Ornithorhynchus anatinus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|149636187|ref|XP_001516854.1| PREDICTED: similar to phosducin [Ornithorhynchus anatinus]
    MDETNNPSLEEDFEGQATHTGPKGVINDWRKFKLESEDSDSVPSKKEILRQLSSPHRRDNKDSRERIRRKMSVQEYELIH
    QEKEDERCLRKYRRQCMHNMHQKLSFGPKYGFLCELETGEQFLEAIEKEQKSTTVIVHIYENDVEG
    CEALNSGLACLATE
    YPTLRFCKIRASNTGAGDRFSAGVLPTLLVYKAGELLGNFINVTERLGEEFFAGDVESLLCEYGLLPERKIQTVQNANIE
    EEDTE

    >gi|149410505|ref|XP_001515290.1| PREDICTED: similar to Trx-like protein [Ornithorhynchus anatinus]
    MAAAPGLPFLLTGRLLLLLLLLLLLLAAPVRARRPGDVRAITDDNWKDLLEGEWMIEFYAPWCPACQNLQPEWENFAEWG
    EDLEVNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPRSILMSSMS
    ALFQLSMWIRHCHNYFTEDLGIPVWGSYVIFALVTLFSGLILGLIMVFVADCLCPSKRQRPQQYPYSKKIPPESTRILKK
    LEEEQEADEEDLSDDDAEKKKASNRDFSQNAVRQRTVNTPAADTS

    >gi|149412981|ref|XP_001509068.1| PREDICTED: similar to thioredoxin [Ornithorhynchus anatinus]
    MVKQIQTKEEFEAELKNAGGKLVVVDFSATWCGPCKMIKPFFHSLSEKDPDVVFLEVDVDDCQDVASQCEVKCMPTFQFY
    KNGKKVSEFSGANKEKLEATINELK

    >gi|149589559|ref|XP_001509414.1| PREDICTED: similar to LOC496089 protein, partial [Ornithorhynchus anatinus]
    SLSRSAARTVGRRIDFSNVTARAVSTCSLLVSQSAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIA
    FGDRIAEFRAINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTRQISKDYGVYLEDLGHTLRGLFIIDDKGV
    LRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|149410513|ref|XP_001515503.1| PREDICTED: similar to ERO1-like protein [Ornithorhynchus anatinus]
    MGSSLLDKFEVLKFGTSSRILCLKVSILSIKVRGQVSGYLDDCICDVETIDSFNNYKLFPRLQKLLESDYFRYYQVNLKK
    PCPFWNDISH
    CGIRDCAVKPCQSNEVPDGIKSSSYKYSEEANTLTEECEQAERLGAVDESLSEETQRAVLQWTKHDDSSD
    SFCEVDDIQSPDAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLSPLASGQGKSEENTFYSWLEGLCVE
    KRAFYKLISGLHASINIHLSARYLLQDTWLEKKWGHNITEFQQRFDAVLTEGEGPRRLKNLYFLYLIELRALSKVLPFFE
    RPDFQLFTGNKIQDTENKKLLLKILQEAKSFPLHFDENSFFSGNRKEANKLKEDFRQHFRNISRIMDCVGCFKCRLWGKL
    QTQGLGTALKILFSEKQIKNIPESGPSYGFHLTRQEIVSLFNAFGRVSTSVKELENFRNLLRDIH

    >gi|149577501|ref|XP_001515478.1| PREDICTED: similar to Protein disulfide isomerase family A, member 2, partial [Ornithorhynchus anatinus]
    MHRPGLLSLLLLVLVGVLAPGGAGEEAVGAGGPPADEEATGPGRPPADKVLEEGDILVLHRHNFDLALRAHPYLLVEFYA
    PG
    CRHCQALAPEFSKAAALLKNVSSELRLAKVDGVVEKELSEEFAVGGFPALKLFKLGNRSDPVDYL

    >gi|149632365|ref|XP_001507885.1| PREDICTED: similar to proliferation associated gene (pag) [Ornithorhynchus anatinus]
    MSAGNAKIGHPAPNFKATAVMPDGQFKEISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSERADEFKKINCQVIGASVDS
    HFCHLAWVNTPKKQGGLGPMNIPLVSDTQRTIALNYGVLKEDEGISFRGLFIIDEKGILRQITINDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVEKSKEYFSKHK

    >gi|149638626|ref|XP_001514270.1| PREDICTED: similar to Thioredoxin domain-containing protein 5
    MDPCGTGTVIPDAFQTLIPLECGHCQRLQPTWNELGDKYNKLENAKVYVAKVDCTADTEVCSAQGVRGYPTLKLFRPGQE
    AVKYQGSRDFQTLENWMLQTLSEEPSTPEPPVEPPKAPEPKQGLYELSAANFKLHTTTGNHFIKFFAPW
    CGHCKALAPTW
    EQLASIFEHSETVKIGKVDCTEHYELCSGNQVRGYPTLLWFKNGEKVDQYKGKRDLDSLKEYIDSQLQNADDAPEAPKPS
    EIPPEGAEPTQDEVNMLSLTENDFDKTVANGITFVKFYAPW
    CGHCKKLAPTWEELSKEQFPGLTDVKIAKVDCTAQHAIC
    SKFSVRGYPTLLLFRAGEMIKEHSGARDLETLHSFVLRQAKDEL

    >gi|149603793|ref|XP_001511291.1| PREDICTED: similar to cytosolic methionine-S-sulfoxide reductase [Ornithorhynchus anatinus]
    MGCFWGAERKFWQQKGVYSTHVGYAGGHTPNPTYKEVCSGKTGHAECVRVVYYPERISFEDLLRVFWENHDPTQGMRQGN
    DFGTQYRSAIFPAAAGQLEAALNSREKYQKVLTDNGFGAITTDIREGQEFYYAEEYHQQYLSKNPHGYCGLGGTGVSCPI
    GIRK

    >gi|149601897|ref|XP_001517928.1| PREDICTED: similar to PLC alpha, partial [Ornithorhynchus anatinus]
    HLXXXXWWIHNFESRVADTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANSNTCNKYGVSGYPTL
    KIFRNGEESGAYDGPRTADGIVSHLKKQAGPASIPLHSDDEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRDNYR
    FAHTGQEKLVKKYEPDGEGITLFRPSRLANKFEDNTVRYTEDKITSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIA
    YYDVDYEKNAKGSNYWRNRVMMVARKFLDAGQKLNFAVASRKTFGHELSEFGLDSTTGEVPVVAIRTAKGEKFVMQEEFS
    RDGKALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNDEDKDVLIEFYAPW
    CGHCKNLEPKYKELGEKL
    SKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKQSPKKYEGGREVSDFLSYLQREATNPPVIQEEEKPKKKKKAQ
    EDL

    >gi|149613734|ref|XP_001521529.1| PREDICTED: similar to O6-methylguanine-DNA-methyltransferase [Ornithorhynchus anatinus]
    MPMRDWPLLCISDSFTRRVLLTLLDQVKFGETVSYRQLAQLVGRDRAARAVGGAMRGNPIAIVIPCHRVILSSGEIGNYG
    GGKAAKEWLLAHERRPKTQHSRPTGSGPAPTSPDP

    >gi|149580480|ref|XP_001511499.1| PREDICTED: similar to HESB like domain containing 2 [Ornithorhynchus anatinus]
    MSASLVRATVRAVSKRKLQASRAALTLTPSAVNKIKQLLKDKPENVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQD
    GIRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

    >gi|149411058|ref|XP_001507228.1| PREDICTED: similar to Coiled-coil domain containing 23 [Ornithorhynchus anatinus]
    MSRGREGIAGRWPANPEEAGVVAVSHRAMVLSEKVSQLMEWTNKRAVIRMNGDKFRRLVKAPPRNYSVIVMFTALQPHRQ
    CVVCKQADEEYQILAHSWRFSSAFTNKIFFAMVDFDEGSDVFQLLNMNSAPTFINFPAKGKPKRGDTYELQVRGFAAEQL
    ARWIADRTDVNIRVIRPPNYAGPLMLGILLIVIGGLVYLRRSNLDFLANKNGWAFLALCFVFVMTSGQMWNHIRGPPYAH
    KNPHTGQVNYIHGSSQAQFVVETHIVLLFSLYPTAGLGVLVVSVPFACPSRLRR

