDVAGGLMAWAAKVDGSFPQY

    >gi|291413075|ref|XP_002722800.1| PREDICTED: thioredoxin reductase 2-like [Oryctolagus cuniculus]
    MRVAGQPTYDLLVIGGGSGGLACAKEAAQLGRKVAVLDYVEPSPRGTRWGLGGTCVNVGCIPKKLMHQAALLGGAIRDAG
    RYGWEVAQPARHDWSKMAEAIQNHVRSLNWGHRVQLQERKVKYLNVKARFIDKHTVLGVSKDKKETLLSADHIVIATGGR
    PRYPTLIQGASEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGLGLDTTIMIRSIPLRGFDQQMASLVTDHMASH
    GTRILRGCTPSRVARLPDGRLQVTWEDRTCGKEDSGVFNTVLWAIGRVPETRGLNLEGAGVETNPESQKILVDARDTTSV
    PHIYAIGDVAEGRPELTPTAIMAGKLLAQRLFGGSSDLMDYSNVPTTVFTPLEYGCVGLSEEEAVARHGQEQIEVYHAYY
    KPLEFTVAEQDASQCYIKMVCLRQPPQPVLGLHFLGPNAGEVTQGFALGIKCGASYEQVIRTVGIHPTCAEEMVKLRISK
    RSGLDPTVTGC

    >gi|291414862|ref|XP_002723675.1| PREDICTED: glutaredoxin 5-like [Oryctolagus cuniculus]
    MSGSLGRAAAALLRWGRGGGLWSPGVRTAGSGAGGGSGSGSTEHLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLH
    GVRDYAAYNVLDDPDLRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGVRSALLGEDKDQDSK

    >gi|291390607|ref|XP_002711799.1| PREDICTED: thioredoxin domain containing 11 [Oryctolagus cuniculus]
    MSECGGRGGGSSSSDDAEDEGGGGPAGSGSLSPAPAGASSAGRLRRGLRGASLMARRRPELLCGAVALGCAVLLALKFTC
    SRAKDVIIPAKPPVSFFSSRSPVLDLFQGQLDYAEHIRQDSEVVLLFFYAPWCGQSIAARAEIEQAAIRLSDQVLFVAIN
    CWWNQGKCRKQKHFFYFPVIYLYHRSFGPIEYKGPMSAVYIEKFVRRVMRPLLYIPSQSELLDFLSNHEPGVLGYFEFSG
    SPQPPGYLTFFTSALHSLKKDYLGTVRFGVITNKHLAKLVSLVHSGSVYLHRHFNTSLVFPREVMNYTAENIYKWASENR
    ETLFRWLRPHGGKSLLLNNELKKGPALFLFIPFNPLAETHPLLDEITEVALEYNNCRGDHVVQRLLQHLRRVDAPVLESL
    SSAPQAPLADPPLMAAAPCCNTVVLPPGHALSRTHNICELCVNQSAGGVRPSSVSVPQCSFFEMAAALDSFYLKEQAFYH
    VASDSIECSNFLTSYSPFSYYTACCRTIHRGVAGFIDSEQDGVLDTPALAFSSVEEKCEGDVPSAVPHIEESRYRLPDVD
    SPGTDFTGLSCRTNKTLNIYLLDSNLFWLYAERLGAPSSSRVKEFATIVDVKEESHYVLDPKQALVKFTLESFIQNFSVL
    YSPLKRHLIGSDSAQFPSQHLITEVTTDTFWEVVLRKQDVLLLYYAPW
    CGFCPSLNHVFIQLARLLPVDMFTVARIDVSQ
    NDLPWEFMVDRLPTVLFFPCNRKDLSVKYPEDLPITLPNLLRFILHHSAPASSSQDVASPPTKDCVQSEAALQQGHISQL
    QREIQKLRAEIGSLQRAQVQVEMQLSRARRDEHRLQREQQALEQQHRLLRRHSQQLQALHEQKSRELAALARQLQELADA
    SETLLAENAWLKILVATMERKLEGQDGAEDAAALPQEGPDPPQPAGAPPPPPNVSSTLASERSNENRTE

    >gi|291415324|ref|XP_002723903.1| PREDICTED: thioredoxin-like 4A [Oryctolagus cuniculus]
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDITETVYRGARKGRGLVVSPKDYSTKYRY