    >gi|149411060|ref|XP_001507266.1| PREDICTED: similar to Claudin-19 [Ornithorhynchus anatinus]
    MSCQYSPFTKTSHGKRTNGKLDDISEMIPFFPEAAHWRNRRKGILLNKYGPKVDQMIHPGLTPIQGGCSAAIILQLACRV
    TRCPLDHWVIGMKRGIFMEIIHLAQEPEDGSGTSTGMDVRKITVAVQGMTCGSCVQAIEQRVGQANGVHCIQVSLEGKSA
    TIIYDPKLQSPESLREAIDDMGFDASLPDPNPLPVVTDTVFLTVTAPPAPPWEQLHRSLLETRGVTDAKISPQQRTAVVT
    LIPSVTSAHQITRSLPGVSLDVGTPERKAEDSNSPQVGEIMLKIKVEGMT
    CHSCTSTIEGKIGKLHGVQRIKVSLDSQEA
    TVVYQPHLITAEEITKQIEAAGFPASIRKHPKYLQLGAIDVERLKNTQVKPSGSGSPQKTTSYSSDSSTFVVEGMHCKSC
    VLNIEGSLSALPSVHSAVVSLENKCAVVKYNPNLIAPDALRKAIEAVSPGQFRVSLARENTSDLNTPSSPSHDQGALNST
    GQPLTQETVIYIGGMTCNSCVQSIEGVVSKKPGVRSIRISLADHNGVVEFDPVLTSPETLREVIEDMGFDASLSEMMEPV
    VVITQPSLDLPLLPSSPEPFSKTTTPVREKEEGTTPSKCYIQVTGMT
    CASCVANIERNLRREEGIYSVLVALMAGKAEVR
    YNPAVVQPPVIAEFIRELGFGATVMENAGEGDGILELMVRGMT
    CASCVHKIESTLMKTRGILYSSVALATNKAHVKYDPE
    IVGPRDIIRTIENLGFEACLVKKDRSASHLDHKREIRQWRRSFLVSLFFCVPVMGLMIYMMAMDHHLADYHHQHRNLTQE
    EMADYQSSMFLERQILPGLSLMNLLSLLLCIPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFVYSFVILLVAMA
    ERAKVNPVTFFDTPPMLFVFIALGRWLEHVAKGKTSEALAKLISLQATEATIVTLDSENVLLSEEQVDVELVQRGDIVRV
    VPGGKFPVDGRVIEGHSMVDESLITGEAMPVTKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPI
    QQFADKLSGYFVPFIVTISIITLLVWIVIGFVNFEIVENYFPGYNTSISRTEVIIRFAFQASITVLCIACPCSLGLATPT
    AVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNHVKVLVESNRMSRNKILAIVGTAESNSEHPLGA
    AVTKYCKQELGTETLGTCTDFQVVPGCGISCKVSNIEALLTKSNWKIEEKNLKNASLVQIDASPEQPSPSSLIIDAPPLS
    SLHPQKFTVLIGNREWMNRNGLVVKNEVDSAMIEHERKGRTAILVAIDGTLCGLIAIADTVKPEAELAVHTLKSMGLEVV
    LMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKQVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADV
    VLIRNDLLDVVASIDLSRKTVRRIRINFIFALIYNLVGVPIAAGVFMPVGLVLQPWMGSAAMAASSVSVVLSSLLLKLYR
    KPTYENYELRAHRQLGQKSPSEISVHVGIDDASRDAPNLGVLDRIVNYSRASINSLLSDKRSLSSIVLSEPDKHSLLVGD
    FREEDDTNL

    >gi|149631942|ref|XP_001510205.1| PREDICTED: similar to MGC78790 protein, partial [Ornithorhynchus anatinus]
    MVSKKKEIPLQVTINNQELWEEMLCSKGLTVVDVYQRWCGPCKTVVSLFKKIKNELGDDLLHFAVAEADCIAALEKYRGK
    CEPTFLFYAGGELVTVVRGANAPVLQRTIVDQLGAEKKVLDQEAERKVIKDEALWDKKETVLDDRDFGEQDEAVSCEKSC
    TLAIIKPDAIAHGKMDEIITKIQEAGFAILAHEERIMTESEAKEFYQHKAKEETFEKLVEFMSSGPCHLLIISKPECDED
    VVTAWRDFIGPSEIEIAKREHPGSLRAQYGTEMPFNAVHGSENQEQAAKELAYFFPGFKVSDETAETKQRKTPQRTLALI
    RPGILKDKK

    >gi|149593437|ref|XP_001517210.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]
    ETVSDNCVVIFSKTSCSYCDMAKRLFRDMNVNYTAVELDTHEYGSQFQDALHRMTGAGTVPRIFVNGAFVGGATDTRRLH
    REGKLLPLVQRCRADTKSGEFGRAT

    >gi|149607111|ref|XP_001517226.1| PREDICTED: similar to prolyl 4-hydroxylase beta-subunit [Ornithorhynchus anatinus]
    MPTGGLLCLALALALAGGVRADAPEEEDHVLVLKKSNFEEALAAHKFLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSE
    IRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAAATLPDVAAAEALVESSDVA
    VVGFFKDAGSEPAKQFLAAAESIDDIPFGITSGGEVFAKYQLDEDGVVLFKKFDEGRNSFSGEVTKENLSNFIKQNQLPL
    VIEFTEQTAPKIFGGEIKTHILLFLPKSVADYDGKLNNFKKAAGSFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVR
    LITLEEEMTKYKPESDELTADKIKEFCDRFLEGKVKPHLMSQDLPADWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPW
    CGHCKQLAPIWDKLGEAFKDHENVVIAKMDSTANEVEAVKVHSFPTLKFFPASAEKTVIDYNGERTLEGFTKFLESGGQD
    GAADDDDLEDLEEAEEPDLEEDDDQKNLRDEL

    >gi|149428152|ref|XP_001511104.1| PREDICTED: similar to interferon, gamma-inducible protein 30 [Ornithorhynchus anatinus]
    MGSASPLLLLLLPVLCYAADDESLHTCTYPPYRWCSSWKIAIVCKVEQQCPVLFQPPTSKNAPPVSVSLFYESLCPACRN
    FLTLQLFPTWLMLFEIMNVTLVPYGNAQETNVSGKWEFTCQHGEDECLLNMVETCVMDTVKDPSDAFAIIFCMESSSSIK
    NSLDSCLKIYSPTTSPDDIMKCTKSDQGNKLMHQNAQLTDALEPPHKYVPWIVINGQHTDELQAQAQEGLFNLVCKLYKG
    QKPSACLSNSSSLHLNNLCLK

    >gi|149632933|ref|XP_001506137.1| PREDICTED: similar to Trx2 [Ornithorhynchus anatinus]
    MESRGHTPRVMINGSSPIHRPCRGPHLNSGPHDFERENSGGGIDSSAGGLKRHHWDGVVAAGAQAAQDDVWRAGVSGGYR
    RNLNQNPGNGCVPRSGRGTPKIGSGQTHRRLPPPCRKPSHSNDLLLVPQARHPPPVYGANFPKLERGGTFAEWIGRARGE
    LFLSGTGSRSQARVMLDRTPWIHKEVPPRAGVVQSGGVKEALGRVTCDLEADPSEKPPRSSMLRCTLLHGFPDWPALRHY
    ALRLVAPRLPRPLIGRPSMTTPSDGPSLDCPAPGLAAPRRPRPPDHPAPRLARPRRPCAPIGRPSVTPSPDWPALDDHAL
    RWAAPRWLIPQWALLYSLNAHCMAQRAVLRRVLAAPWSERAGPLLARARPGPAVPPPAARALLLRPGPPAPRLSARTFYN
    MVPAVTFHIQDGPDFENRVVKSQTPVIVDFHAQW
    CGPCKILGPRLEKMVAKQEGKVLMAKVDIDDNTDLAIEYEVSAVPT
    VLAIKNGDVVDKFVGIKDDDQLEAFLKKLIGC

    >gi|149437010|ref|XP_001507943.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MSVRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLEALQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|149566337|ref|XP_001508352.1| PREDICTED: similar to secreted cement gland protein XAG-2 homolog [Ornithorhynchus anatinus]
    MEKIFLSVFLVLVAVSHTLAKDISSKTGGKKEVKNTHTKFPQTLSRGWGDNLFWTQTYEEALYKSKSSNKPLMIIHHLEE
    CPHSQALKKVFAESNEIQKMAEKFVLLNLIYETTDKHLSPDGQYVPRIMFIDPSLTVRADITGRYSNRLYAYEPSDAALL
    LDNMKKALKLLKTEL

    >gi|149430500|ref|XP_001521748.1| PREDICTED: similar to protein disulfide isomerase [Ornithorhynchus anatinus]
    MPIPHLVTSASAQPIPGKDSGKEEGGRPGREETQTRPSSVEPGGPEPDAEDAPWCTHCREMAPAWEELADKYREQEDILI
    AELDSTANELEDFTISGFPTLKYFPAGPGRKVEVRARVRGGQREA

    >gi|149638241|ref|XP_001512742.1| PREDICTED: similar to ERO1-like beta (S. cerevisiae) [Ornithorhynchus anatinus]
    MTMTWMLLEPPRPRPLFWRPAWWAGIGGRGARGGRPGPETTSPVVPRPCRGLQVPSCPRAARKPGGTNRPAPRGGTTSPV
    VPRATPKPWEGANRPMRGDYKSRGAPRDAEALGGGQPPHEGGLQVPSCPARLRSPGGNRGKAVSYQKPRRLFKSFRQPTL
    LPSIPEERRKGRGGTLPGESRSEEKWRNGASFPSVSDTERTKTCILTGSAPCSTLNTRGRPLPRALIFHSSRAVRGVKVT
    YQGGSTIRLAGVLDDCLCDIESIDSFNTYKIFPKMQRLQERDYFRYYKVNLKRPCPFWADDGH
    CSIKDCHVEPCPESKVP
    VGIKAGSSNKYSKAANNTKEMEDCEQANKLGAVNSTLSNQSKEAFIDWARYDDSQDHFCELDDETSPSAQYVDLLLNPER
    YTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGKDDGESFYTWLEGLCLEKRVFYKLISGLHASINLHLCANYL
    LEETWGKPSWGPNVREFTRRFVDTKGEGPRRLKNLYFLYLIELRALSKVAPYFERSIVDLYTGNMEEDAQTKTLLLDIFQ
    DTKSFPMHFDEKSMFAGEKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEIQKLPENSP
    SKGFQLTRQEIVALINAFGRLSTSIRELQNFKVLLQHSR

    >gi|149616227|ref|XP_001514389.1| PREDICTED: similar to Chloride intracellular channel 3, partial [Ornithorhynchus anatinus]
    MPRPGQRDFTSRRSLAPYALADPRLLALQASEDGESVGNCPFCQRLFMILLLKGVPFTLTTVDTKRSLDVLKDFAPGSQL
    PILLYDGEARTDTLQIEEFLEETLGPPNFPSLVPRYKESNTAGNDVFHKFSAFIKNPVPSQDEALHRMLLRALLKLDGYL
    SSPLEHELEREPRLTQSRRRFLDGDRLKPAGCGGKRGTGPNKDCQLPLDQKLPGLQEYAACQSHAFLKGIGAFITGTDEN
    KNRLVAGGERARTVLFRACGFGAAFALQKLLNRKLPYPMQWTVLLAVGGCPLGGGRWRPRLPGRR

    >gi|149642051|ref|XP_001515043.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]
    DPNADTEWNDILRKKGILPSKESLKELEKKEDEEEERRILQQSVVKTYEDMTLEELEENEDEFNEEDEHAIEMYRQQRLA
    EWKAKQLKNKFGEVLEISGKDYVQEVTKAGKGLWVVLHLYKQGIPL
    CSLINQHFSALARKFPDVKFVKAISTTCIPNYPD
    RNLPTVFVYLEGDIKAQFIGPLVFGGMNLTKD

    >gi|149634902|ref|XP_001509530.1| PREDICTED: similar to Chain A, Crystal Structure Of Soluble Form Of Clic4 [Ornithorhynchus anatinus]
    MTPVAILGFLGGLSCCLNPEFGPRAGEEEGCEPEAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA
    PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAFIKNSRPEANEGLERNLLKTLQK
    LDEYLNSPLPDEIDENSMEDIKVSSRKFLDGNEMTLADCNLLPKLHIVKVSLAGLGRRSRTVHQIRLH

    >gi|149639745|ref|XP_001515735.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 [Ornithorhynchus anatinus]
    MTSLCVILINLVALVCTDQDYYGLLGVSKEANSREIRQAFKKLALKLHPDKNQNDPNAHENFLKINRAYEVLKDEDLRKK
    YDKYGEKGLEDNQQGGQYESWNFYRYDFGIYDDDPEIITLDRGEFDAAVNSGELWFVNFYSPR
    CSHCHDLAPTWRDFAKD
    MDGLIRIGAVNCGDNRVLCRMKGINSYPSLYIFKSGTNPVKYYGDRTKENLVSFAMQYVTTTVTELWAGNFVNAIQTAFA
    SGVGWLITFCSEGGDCLSSQTRLKLAGMLDGLVNVGWMDCATQGELCDNLDITSSTTAYFPPGATLTNKEKGSVLFLNSL
    DSKEIYLEIMKHLPDFELISAGSFEDRLAHHRWLLFFQFGQSENSDGHELKKLKNLLRKEHIQVGKFDCLSAPDICSNLY
    VHQPCLAVFKGKGTEDYEIHHGKNILYDVLAFAKESVNSHVITLGPQNFPGKEKEPWLVDFFAPW
    CPPCRALLPELRKAS
    KHLNGQLKFGTLDCTVHEGLCNMYNIRAYPTTVVFNQSNIHEYEGHHSAEQILEFVEDLMNPSVVSLTPESFVELVKRRK
    RDEMWLVDFYAPW
    CGPCQALMPEWKRMARMINGLINVGSVDCQKHYSLCHEENVQGYPEIRLFPQKSNTAHRYYSYNGWH
    RDAYSLRGWALGYLPQVSIELTPQTFNEKVLQGKDHWVVDFYAPW
    CGPCKNFAPEFELLARTVKGKVRAGKVDCQAHGNT
    CQKAGVRAYPTVKFYPYQGEKKSAHGEHIDSRDAKDIANLLTAKLAALQSKGKKKSSSRNKEQDLRRCDAGESCGLEDLK
    REDCQVGKGKESEAEELILKDDCKLFEGRDRLLTSPDAQYSAPYSAFDYFRLTCRNQKLVPGENRGGEFSFSPKVKGRFP
    KKKPYTLPTSEPTEKPRDREDECLLSVWKKNASWQKTRDLEGFPALKLAAISEAAEMDLNHPTDQSRGENVPFPGFFRLR
    SAHTRPAWVSVNSGSHGFSETVSRVAFAQSRGNAIAFSSRLPEGPR

    >gi|149633467|ref|XP_001511421.1| PREDICTED: similar to chloride channel protein [Ornithorhynchus anatinus]
    MTDSASANGEGKDPEIELFVKIYRKRVGRQFTSLRGSDSRVFCQSVFARRYLLILRLGRSDIQEQGALPGRGADGVKGEG
    IVSLLEMPLRAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEF
    LEETLAPPKYPKLAAKYRESNTAGIDIFSKFSAYIKNTKQQENANLERGLTKALKKLDDYLNTPLPDEIDANSRGDEEKV
    SRRKFLDGEELTLADCNLLPKLHVVKIVAKKYRNYEIPAEMTGLWRYLKNAYARDEFTNTCAADKEIEGAYADVAKRLSR
    S

    >gi|149637792|ref|XP_001512782.1| PREDICTED: similar to LOC733408 protein [Ornithorhynchus anatinus]
    MERLLRAEHRSERLGEGRPTGSDCEPHNLLAEKVEQLMEWSSRRSVIRMNGDKFRRFLKAPPRNYSVIVMFTALQPQRQC
    SVCRQANEEYQVLANSWRYSSAFSNRLFFTIVDYDEGADVFQQLNMNSAPTFMHFPPKGKPKRADTFDLQRIGFAAEQMA
    KWIADRTDVHIRVFRPPNYSGNIALALLVSLEDGLLYLGEEQLEILLQQHGDGPMTTLCVVFAMTSGQMWNHIRGPPYAH
    KNPQNGQVSYIHGSSQAQFVAESHIILLLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYH
    GYPYSTVIPEDAELKGRGGWKGKWLQLFLPSKQSLSKPPLRELTAASRAGGTTFGRQPPWSAARPTVGFYQGNRTPLPTR
    FKWKTRISTSRRYLGKCGVGDGGDPGSYLDLSSDAPSHDSVDPSISGVYRALLADHSLLSNRPRTSLL

    >gi|149636374|ref|XP_001516346.1| PREDICTED: similar to quiescin [Ornithorhynchus anatinus]
    MLNSRSAEIFALFFRHNSVDFGKRFELPELDVNEYTEIETVGSKRLEEINSFFTKNRDQFLALIFEKKGSFVGREVTLDL
    SQYEGIAVRRVLDTETVVIHKYRVTSFPSCYLLSRNSSISRVPVLMETRSFYTAYLQRLPGVTKGPYRPTVSPASQETTT
    PIVWRSADSSKVYMADLESSLHYILRLEVGKYPVLTGERLEALKSFVAVLAKYFPGRPLVQNFLQELNKWLKDQRRQKIL
    YSTFEAVLTRRKEGNVLTNKVTWVGCQGSKPQFRGFPCSLWILFHFLTVQAAQHTKVSPAAPVHADPQEVLSAIRGYVRF
    FFG
    CRDCAAHFEEMAAASMDRVKSQDEAILWLWSRHNQVNSRLAGAPSEDPRFPKIQWPPRSLCAPCHNELRGEPVWDLG
    AILNFFKAHFSPGNIASDYAQPLPARGRRHSVGERERKEMEEDLTTATQAWSPSHTEKPEGTFQTEEGREPVMERSVLGT
    ERRGSHQPQRPRIIRMSTKAQEEEEEEEIVDLDAFTRDLYKRETQPGASVMTLPRQQLPQGRRLSKRDTVPLLLEGEGEE
    EEEKSLLKYAAALKRLKQQGQGAKQLASILEGKEGVKAPLGGLWLRLLGGDFSLLDISLCIGLYFLSSMCLLGMYAYFRL
    RMRVRKGRASYPLSVSCRD

    >gi|149635872|ref|XP_001513328.1| PREDICTED: similar to ATPase, Cu++ transporting, beta polypeptide [Ornithorhynchus anatinus]
    MVARDRVSVATSNDPGVTLVSIHRRPSLSSGSPPPDPSQASKSSSPGNTDRFPPNAGNGAPGIKCQQELTIGCKADRDQL
    FLEESVLSAGTLMDSIREVNLATSSNQEELLRIDIFLDEILVTALPKVSFPARVPKQSFAFDNVGYEESLDELLPRASTG
    VINILGMTCQSCVEAIEGKISTLKGVMSIRVSLEKGNAVVEYEQSTVSLEEICLEIGGMGFEANTTKEKAASASRRSAHA
    SEALVKLRVEGMTCQSCVNSIEGKIGKLQGVLRIRVSLASREAVIAYQPYLIQPEYLRDSIDDMGFEAAIKSKMAPLAID
    SIDLSRLQSPGLKKTPASASLNSGDAPVSAGETGTVATVSLGVEGMHCKSCVFNIEGNIADLPGVHSIRVSLEDQSARVE
    YDPTSVSPVSLRRAIEALPPGNFRVSLPNGVGEGGTERSACRGTAGLRLPRCPPGSRVRASTRSTAVINIEGMT
    CGSCVQ
    AIETSLAQREGVHNVSVSLAKGSGTIDYNPGTTSPEELREAIEDMGFEASLPHLRESSVTKSQSGSPPPPRTPASEKCFL
    RITGMT
    CASCVSNIERNLQKEDGVLSVLVALMAGKAEVKYNPKSIEPLEIAQLIQNLGFEATVMEDYTSSDGNIELIVTG
    MT
    CASCVHNIESKLTKTNGIFYASVALATSKAHIKFDPEIVGPRDIIKIIEGIGFHASLAQRDPSAHHLDHKMEIRQWKK
    SFLCSLVFGIPVLCLMIYMLIPSNQPHESMVLEYNIIPGLSILNLVFFILCTFVQFLGGWYFYVQAYKSLKHKTANMDVL
    IVLATSIAYVYSLVILVVAIVEKAEQSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTFGADN
    LIIREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGHTMVDESLITGEAMPVTKKPGSTVIAGSINAHGSVLINATHVGS
    DTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTVTLVVWIIIGFVNFDVVQKYFPIKTVMFDKTGTITYGVP
    KVLRILLLLDPAILPLKKVLAVVGTAEASSEHPLGLAVTKYCKEVRRLKHKAMK

    >gi|149430778|ref|XP_001505260.1| PREDICTED: similar to nucleoredoxin, partial [Ornithorhynchus anatinus]
    MASVLAGELDVDLPVLMALMAFHLRLENSPHPTLEPIPPQDNQTNRLKLWNKYRISNIPSLIFLDASTGKVVCRNGLLVI
    RDDPEGLEFPWGPKPFSEVIAGPLLRNTGQSLDSSTLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKESGQKFEIIFV
    SADRSEDSFKQYFSEMAWLAVPYTDEGRRSRLNRLYGIQ

    >gi|149409803|ref|XP_001510259.1| PREDICTED: similar to thioredoxin-related protein; Trp [Ornithorhynchus anatinus]
    MEKRANGGEVKIGTWLEGPSPPAIAPTSPSRPVLPSGLSSPGGLRFVSSDSRTAVSIPFLPLRKMSSGAAYGGETGVGEV
    RGVVVQ
    CGPCLRIAPAFNALSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHL
    ENDPGNNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDPSFLESDCDEQLLITVAFNQPVKLYSMKFQGPDN
    GQGPKYVKIFINLPRSMDFEEAERSEPTQALELTQDDIKEDGIVQLRYVKFQNVNSVTLFVQSNQGEEETTRVSYFTFIG
    TPVQATNMNDFKRVVGKKGESH

    >gi|149513710|ref|XP_001517033.1| PREDICTED: similar to mercaptopyruvate sulfurtransferase [Ornithorhynchus anatinus]
    MASQPLFRALVSAKWVAEALKSPGTGQRVQLLDASWYLPKLKRDPQKEFEDRHIPGAAFFDIDLCSDRTSPYDHMLPTAE
    SFAEYAGKLGVGGDTHVVVYDASEQGLFSAPRVWWMFRAFGHRAVSLLDGGLRNWQREGRPLGSGKGRPVPAEFRATLDP
    AFVKSHEDIKENVESRRFQVVDARASGRFRGTEAEPREGIEPGHIPGTLNMPFTDFLTEQGLEKSPEELRGLFREKKVDL
    SQPLVAT
    CGSGVTACHVALAAYLCGKPDVAIYDGSWVEWFMRAQPEDVVSEGRGKTL

    >gi|149433266|ref|XP_001520740.1| PREDICTED: similar to chloride channel form A, partial [Ornithorhynchus anatinus]
    AGCDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAPPRY
    PKLGAQHTESNSAGDDVFAKFSAFIKNTRKDADE

    >gi|149636390|ref|XP_001516560.1| PREDICTED: similar to glutaredoxin 2 [Ornithorhynchus anatinus]
    MTVSRVAPRRMGNRTSALSTEAEAAAATQIQETVSDNCVVIFSKTSCSYCDMAKRLFRDMNVNYTAVELDTHEYGSQFQD
    ALHRMTGAGTVPRIFVNGAFVGGATDTRRLHREGKLLPLVQRCRADTKSGEFGRAT

    >gi|149579990|ref|XP_001505837.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MASLPILYSYFRSSCSWRVRIALALKGITYETIPVNLIKDGGQQFTGEFQAMNPMQQVPALKIDGITISQSLAIIEYLEE
    TRPSPSILPRDPKKRASVRMISNVIAAGIQPLQNLSVLKQVEQEKQLAWAQQCICQGFKALEQILQGTAGKYCMGDEVSM
    ADLCLVPQVANAERFKVNLAPYPTIKRINEALLNLEAFQVTHPCRQPDTPPELRA

    >gi|149591327|ref|XP_001509609.1| PREDICTED: similar to Chain A, Endoplasmic Reticulum Protein Rp19 O95881, partial [Ornithorhynchus anatinus]
    DAPPGPRPGPLRRHVPALPATQPRLIFPGGRAARRRPTPPSISSEKDGDGLGRARTPRRAPSRAPERDGAIRGLPLMVII
    HKSW
    CGACKALKPKFAESKEISELAHNFVMVNLEDEEEPKDQDFSPDGGYIPRILFMDPSGKVHPEIVNEKGNPSYKYFY
    ISADQGTAGPGVGAEGMALGWHPGPGPRVPTRLIRGLSAFGAVGAWSRDEELQPRPPSVVQRREPSPSVSGGLLT

    >gi|149412220|ref|XP_001510709.1| PREDICTED: similar to zinc finger protein 71 (Cos26) [Ornithorhynchus anatinus]
    MKALSLTQPPEGISFFPLGDIHIIPGGARKFQAPGSTKARRPGPVGMGDEKEAQNIRHRGWNMQTVYFVLNPGREASFVL
    VFHDTCFLTQHKSTTDWKKKLTPEQYCVTRGKGTEPPFSGIHLNNTERGMYHCLCCDMPLFSSEKKFCSGTGWPSFLEAH
    GTQGTDESQTGILRRPDHSLGLARTEVVCKRCEAHLGHVFDDGPPPTGQRF
    CINSVALTFKPS

    >gi|149639305|ref|XP_001509701.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MGRELGGRPSGNSRSWPLVPGEKPPPPSRLSEGRPGASSRSRSCFVPGHDSSLPSSGSISLRSHVDTDTCRDAADRQDPP
    HPEHLRFPSPGLAPPDTLTIPARVRTFRHGTTCGREERAQKQKPRSAPAVASPHPDGGILHRFPRSPLHPQARPASPASG
    PRAQARPPPGRYGDGPCLDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGT
    CLNVGCIPSKALLNNSHFYHLAH
    GKDFAARGIEISGVQLNLEKMMEQKSGAVKALTGGIAHLFKQNKVVHVPGYGKITGKNQVTAAKADGSNQVINTKNILIA
    TGSEVAPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGSGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQ
    RILQKQGFKFKLNTKVTGATKKPDGKIDVAVEAATGGKGEVITCDVLLVCIGRRPFTQNLGLEELGIELDARGRIPINSR
    FQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGVEYKVGKFP
    FAANSRAKTNADTDGLVKILSHKSTDRMLGAHILGAGAGEMVNEAALAMEYGASCEDVARVCHAHPTVSEAFREANLAAS
    FGKAINF

    >gi|149616796|ref|XP_001518238.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MAARPHGGLSDASAAAAAAAAAEEGKRPPFGTRVLDNADSLFHYNAWDNVEWSREQEAAARKKVQENSAKLVPPEKKADY
    EVNAHEYWNGFYKIHENRFFKDRHWLFTEFPELAPRPTAKTPESLVPEAGGGETLRASGSCGDAFGLPVSDSRASRADGI
    AQKLSHLKMSADDFPGASATYRILEVGCGVGNTVFPILQTNNDPGLFVYCCDFSTTAVDLVQANSEYDPSRCFAFVHDLC
    DEHKSYPMPEGSLDIIILVFVLSAVDPDKMQNAITRLSCLLKPGGRILLRDYGRYDMAQLRFKTGR
    CLSENFYVRGDGTR
    VYFFTQDELHGLFSSAGLEKVQNVVDSRLQVNRGRQLTMYRIWIQCRYRKPLPSSPS

    >gi|149412724|ref|XP_001510289.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 [Ornithorhynchus anatinus]
    MADGEEPEKKRRRIEELLSEKMAVDGGCGDTGDWEGRWNHVKKFLERPGPFAHPDFEPSAESLQFLLDTCKVLVVGAGGL
    GCELLKNLALSGFRKIHVIDMDTIDVSNLNRQFLFRPKDVGRPKSEVAAEFLNDRIPNCAVVPHFKKIQDFDDTFYRQFH
    IIVCGLDSIIARRWMNGMLMSLLNYEDGVLDPSSVIPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQINFPM
    CTIA
    SMPRLPEHCIEYARILQWPKEQPFGDGVPLDGDDPNHIQWIFLKSLERASQFNIRGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKLATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQDIQFPPSAKLQEVLDYLTNSASLQMKSP
    AITATLDGKNRTLYLQTVSSIEERTRPNLSKTLKELGLTDGQELAVADVTTPQTVLFKLHFTA

    >gi|149412726|ref|XP_001510333.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 2 [Ornithorhynchus anatinus]
    MADGEEPMAVDGGCGDTGDWEGRWNHVKKFLERPGPFAHPDFEPSAESLQFLLDTCKVLVVGAGGLGCELLKNLALSGFR
    KIHVIDMDTIDVSNLNRQFLFRPKDVGRPKSEVAAEFLNDRIPNCAVVPHFKKIQDFDDTFYRQFHIIVCGLDSIIARRW
    MNGMLMSLLNYEDGVLDPSSVIPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQINFPM
    CTIASMPRLPEHCIEYAR
    ILQWPKEQPFGDGVPLDGDDPNHIQWIFLKSLERASQFNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKLATS
    AYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQDIQFPPSAKLQEVLDYLTNSASLQMKSPAITATLDGKNRTLY
    LQTVSSIEERTRPNLSKTLKELGLTDGQELAVADVTTPQTVLFKLHFTA

    >gi|149422654|ref|XP_001520868.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MQDPNEDTEWNDVLRNFGILPPKEEPKDEIEEMVLRLQKEAMVKPYERMSLTQLEEAEDEFDEEDMKALEVYRQRRMQEW
    KALQKRQKFGELREISGNQYVREVTNAESDLWVVIHLYRTSIPM
    CLLLNQHLSLLARKFPETKFLKAIVDSCIEHYHDTC
    LPTIFVYKNGQIKGKFIGISECGGINLKLEELEWKLAEVEAIRTDSKENPKRDLKENFQQDIAEVSSSIRNTSIYDDSNS
    SSSEDETKCYSGRNIQ

    >gi|149567274|ref|XP_001506977.1| PREDICTED: similar to hCG28655 [Ornithorhynchus anatinus]
    MGASDFRQCCVAQLWCQATRGHILSLTDLPLKQPQSQPIEVTWILTPITSEITSLDSANIDDTLNNADVALVNFYADWCR
    FSQMLHPIFEEASNVIKEEFPNKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADYIRQQ
    KSDPVREVHDLEEIASLDRSKRNIIGYFEQKDSDNYRTFERVANILHDDCVFLSAYGSVSKPERFSGDNIIYKPPGENAP
    DMVYLGSMTNFDLAYAWTQDKCVPLVREITFENGEELTEEGLPFLILFHMKDDADSLEQFQQEVARQLISEKGTINFLHA
    DCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFPDFRDLVVPGKLKQFVLDLHSGKLHREFHHGPDPTDVSPGQHVQDVA
    SSPPESSFQKLAPSEYRYTLLRDRDEL

    >gi|149461406|ref|XP_001513863.1| PREDICTED: similar to chromosome 6 open reading frame 97 [Ornithorhynchus anatinus]
    MLLRSARSQPAEIHPTFPPSPVLSLPRGLTRRHRPSLPEGLRSRLLANFTQPLAPSDSCGTDRPAPDERGEGRCSNLRAG
    RVEEGDLSVPGSGEGLDARCRAGFSPDQALWPRSALSLHPLFFLCPASLPETLTPLLCPCPLPQVGDKLPSVELFEENPG
    NKVNLEELFKGKKGVLFGVPGAFTPG
    CSKTHLPGIVEQAGALRAKGAEVVACLSVNDVFVVSEWGRANGAEGKVRLLADP
    TGAFGKMSDLRLLECFWAPRGWRFSMVVQDGVVKSLNVEPDGTGLSCSLAPNLLSQL

    >gi|149639832|ref|XP_001508929.1| PREDICTED: similar to molybdopterin synthase sulfurylase [Ornithorhynchus anatinus]
    MPPSTQPQRVEAHPSSQALTFPLGDPAPGKMTSSKTWEGGILRCGPPPSSGGRERPPVGVAIFLSRRPKALEAGAAEPRQ
    PKKKRGIPLSQLPARSALTAAEILRYSRQLVLPELGVRGQLRLAGSSVLVVGCGGLGCPLAQYLAAAGVGRLGLLDPAVV
    EPSNLARQVLHGEARAGQPKVHSAAAALRRLNSSVEVVPYARALTPASAPDLVRRYDLVADCSDNAPTRYLVSDACVLSG
    RPLVSASALRLEGQLAVFHHAGGPCYRCAFPRPPPAHTVTS
    CADGGVLGAVPGVLGCLQALEVLKIAAGLEPAYSGRLLL
    FDALGGHFHSIRISGPLTNQPPAEFRHWNLDGRQVMTERLRTSVQSQLDMNGPKSGLHPKKRTIRRSQALDPARHLP

    >gi|149591912|ref|XP_001517747.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]
    GVGGSGVSLRSAGARPPFLPDLTVGYSTCHWCHMMEEECFRCPAIGRILSDHFVSIKVDREERPDVDKVYMAFVQTTSSG
    GGWPMSVWLTPSLQPFLGGTYFPPEDGVSHIGFRTILLRVLEQWKHNRTSLLENAQRLTEALQARLKMAAGAREEPPPAE
    EVSDHCFRQLADAYDEEYGGFGNAPKFPSPVNITFLLTYWAQRRSLSEGSQALHMALHTLKMVAHGGIRDHVGQGFHHYS
    TDQGWNMPHFENMLSDQGQLAVVYAKAFQVLIQANSKSSGFLFRQLPFLASLSQWEGEATAYVWENDACSLPITSPRVLR
    KFLQK

    >gi|149571537|ref|XP_001518656.1| PREDICTED: similar to glutathione reductase, partial [Ornithorhynchus anatinus]
    PDFLASFLTTLPFLGILSFLRTLALLRTLPFLRSLVLLRSLAFLIPGRQQLYQLPLLSNRNGRDELPLPFPLSPFSLSPH
    PGGSALGSLVIPDRAGQSLPRCSCPQVDPQPALPARIGKLPTPPRSRALLPAKSWQPRAPGRGILHRAVNVGCVPKKVMW
    NTAVHSEFMHDQVDYGFQS
    CDPKFNWRVIKEKRDAYVSRLNSIYQNNLNKSHIEIIRGHATFTSDPEPTVEVNGRKYSAP
    HILIATGGLPSLPSEQQIPGASLGITSDGFFELEELPRRSVIVGAGYIAVEIAGILSALGSQTSLIIRHDKVLRSFDSII
    SSNCTQELENAGIEVLKYSQVRAVRKSPAGLELSVTTVAPGGNPSVHTIQDVTCLLWAIGRDPNTQGLNLDRVGIRTDDR
    GHILVDEFQNTNRRGVYAVGDVCGRALLTPVAIAAGRKLAHRLFEGKEDSKMDYDNIPTVVFSHPPIGTVGLTEDEAVSK
    YGRENVKIYSTSFTPMYHAVTRRKTKCVMKLVCACRQEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTS
    SEELVTLR

    >gi|149637913|ref|XP_001507796.1| PREDICTED: similar to thioredoxin reductase 1 [Ornithorhynchus anatinus]
    MTWAVILRRGFNVMQEDKVALETSERYTELAYRDLTSNSKLEPFQSTETSDHHRSGIQPENKNRTVFTNSLSNNIESSED
    TSNANLRSGVQAYVDTNTVVIFSQTTCGLCIEAYKEGRLQKVLKMNNANNIPESFDYDLIVIGGGSGGLAAAKEAAKYGK
    KVMVLDFVTPTPLGNRWGLGGT
    CVNVGCIPKKLMHQAALLGQALQDSRKYGWQVEETVKHNWESMTEAVQNYIGSLNWGY
    RVALRENKVTYENAYGEFVGPHKIKATNQKGKENFYTAEKFLIATGERPRYLGIPGDKKY
    CISSDDLFSLPYCPGKTLVV
    GASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIKKFVPIKIEQIEEGMPGKLKVVAQSTDG
    QETIEGEYNTVLLAVGRDSCTRKIGLENVGVKINEKTGKIPVTDEEQTNVPYIYAIGDVLEGKLELTPVAIQAGRLLARR
    LYSGSTVKCDYDNVPTTVFTPLEYGACGFSEEKAAEKFGEENIEVYHSYFWPLEWTVPSRDNNKCYAKIICNIKDNERVV
    GFHVLGPNAGEVTQGFAAALKCGLTKEQLDSTIGIHPVCAEIFTTLTVTKRSGGNVIQAGC

    >gi|149634548|ref|XP_001511844.1| PREDICTED: similar to hCG2024404 [Ornithorhynchus anatinus]
    MTDVRADSVNALLTSRETNMREVAMLRFYGCGLVCPESLENRRILDLGSGSGQDCYVLSQLVGEKGHVTGVDMTKAQVEV
    AKKYIDYHMKKYGFQTPNVNFIHGYIEKLGEAGIKDESYDIIVSNCVINLVPNKRQVLQEAYRVLKPGGELYFSDVYASL
    DLPEEIRSHRVLWGE
    CIGGALFWKDLFTIAQEIGFCPPRLVSAFPITIQNKELEKVLGNYQFVSANFRLFKLLEKSPVNR
    CEVIYNGGITGFEKELVFDANFTFKEGEVVEVDEETAAILQNSRFAESFLIRPVGEKLPTPGSGSRLEPKEMITDPFKLV
    KQLKTKPTCSTASSACSGSKKCG

    >gi|149571832|ref|XP_001512035.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MEPLLSSPSKCSVAKARVLAVLLSLVLCTAILCLLQLRSIKPKIKTDFYSFQVKDSKGRTVALEKFRGKATLVVNVASNC
    QYTERNYLALQELHREFGPSHFSVLAFPCSQFGDSEPGPSQEIEAFAKGNYGATFPIFHKIKILGSEAEPAFRYLIDSSK
    KEPRWNFWKYLVNPEGKVVKFWRPEEPFEIIKPDIAALVRQIIMKKKEDL

    >gi|149634574|ref|XP_001512410.1| PREDICTED: similar to glutathione S-transferase omega [Ornithorhynchus anatinus]
    MSGLSGVSAKSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLNAKGIKHEVVNINLKNKPEWFFQKHPLGQVPVLET
    SKGQLIYESSITCEYLDEAYPEKKLFPDDPYEKAYQKMIFNQFSKVPPLALKCMTGARNGEDCSDLKAELRKEFSMLEEI
    LSRRKTQYFSGDSITMIDYLLWTWFERLELFKIADCVDHTPNLKLWIAAMTENPFVKAIFTDLKTSQGFMELYLNNSPEA
    CDYGL

    >gi|149533842|ref|XP_001519283.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]
    VKGRVSLVVNVASECGFTDQHYRALQQLQKDLGPSHFNVLAFPCNQFGQQEPDGNKEIESFVRKTYGVSFPMFSKIAVSG
    AGANAAFKFLTESSGEEPTWNFWKYLVSPDGKVVNSWDSTVPVEEIKPHITALLRRMIMKKKDEL

    >gi|149460144|ref|XP_001520252.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]
    MKVRKACVLLLLLGLAHLAVLAGARGDGVGVKEENGVLVLNDANFDTFVADKDTVLLEFYAPWCGHCKQFAPEYEKIAKT
    LKENDPPIPVAKVDATTASSVASRFDVSGYPTIKILKKGQPVDYEGSRTEA

    >gi|149634614|ref|XP_001513492.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MAAAGPEACGLAGLSAAQTALENALLDALTLREKDDLVSQYLRQVDGRERDLKVPEFAEGLEWLNTESPIYMYKDLSGKV
    VVLDFFTYC
    CINCIHLLPDLHALEQKFSDEDGLVVVGVHSAKFPNEKVLDNIKSAVLRYNITHPVVNDADASLWQALEVS
    CWPTLVILGPRGNMLFSLVGEGHKEKLFLFTSVALKYYKGKGQIKDNKIVIKLYRDFLPPSPLLFPGKVAVDRATGRLVI
    ADTGHHRILVVKKNGQIQYSIGGPNSGRKDGTFSESAFNSPQGVAIKNNIIYVADTENHLIRKIDLEVEQVSTVAGVGVQ
    GTDKEGGAKGEAQPISSPWDVAFGTSDEGSEAQRNYILWIAMAGTHQIWALLLDSGTLPKKSELKKGTCLRFAGSGNEEN
    RNNAYPHKAGFAQPSGLSLASGEPWNCLFIADSESSTVRTISLKDGAVKHLVGGERDPMNLFAFGDIDGAGINAKLQHPL
    GVTWDEKGNLLYVADSYNHKIKVVDPKTKNCATLAGTGEASNVIGSSLTQTTFNEPGGLCIGEDGHLLYVADTNNHQIKV
    LDLEAKTVSVFPILNSETAVDGRTLEKKVAKLPKLPKFAPKIELSPLTVCPGQTLRFGLRLVLPAKSKLTEEAASFWYLT
    AEGNEWLLQGQTPLGEIKDISNPCEISLLIPCSCVSFQVILSVNVFLYYCSVDSSACMMKGILFNQPLQIAKTHQVSSLF
    LPRNSRIYKLTCKARAAAKLLCLLLVSVAYLHPPRCFQCTQGASASASASAPRRLLRSRGDLETRPGETTTKHHVKSSGL
    ERDLMEGLGLSCPPNIPLKRLPNDPKRQLSY

    >gi|149600434|ref|XP_001519650.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]
    AHQNGLLQKLLEDETVSYEYDLIVIGGGSGGLACSKEAATLGKKVMVLDFVVPSPVGTSWGLGGTCVNVGCIPKKLMHQA
    ALLGQALQDSRKFGWEYEQQVKHNWKTMTEAIQNYIGSLNWGYRVTLREKAVTYSNSFGEFVDHHKIKATNRKGQETFHT
    ASKFVIATGERPRYLGIPGDKEY
    CITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQEMA
    EKVGAYMELHGVKFIRKFVPFLIEQLEEGAPGKLKMTARSTEGESIIEEEFNTILIAVGRDACTKKIGLEKIGVKVNEKN
    GKIPVSDEEQTNVPYVYAIGDILEGKLELTPVAIQAGKLLARRLFGGYSEKCDYINVPTTVFTPLEYGCCGMSEEKAIEQ
    HKKDNLE

    >gi|149635578|ref|XP_001510098.1| PREDICTED: similar to peroxiredoxin 2 [Ornithorhynchus anatinus]
    MASGNAHIGKPAPDFHATAVENGAFKEVKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSENASAFRQLNCEVLGVSVDSQ
    FTHLAWINTPRNTGGLGTMNIPLLADLTHSIATDYGVLKEDEGIAYRGLFIIDNKGIVRQITINDLPVGRSVEEILRLVQ
    AFQYTDKHGEVCPLIRSRLGPHPRRSAGARREGRGGFLALDPCSPPSPICKLGKSQPLFPAHRTAEQCRRGFPESGRPGL
    RHWAETAHIWARLPLRHGEKPPIGRGPAPPSTARPKSKRDTAPARPGLGLPPPLPAPPPSSPPPPPPPRSYPELFSRPAA
    GFSEPRGRRRSTSLRARSPPNPQGWDS

    >gi|149640945|ref|XP_001514678.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MDPKGHRDSTPVFVMIFLNNGLYFTHNPYHVQGRIIFEISYAPWCPSCQQTELEWETFAKSGDILDISVGKVDVTQEPGL
    SGRFFVTTLPTIFHAKDGIFRRYRGPGISKDLQNYILEKKWEAVEPVAGWKSPSSITMSGMAGLFSLSGWIRQLHSYFTG
    PLGIPVWGSYVIFIVATLVIGLLLGLILVLLSDCFCPPKPRAERSEVTEKENEALIVEDLGEISEEKKNLLEGEEEKEDL
    SDGEEKEEDRSGGEEEKEDLSDREEERSHSNEESSEEDSVVDEESETEEAGGNSHKHHPADPEVDGVVRQRKSQGADSGL


    >gi|149639973|ref|XP_001510245.1| PREDICTED: similar to anthracycline-associated resistance ARX [Ornithorhynchus anatinus]
    MSGDICARQDTDEPKTILSRPRIKLPLGMQYILGESLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPEANI
    VAYHDSIMNPEYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTVIKKGVTECYECHPKPTQKT
    FPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPAEAEARARASNEDGDIKRISTKEWAKSTGY
    DPVKLFTKLFKDDIRYLLTMDKLWRKRKSPVPLDWAEVQNQGQDICVSEQQNDSTLGLKDQQVLDVKSYAHLFSKSVETL
    RVRLAEKGDGAELIWDKDDPPAMDFVTSAANLRMHIFSMTMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGK
    IDQCRTIFLNKKPNPRKKLLVPCALDPPNPNCYVCASKPEVTVKLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTI
    LISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINLLHSEDLGKDVEFEVVGDAPEKVGPKPADQTTKSITNG
    SDDGAQPSTSTAQDQDDVVLVDSDEDSPAINAGVDKDDKVRKRKLDDTDNVNTKRLRTEQTEELDDIIALD

    >gi|149635596|ref|XP_001511642.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MPPPVPVGKREPDRGLPDTGVREVSARPGLAPGEAPAGRREAEGGKRGQPGLGLVVTGDPKFLLPVRGVPFPVPRARGGK
    LPSHPARPSSRRSPAEERKKCGAQRRRELLFPSITLRKHLRKPGTETRCNVNGSMSILISAVVRSCGVSVEKAEKQGEGI
    DPPPVSSRGLGSIRWNPNDKPSPTVTTDAMEIDDALYSRQRYVLGDMAMQKMARSHVFLSGMGGLGVEIAKNIVLAGIKA
    LTVHDTKQCQAWDLGSNFFLHEDDVRNLRNRAEATLPHVAELNPYVLVTSSSAPLDEATDLSFLRQYQCVVLTEMRLSLQ
    KKINDFCHAQQPPIKFISADVHGIWSRLFCDFGDEFEVLDSTGEEPKEIFVSNVTQANPGIVTCLENHPHKLETGQFVTF
    REINGMTALNGSTQQITVVSPFSFSIGDTTEMAPYLYGGIAVQVKRSKTFHFERLEKQLTDPTYLLADFSKPEAPLQIHS
    AMLALDRFQERYGRKPNVGCRQDSEEMLKLAASISETVEGKPEVDDDIVNWLSWTAQGFLAPLAAAVGGVASQEVLKAVT
    GKFSPLRQWLFIEASDIVDSLDNPSRDDFLPRGDRYDALRACIGDSLCQKLHSLNVFLVGCGAIGCEMLKNFALLGVGTG
    KGRGLVTITDPDLIEKSNLNRQFLFRPHHIQKPKSCTAAAATLNINAQLKIEPHLSKVCPLTEALYNDEFYTRQDVVVTA
    LDNVEARRYVDSRCVANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPF
    CTLKSFPAAIEHTIQWARDKFES
    LFSHKPSLFNKFWQTYSSAKEVLQRIESGESLEGCFQVIKSLHRRPRNWPQCVELARMKFEKYFESKALQLLYCFPLNTR
    LKDGSLFWQSPKRPPSPITFELNDPLHFSFIQNTARLLATVYCIPCTEKDLSMETLATILSSVPIQEFRPSNKVVQTDET
    ARKPDQAPVSSEDERVAIFQLKKAIAAKEATKNDLQMKVLSFEKDDDRNGHIDFITAASNLRAKMYSIEPATRLKTKRIA
    GKIIPAIATATAAVSGLVALELIKVAGGHPFEAYKNCFLNLAIPIIVFSETTEVRKTAIRYAAGGWAAGRRSPPTALPLQ
    EKYGIEPTMVVQGVKMLYVPVMPGHIKRLKLTVWLRGSDAGVRGEFVAPSPRDLRLKPPPSAAAASSSPELQPRSPPVAA
    PEAPRLFWALPLSLGLGQARPPEPPHSLLSGVGPVAQVQPAPLTARRVGLPL

    >gi|149632257|ref|XP_001510503.1| PREDICTED: similar to MSRB3 protein [Ornithorhynchus anatinus]
    MSAFNLLHLVTKSQPGSLQACGLPSGSRRDKRSCKVVFSQEELRKRLTPLQYHVTQEKGTESAFEGEFTHHKAPGTYKCV
    VCGTPLFKSETKFDSGSGWPSFYDVIGSDAITLTDDFSYGMHRVETSCSQCGAHLGHIFEDGPRPTGKRY
    CINSASLSFA
    AVEENIDKENGSGDSPIQPGKTELKYADLQQAFITSSIVYLALWLLGLQLVSVCCFGVGPFVPQSDRGPRSKRATSSSMA
    ALQAGLLATLSQAELDCILRVFPLPFLLSVTPFQLTIWQLCGYPAVVPSYVYLPPTEAGQQWSIESTERFLCAGHLLST

    >gi|149412905|ref|XP_001511331.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MDNPRGLRRIGTKRSESRLESTYLRKLQRSIIKTCEKQLFGEVNCFQNQGEQTLLTRRHKNSSSRFVLSGLWSRFQVATT
    NEACTKEPENSTKPPGRYPVPYKKDLPFDIVELMEEVEQKTGFLPNVFKELSHRPEEFRAFFAYYNAIINKKTGRLSKAD
    KELIIVATSAANRCSY
    CVVAHSALHRVYSQNPVLADQVIVNWKQADLSDREKAMLEFALAVCRADDITEGHFEKLEAQGF
    DREDAWDIAAISAFFAMSNRIAHFTNLVPNREFYSMGRTSDSSAGDMVSGDDLHRDKIVDCCRLKRALYGKKTGGSERSK
    YSHVDVVTLTVINPSWRKADFQDVLPLRDPAGPGSGAVPSLDANHSNVLTGAGPRRSEKS

    >gi|149640021|ref|XP_001512766.1| PREDICTED: similar to Chloride intracellular channel 2 [Ornithorhynchus anatinus]
    MADLRSSSQREPEIELFVKAGIDGESIGNCPFCQRLFMVLWLKGVKFNVTTVDMTRKPEELKELAPGTNPPFLVFNKELK
    TDFIKIEEFLEQTLAPPRYPHLSPRYKESFDVGSDIFAKFSAYIKNTQKEANPNFEKALLREFKRLDNYLNSPLLDEIDQ
    DSADEVLVSRRRFLDGDHLTLADCNLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAQEEFTHTCPDDKEIECTYA
    SVAKKMS

    >gi|149453537|ref|XP_001518434.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MDLRLSQVARQVRASPRAVDAPRAGAASAERKCPANPVPAGPALNRLPFSTSSSNYVPAVTQHAPYFKGTAVVNGEFKEL
    TLDDFKGKYLVLFFYPLDFTFV
    CPTEIIAFSDKANEFHDVNCEVVAVSVDSHFCHLAWINTPRKSGGLGHMNIAVMSDLT
    KQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSINDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPE
    ASKEYFEKVNQ

    >gi|149421418|ref|XP_001515956.1| PREDICTED: similar to chromosome 5 open reading frame 14, partial [Ornithorhynchus anatinus]
    ENEISLSEQQRQTKRPAYSSGEEQPRETVQYKMAEIADAMMGSEANSDHLELLSMIPGEASDRQSSELSVGTCEAGVHSS
    ECESRENLFSSSESRTEVPEKGEEYNLALATVHGDPSPVEESNGTESLKTPKVNCDERNVTGMENFTLQILNISQDLMEF
    LNPNGSDCTLVLFYTPW
    CRFSANLAPHFNSLPRAFPALYFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDR
    TLETLKAFIFNQTGIEAKNDVVVTEDDRIGPLPSTLTKSVDWLLVFSLLFLVSFIMYATVRTESIRWLIPGQEQEHQE

    >gi|149634217|ref|XP_001505534.1| PREDICTED: similar to calcium-sensing receptor related protein 2 [Ornithorhynchus anatinus]
    MNPRRRLRLSPEASDPHPEETTTPAGQDLTARGSSDSRSLDGRLRDNWYWAPLPRVDDEILIEDVWRPFCLPVEAGKHQD
    LCYVSSDTVAALLRGGYAQSVEEFVVVDCRYPYEYAGGHIKGALNLYREDQLVERFLQGPRCPPEGPKSRVFIFHCEFSS
    ERGPRL
    CRALRELDRRINQYPRLCYPELYLLRGGYRDFHQHFQELCEPPGYVTMLHQDFRAELKRYRSRGKCRVCKELFQ
    R

    >gi|149636157|ref|XP_001515331.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MPGLLLGDEAPNFEAETTFGPIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKMIALSIDTVQDHLA
    WCKDINAYNGAEPTEKLPYPIIADAKRELAVKLGMLDPDEVDKDGLPLTARVVFVFGPDKKLKLSILYPATTGRNFDEIL
    RVIDSLQLTACKKVATPVDWKSGDSVMVIPSLPEEEAKKLFPKGVFTKELPSAKRYLRYTPQP

    >gi|149578027|ref|XP_001519082.1| PREDICTED: similar to Chain A, Microsomal Prostaglandin E Synthase Type-2, partial [Ornithorhynchus anatinus]
    QHTEGRLQLTLYLYKTCPFCSKVRAFLDFHGLHYDVVEVNPVMRQEIKFSSYRKVPILLAHERDSLEEIQEVVIPSLAVY
    SFVQSKSLEEIITYYPPMKTVNDRGKEVTEYGNKYWLMLDEKENKHVYSGKEARVEEMKWRKWADDWLVHLISPNVYRTP
    GEALASFNYIVHEGKFGPVEGAFAKYIGAAAMFFISKRLKS

    >gi|149409268|ref|XP_001506777.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
    MSCIQPDDPYVRRAKDVIMPAKPPVNFFSSRSPVLDLFQGQLDYAEHIRQDSEVVLLFFYAPWCGQSIAAKGEIEQVASR
    LADQVLFVAVNCWWNQGKCRKQKHFFYFPVIYLYHRSSRAIHFCKPSHCEDRSVFIIFLRLPLLRLPSEASYLRSHSRYN
    PGVLGYFEFSGSPQPPGYLTFFTSALHSLKKDHLGTVHFGVITDKHLAKQVSMVHSGSVYLHRNFNTSLMYPRDVLNYTA
    ENICKWAFENQEILLRWLRPHGGKSLLLNNELKKGPALFLFIPFNPLAESHPLLDEITEVALDYNNCNKSQTVEVLLQHL
    RHSETPTFESLGPDPPTPLTGSFSISESPCCNTVVLPQWHSISRTHNVCELCVNQTFGIKPSEVSVPQCSFFDIAAALDS
    FYLKERTFYQVASNNIECSNFLSFYSPFSYYTACCRTVRRGWSFVNSEEAIFQTPNVAFSSHEKKDEVDPPNSVPHIEES
    RSFPHEPVNGTDISGLFCRTNKTLNLYLLDSNLFWIYAERLGASSSTPVKEFAVIIDLKEESHYILDPGQALVKPILETF
    IQNYSILYSPLKRHLIGDASTHFPSWNLISEVTTETFWEVVFKKKDVLLLYYAQW
    CGFCASLNHIFIQLARLLPPDKFTV
    ARIDVARNDLPWEFMVDSLPTVMFYPRNR

    >gi|149408720|ref|XP_001505713.1| PREDICTED: similar to Protein disulfide isomerase associated 6 [Ornithorhynchus anatinus]
    MLPLSAYSARTAVRSAGGAAGAVPVFQARCGHCQRLTPEWKKAATALKGVVKVGAVDADKHQSLGGQYGVKGFPTIKIFG
    ANKNKPEDYQGGRTGEAIVDAALSALRPLVKDRLSGRSGGYSSGKQGGSGGSSKKDVIELTDDNFDKNVLESDDVWLVEF
    YAPW
    CGHCKNLEPEWAAAATEVKDQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGEEPRDYDGGRTRSDIVSRA
    LDLFSDNAPPPELLEIVDEAVAKKTCEDHQLCVIAVLPHILDTGASGRNSYLEVMLKLADKYKKKMWGWLWTEAGAQFEL
    ENALGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPKINTVEPWDGKDGELPLEDDI
    DLSDVELDDLGKDEL

    >gi|149640540|ref|XP_001506840.1| PREDICTED: similar to LOC500420 protein [Ornithorhynchus anatinus]
    MRLEDSAAPPDCAKRMNQKQTLPVSRLKTVKGSSCHLCTDVSQSITYQELKDLLHSKTTVLIDVREVWELKDHGRIPGSI
    NIPLAEVAEALQMNPSDFKDKYRQAMPSKSDRVVFS
    CLAGVRSKQALATALSLGFKSAQHYPGGWKEWTSYEFPPKNE

    >gi|149641426|ref|XP_001506955.1| PREDICTED: similar to ATP binding protein [Ornithorhynchus anatinus]
    MEADTSVNMFSKVLENQLLQTTKLVEEQLDSEIQKLDQMDEDDLERLKEKRLEALKKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKKVVCHFYRDSTFR
    CKIVDKHLALLSKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDYVVG
    FTDLGNTDDFTTETLEWRLGCSDILNYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSEDD

    >gi|149641918|ref|XP_001513015.1| PREDICTED: similar to Sulfhydryl oxidase 2 precursor (Quiescin Q6-like protein 1) (Neuroblastoma-derived sulfhydryl oxidase) [Ornithorhynchus anatinus]
    MREKGEHSNILLLPYALLGPTQSPTFLSSPVLLKKARSLMGKGRQREDSWVDCRRPQERLHGGGRCFRSRLNEKRMLGEQ
    EGQGMWGCALETVRIHDPRYPRHHNSAGHAAICLGIGIKKIAGVDWDSAIRVGVLDCADEENYETCREYGIQFYPSFRYF
    RAFTKEFTHGENYKGSDRELQTVRQTMIDFLQNHSQENRPPACPNLEPISSNDVASLFDISGGHYIAILFESNNSYVGRE
    VMLDLVPFENIVVNRALNSDKTFLEKLGITSVPSCYLIYPNGSHGLINIVKPLRSFFSSYLKSLPGVKRKLSSQVTLPIK
    PNKEEIVDTSAWREFDKSKLYMADLESGLHYLLRVELATHKTLEGAELKTFKDFVTVMTKLFPGRQSVMKLLETLQEWLV
    SLPLDKIPYDAILDLVNNKMRISGIFLTHHVQWVGCQGSRPELRGYPCSLWKLFHILSVQAALRPKALINTDFDQNPQGV
    LQVMRQYIQKFFG
    CKECAQHFEEMAKESMDSVKILDQAVLWLWKKHNIVNYRLAGQLSEDPKFPKIQWPPPELCPACHEE
    IKGLDSWNEDEVLMFLKHFYSQENILDKYSEEQTDSSEVGPGAEDARKEKSSQTKPSESRDGKIPDSHHALDPNQRNGGP
    VKDSVKNEYESGLHKETKHSFLGIGFSNIDMSLCVVLYVASSLFLMIMYFFFRMRSKRWKVKYYRPVV

    >gi|149627057|ref|XP_001507748.1| PREDICTED: similar to Dim1p homolog [Ornithorhynchus anatinus]
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY