Neurospora crassa

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|85078281|ref|XP_956143.1| hypothetical protein [Neurospora crassa OR74A]
    MPISQDTQKNEVDLVTRMQVDESVAGTTAEIDESLYSRQLYVLGHEAMKRMSASNVLIVGLKGLGVEIAKNVALAGVKSL
    TLHDPEPAAWADLSAQFFLRPEDVGKPRDQVTAPRVAELNAYTPVHIHQSPSLADNLSQFDKYQVVVLTNQHTDLQTIVG
    EYCHSKGIYFIAVNTHGLFGGIFCDFGDNFTVMDTNGENPVNGIVAGIDEEGLVSALDETRHGLEDGDYVTFSEVEGMEG
    LNGCEPRKVTVKGPYTFSIGDVSGLGQYKKGGLYQQVKMPKTIEFKSITNALKDPEFVISDFAKFDRPQQLHIGFQALHA
    FAKSQGRLPRPMNDEDALVVIASAKEFAKQQGVDVEFDDKLLKELSYQATGDLNPMAAFFGGLTAQEVLKAVSGKFHPIK
    QFMYFDALEALPTNSKRTEELCAPTGSRYDGQIAVFGKEFQEKISNVKQFLVGAGAIGCEMLKNWAMIGLGTGPEGKITV
    TDMDSIEKSNLNRQFLFRPKDVGQMKSDCAAKAAQAMNPDLEGHIVSLKDRVSPETEEIFNEEFWQGLDGVTNALDNVEA
    RTYVDRRCVFFHKPLLESGTLGTKGNTQVVLPRLTESYSSSQDPPEQSFPM
    CTLRSFPNKIEHTIAWARELFESSFVKPA
    ETVNLYLTQPNYLDTTLKQSGNEKATLEMLADFLKHERPLTFEDCVQWARMLFEKQYNNAIQQLLYNFPKDSVSSTGTPF
    WSGPKRAPDPLKFDPENPTHFSFLEAATNLHAFNYSINAKGKSKADYLRALEGMIVPDFSPDSNVKIQADEKEPDPNADN
    TAFDDESELGNLKSQLPEPKSLAGFKLNVVEFEKDDDTNYHIDFITAASNLRAENYKIEPADRHKTKFIAGKIIPAIATT
    TALVTGLVVLELYKIIDGKTDIEQYKNGFINLALPFFGFSEPIASPKVEYNGPNGKVTLDKIWDRFEVGDITLQELIDDF
    EKRGLSISMLSSGVSLLYASFFPPAKLKDRYTLKLSELVETISKKPIPAHQKELIFEVVTEDADGEDVEVPYIKARIR

    >gi|85079936|ref|XP_956448.1| hypothetical protein [Neurospora crassa OR74A]
    MAPISRETDFLVIGGGSGGIATARAAAGKYGIKSMVVEGKRLGGTCVNVGCVPKKVTFYAALVAETIHQAKDYGFSVEQT
    APFDWPTFKQKRDAYVARLNGIYERNLANDKVEYVHGWAKLLSPNSVEVTLDDGTKSVVNAKKILIAVGGNPTIPPHIPG
    SEYGTNSDGFFDIDTLPKKVALVGAGYIAVEFAGMLNALGVETHLFIRHDTFLRSFDPMIQQVSVKEYERIGVKVHKKSQ
    LTSVQKDAAGKLAINFKEGEGEQSISDVDHLIWAVGRTPAVEGLGLDKAGVKTNEKGYIEVDEYQNTSTENIYAVGDVCG
    QVELTPVAIAAGRKLAARLFGPEEFRTLKLNYDNVPSVVFAHPEIGSIGLTEPEAVAKYGAENLKIYKSSFTAMYYAMMK
    PEDKAPTAYKLICAGPEEKVVGLHIIGLGSGEILQGFGVAVNMGATKADFDNCVAIHPTSAEELVTLK

    >gi|85080643|ref|XP_956580.1| hypothetical protein [Neurospora crassa OR74A]
    MRWLPAFLSASLFAAGSFAARKSSEERFAEFHAKQTSHAPIKLKDSSFKSLTAPPRDYSVAVVLTALDPRYGCQLCREFQ
    PEWELLSKSWVKGDKSGESRVIFGSLDFSEGRETFMGFGLQTAPVLFFFPPTIGPHAAASPEPIRYDFTNGPVPAEVVHS
    WLVRHLDGRPHPPVKRPVDYIKWAVSFTMITGSLTGVYVAWPYVVPVIQNRNVWAAFTLIAILLFTSGHMYNQIRKVPYV
    ANNPRGGVSYFAAGFQNQYGLETQIIAALYGILSFAVISLAVKVPRIADPKSQTIAVWAWSGVLLVVYSFLLSIFRLKNA
    GYPFYLPPFM

    >gi|85081887|ref|XP_956805.1| ubiquitin-activating enzyme [Neurospora crassa OR74A]
    MTSQLTAEAVLALAPAETPETLLTTTSQARVLMVGAGGIGCELLKNLVLTGFGEVHVVDLDTIDLSNLNRQFLFRHEHIK
    KSKALVAKEAAQKFNPAVKIVAHHANIKDAQFNIEWFSSFRIVFNALDNLEARRHVNKMCLAADVPLIESGTTGFNGQVQ
    VIKKGVTACYDCAPKETPKSFPV
    CTIRSTPSQPIHCIVWGKSYLLNEIFGASEDESAFDHTVDGDNAQEIEELKRESAAL
    RKIRNSVGTEEFAQMLFEKVFKTDIERLRSMEDMWKTRKPPEPLNYKELLDKAKSLDKDKVLKDAQKVWSLEENLVVFND
    SLERLSKRVLENKSAGEESIITFDKDDEDTLDFVAASANIRSAVFGIDRKSKFDIKQMAGNIIPAIATTNAIVAGLCVLE
    AFKVLKGHYEQAKEVFLTPFANARMLASDKSREPNPDCPVCGVYQTRAYVDLEKATLNDLVEHLIKTNLGYGEKDFAISN
    EVGILYDPDETDNLEKKLSELGIKSDSFLTITDEDDEEPFVNVVVAIQEAKEPLGDKPVKGILDPEDVKIPLKPKKQSQP
    EPVATPTAATNGASISNGQNGGVINLDGDEPMTTPAKSLKRGHPEDAEGPSVKKIKANDKAADDDIVFIEDSAGAIVIDD
    D

    >gi|85083763|ref|XP_957181.1| hypothetical protein ( hypothetical protein B17C10.170 [imported] - Neurospora crassa OR74A )
    MRSLQPAARCLALAQHLKSIPYANQPFSAFFSTTKHIMASNGTAIENGTHPLSSDGTTLSALPKSWHFTASLPPDAAFPT
    PADSHKADRDDLGPRQVKNAIFTWVRPEKQQDPELLAVSPAAMRDLGLALSEADTEEFRQVAVGNKIIGWDEETLSGPGY
    PWAQCYGGFQFGQWAGQLGDGRAISLFEGTNPATGVRYEVQLKGAGMTPYSRFADGKAVLRSSIREFIVSENLHALGIPS
    TRALAISLLPHSRVRRETMEPGAIVVRMAQSWLRFGNFDILRARGDRKLVRQLATYIGEEVFGGWDKLPGRLADPEGAPG
    DEPPRGIPKETIEGPLGAEENRFHRLYREIIRRNALTVAKWQIYGFMNGVLNTDNTSIMGLSIDFGPFAFMDNFDPNYTP
    NHDDFALRYSYRNQATIIWWNLVRLGEALGELIGAGPEVDSESFVTNGLNFDDEAASKPIEERAHKLITQAGEEFKAVFM
    GEFKRLFTARLGLKTYKESDFDSLFDSLLNTMEALELDYNLFFRRLSTLKTADLQTEEARQKAAEVFFSQVEEVPGPGTD
    KEKARKRVGEWLDKWRVRIEEDWTTSAADSEERVAAMKRVNPSFIPRGWILDEVIRRVEKQGERDVLKRVLHMATHPFED
    AWTGKEFEDGPTGKGVYQGDKAEEERWTGDVPQQKKAMQCS
    CSS

    >gi|85085612|ref|XP_957530.1| hypothetical protein [Neurospora crassa OR74A]
    MPENYPVQKSADEWRAVLSPQQFRILREKGTEPAGTGKFDKHYPSAGVYTCAGCHAPLYKASHKFNSGCGWPAYFDSIPG
    AVTRHEDRTFGMTRTEIVCSNCGGHLGHVFKGEGFNTPTDERH
    CVNSISLSFSEEDSAAEKKGDGERSGEKTLDCIQSLH
    SR

    >gi|85089362|ref|XP_957919.1| hypothetical protein [Neurospora crassa OR74A]
    MSSATTIYDFKPLDKKGSELPLSTYQGKVVLIVNVASKCGFTPQYAGLEKVYKEIKEKYPDDFEILAFPCNQFGGQEPGT
    EEEIQSFCQLNYGVSFPIMKKVEVNGDNADPLYEWMKNEKPGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKEA
    ILKELGE

    >gi|85089598|ref|XP_958022.1| hypothetical protein [Neurospora crassa OR74A]
    MSTTAFPSSPVTVPEGAEKATVAAGCFWGVEHLYRKHFADKGLYDARVGYIGGDASNPSYKQVCSGNTGPCSLDCVADKT
    KDAEATLLIYDPTRLSYTQILEFFYKMHDPTTHNQQGPDRGAQYRSGIFYHNDEQKKVAEEITKKANEQWWGGKIVTEIL
    PAKEWWDAEQYHQLYLVNNPDGYECPSHFLRKFPELK

    >gi|85089859|ref|XP_958143.1| hypothetical protein [Neurospora crassa OR74A]
    MARRPHITLMLVVGVILFVFTTYMLSSSGSSGVVQHSETLDLGGSSGSGDHKSASGDGGSKSAFGISDNILKGGSIAPKL
    ENATAKAELGRASWRLFHTMMARFPETPTAEESLALKTYIQLFARLYP
    CGDCASHFQKLLKKYPPQTSGRNAAAGWACFV
    HNEVNKRLKKEQFDCNKIGDFYDCGCGDEGAKKAGEAGAGAEVKTETKKGEDLKMD

    >gi|85091979|ref|XP_959167.1| hypothetical protein [Neurospora crassa OR74A]
    MHAPTKFALGLLAAAAVATASDVIQLKKDTFDDFVKTNDIVLAEFFAPWCGHCKALAPEYEEAATTLKEKNIKLAKIDCT
    EESELCQQHGVEGYPTLKVFRGLEVVSPYKGQRKAAAITSYMIKQSLPSVSELNKDNIEEFKKADKVVIVAYLDAADKAS
    NETFSKVADKLRDEYPFGASSDAALAEAEGVTAPAIVLYKDFDEGKAVFTEKFDPEAIEKFAKTASTPLIGEVGPDTYAG
    YMSAGIPLAYIFAETPEERKELSEALKSIAEAQRGVINFATIDAKAFGAHAGNLNLKADKFPAFAIQDTTKNLKFPFDQE
    KEITADSIKKFVDDFVAGKVEPTIKSEPIPETQEGPVTVVVAKSYDDIVLDDTKDVLIEFYAPW
    CGHCKALAPKYDELAT
    LYANSDFKDKVVIAKVDATQNDVPDEIQGFPTIKLYAAGAKDKPVEYSGPRTVEDLIKFISENGKYKASPPAEAEESVAA
    SAESGSSTETGTVEEPAKETSHDEL

    >gi|85092101|ref|XP_959227.1| hypothetical protein [Neurospora crassa OR74A]
    MFARTALRATASASPIARVSASAAPVAAASRFFSSSPARLVKIGELLPEGELLQEGSPGNKVDLRKEAESARNMLIIGVP
    AAFSPA
    CSASHIPSYIQHPKTQEFDVKAVVSVNDAFVMKAWKENLDPAGESGIRFLADPSGSFTKALDLTFDSKAIFGND
    RSKRYAMIVEDGKVTKIAVEPDNTGTAVSLADKVLG

    >gi|85092487|ref|XP_959418.1| hypothetical protein [Neurospora crassa OR74A]
    MARVGVISPLRASMRSTAAKTGAVRCFSSYLVTPKELHEALKKAPPSPISSEPRVIPLCASWFLPNDPQKRTGLDVFIEK
    RIPKARFFDLDKVIDKRSPYPHMLPSSKDFAAAMSELGIRREDTVVIYDSQELGIFSAPRVGWTMKVFGHPKVHILNNFK
    LWIEEGLPTESGNVWTIECGTYPIPEMNEDKVASFEEVRQVAIDSSKEGSKSVQILDARSPGRWSGTEPEPREGLSSGHM
    PGSINIPFSAVLDSSTKAFLPADKLKEVFARAGVDPSKPIISS
    CGTGVTACVLETALNEAQFGSPEKSKVYDGSWTEWAQ
    RVKSSESLIEKAE

    >gi|85092766|ref|XP_959535.1| hypothetical protein [Neurospora crassa OR74A]
    MLSQRLIGRAAVRSAFKPSGLPVVVSPRLRRTYATESGLFANIKSWFSSKDSGRLTVDVPVEEKDLVIIGGGVAGYVAAI
    KAGQEGLKVACIEKRGTLGGT
    CLNVGCIPSKSLLNNSHLYHQILHDSKHRGIEVGDVKLNLAQLMKAKEQSVSGLTKGVE
    FLLKKNGVEYIKGAGAFADEHTINVKLNDGGETSVKGKNILIATGSEVTPFPGLEIDEKRVISSTGAIALEKVPEKMLVI
    GGGIIGLEMASVWSRLGAQVTVIEFLDQIGGPGMDLEVAKSIQKILKKQGINFKTGTKVVSGDKTGETVKLEVDSAKGGK
    PETLEGDVVLVAIGRRPYTEGLGLENIGLEKDERGRVIIDSEYRTKIPHIRCVGDVTFGPMLAHKAEEEAVAVVEYIKKG
    YGHVNYGCIPSVMYTFPEVAWVGQSEQELKKAGVPYRVGTFPFSANSRAKTNLDTEGMVKMIADPETDRILGVHIIGPNA
    GEMIAEGTLALEYGASSEDIARTCHAHPTLAEAFKEAAMATHSKAIHF

    >gi|85093072|ref|XP_959621.1| hypothetical protein [Neurospora crassa OR74A]
    MASTDRNAPLRLGTIAPNFQADTTTGPIDFHEFIGDNWVILFSHPEDYTPVCTTELGEMARLEPEFKKRGVKLIGLSANT
    LGSHEGWINDIKDVTGSQVQFPIIADKERKVAYLYDMLDYQDTTNVDEKGIAFTIRSVFVIDPKKTIRTILAYPASTGRN
    SAEILRIVDSLQTGDKHKVTTPINWVPGDDVIVHPSIKGEEATRLFPNLKAVKPYLRFTPLPKDA

    >gi|85093141|ref|XP_959633.1| hypothetical protein [Neurospora crassa OR74A]
    MTHFQIKVVSDIICPWCYVGKARLERAIKLYKDVIPGGANDTFTVTWHPFYLDPSLPKTGGIDPKAYLGKKLGSPERLAM
    VHARLKAIGEGEGIKFSLNGRIGNTRNAHRLIQLAKTKSNEIENKTAAALFQLHHEEDGDVSSNDMLIAAGKRAGLDGAE
    VESWLASDRGGEDVDREVAEAQRKGIHGVPNFTINGQSELSGAQDPETFVQEFLRVKAATSDVSERPSDGPSC

    >gi|85093549|ref|XP_959716.1| hypothetical protein [Neurospora crassa OR74A]
    MPTNVTDNDPAQSGATATAPVDGSATEPPKKFPKGVVLGKDGKPCRSCTSFGAWASQAKATLKTSHDMSSTAPSTIASAA
    TLSTRRTDCPADVETLGRSSWTLLHSIAATYPPAPTPSEQNDLKSFMSLFAKLYP
    CWVCAEDFQQYIKKEEPKTGSRDEF
    GNWLCEAHNEVNRKLGKPTFDCSKWQERWRTGWKDGSCD

    >gi|85068507|ref|XP_960142.1| hypothetical protein NCU05616.1 [Neurospora crassa OR74A]
    MDTRNTSQIYDEVAKHYSAASQTTSVKYGETVAKSFGYTEEELANIPEGANLGLSCGNPLAITSLREGETVIDLGSGAGF
    DVFLAATRVGPTGRSIGIDFNDDMLARANSLKSSRGFPDSQVSFLKGSITAIPLESGTADCIISNCVINLVPEAEKPLVF
    KEMHRVLKSGGRVAVSDILAKKPLPEKLRNDIAMYVG
    CIAGASEKQQYETWLKEAGFEQVLIQDTGADINVYLDTDENGN
    RGGCCAPPGTVKEEEEEKSSSCCAPKKTECAPAGAAGAAAAAPSCCKPAAETTPPCCKPVEKKESSCCKPAAKPEVEAEE
    KEDLNEWVGSYKIYAVKN

    >gi|85099508|ref|XP_960798.1| hypothetical protein [Neurospora crassa OR74A]
    MPVELRKRKAPPPPPAPVKKRATKATKAAAKAKEQVEDVASKAAETASKAAEVATETATAAAQTAAEAVANGAAKVATAL
    AGNPKVGDLIDLDNFGGEVETNDGTKTSLKKLVEESKAGVVLFTYPKASTPG
    CTRQVCLFRDSYTALSSATGLSIYGLSS
    DSPKANTTFKEKQKLPYPLLCDPSYALIGAIGLKKAPKGTTRGVFVVDKQGKVLAAEAGGPEATVKVVERVVSEMGEEGK
    TEKKKEEEEAEEKGEKKEGEEEEKAEKDEAKEEGEEKKEDKAETKEREEKAEAKESEEKKDEKDETEAAGKKDEKKNEKD
    ETEAAEKKDEKKDEKDETEAEEKKEEQDKDSETKDDDEKKAEKKDAATEEEKKKEKEDTTNGEKKDEKKKTEEKKSDDDK
    AEDKKEDKEAEEEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKKDEKTE
    EKEKEDTEMKDA

    >gi|85099869|ref|XP_960860.1| hypothetical protein [Neurospora crassa OR74A]
    MLTRSLFSRQLFAAASRPAIAPKAVSSAFRPVLFYQNRFLSDATRQAIDKAVASAPVVLFMKGTPETPQCGFSRASIQVL
    GLQGVDPNKFAAFNVLEDAELRQGIKEYSDWPTIPQLYIDKEFVGGCDIIVSMHQNGELAKLLEEKDVLVKGEEGAAEEQ
    TEKKE

    >gi|85102016|ref|XP_961259.1| hypothetical protein [Neurospora crassa OR74A] )
    MAVSTDQPPANPMFATSNSSRPTTAEKANPSLPVEPSQKSSSRPPSFVPSRKSVSTSPVDGPRFSTSDNAVAALDFQGSV
    DSNNDLPSLATIKKIENYHVLDRDGKSHTFRSLYTGKHVARRVLIIFVRHFF
    CGQCQEYLRTLSASITPDALLRLPLSTF
    IAVVGCGNPQLIDMYAQATNCPFPIYADPTRKLYQELGMVRTLALGEKPAYVTKHLIKSSFDSIITGIKQIPKGLANKAG
    DFKQIGGEFLFEPVDIQSPINAVQWEDMERTLERATRENNEAAAAAAAAERKRDSSGSRLEPDSDDKETGKGTIMKEKKI
    FGGQGHRPSEASIDGKHEDDEGEEKKVTWCHRMKTTRDHVEIPELMEVLGLDGQGEPIKDSRRWSKALETRKGTGFSMAR
    RMNTMKAEAGA

    >gi|85103303|ref|XP_961490.1| hypothetical protein ( (AL513467) conserved hypothetical protein [Neurospora crassa OR74A] )
    MDVHLLVYDLSRGLAKQMSVGLLGFQLDAVYHTSIQLNGREYVYDGNIVSIIPGSSHLGRPLEEMYLGKTEFQCADGIVP
    SANGSDRGVFRLTEGNLHSRATFLLGKGIPDYIVNMPQTVLSSPMGQMLMPMLNQQIHANKRGGGILGIQQNTPGSTSKP
    KAELHHHEGKVHNVTNLNELQSLLEKFQNSCAVVFFTSAT
    CPPCKVLYPLYDQLAAEVGDKGVLIKVDVLAAFDVGSAYS
    VSATPTFVTFLKGKQENRWSGADRGALQGNVRLLVQMAWPAHAHQSLNLPTFSNPGTKPVLYTKVPPLEKLLAKMGSDAE
    NPAVQGVKHFIEARSQDGPAEATLPDMAAFTTFVRQSIKNVPTDTLFTVVDLMRIGLVDPRFSGYLAEEVVHGTVTALLE
    HINDLKECPYALRLVTLQMACNLFSSQLYADEVLSNDKLRTCLTQLVSASFLDDNHNNVRVAAASLLFNIALANSRKRQD
    GPGDVLPQDDQIELAASILEAIAQEESSGEALEGMLLALGYLAYRMPLDGELSDLLRTMDAGNSILEKKKAFPDMKLIDE
    VGSELLGRGLNKP

    >gi|85103410|ref|XP_961515.1| disulfide isomerase ERP38 precursor [Neurospora crassa OR74A]
    MVLLKSLVVASLAAAVAAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELATALEYAKDKVQIAKVD
    ADAERALGKRFGVQGFPTLKFFDGKSEQPVDYKGGRDLDSLSNFIAEKTGVKARKKGSAPSLVNILNDATIKGAIGGDKN
    VLVAFTAPW
    CGHCKNLAPTWEKLAATFASDPEITIAKVDADAPTGKKSAAEYGVSGFPTIKFFPKGSTTPEDYNGGRSEA
    DLVKFLNEKAGTHRTPGGGLDTVAGTIAALDEIVAKYTGGASLAEVAEEAKEAVKSLKNSAELKYADYYLRVLDKLSKSE
    GYATKEFARLEGILKKGGLAPAKVDELTVKVNVLRKFVEKAAEEAKEEL

    >gi|85103722|ref|XP_961585.1| probable glutaredoxin 8D4.220 [similarity] - Neurospora crassa OR74A [MIPS]
    MSDAATQKAKQLINDNAVVVFSKSYCPYCSNTKQILDGLNAKYATYELNQESDGSDVQDALLKLTGQRTVPNIFIGKQHI
    GGNSDLEAVVKNGKNGKKIQELLQEAGAL

    >gi|85105224|ref|XP_961916.1| hypothetical protein [Neurospora crassa OR74A]
    MLSAPTRRSIARLSAGAVKSIGSSGTTPVACTFSVTNATLRKAAAAAATTAAAAQQPQVPAQRAFSTAVRPRNTTRTTTR
    AARAARAAYYSQEAQGKGNKGAENKIWAFEEIQTLIEDPNRKVIIIDPKKDTREPGELHQTGRIPTAINIPITTSPDSFF
    ISEDEFEDRFGFPRPSKDSEVVFY
    CKAGVRSRGAAGLAREAGWEKVGEYPGSWLDWAARGGKVER

    >gi|85106433|ref|XP_962185.1| hypothetical protein [Neurospora crassa OR74A]
    MNTLVTGAAFGAALTVSGVYQPSVIVSQLKFENWHMIQAFLTAAASSAALVHLLQTLSPTAFPLPPRSYSSISLFSRYDG
    NLLGGILLGTGMMLSGACPGTVLAQIGTGVRSGFYALEGGIIGGIVFTGFVGPWIAKRNAAAKAAEAAAKARGEGEESKE
    LTKTVYENLGVSKSNVLVAFEAICASVVVSTALWTSVGPEAKISPVVGGLCIAGAQLLSLLLRKNLVGTSTSFEEVGDWF
    WGIFKGKTLPQRYNNLLFVSGCVLGAKLLTVAYPALGQVTDVAVSPVAAGLGGFLMIIGSRMAGG
    CTSGHGISGISLLST
    SSFLTIGAAFGAGALLGLLRG

    >gi|85106854|ref|XP_962263.1| thioredoxin [Neurospora crassa OR74A] )
    MTVSRYNSVAEFKEAIAKHPIVVLDAFATWCGPCKAIAPTVAKWSEEPQFKDTVYFAKFDVDALPDLAQELGIRAMPTFV
    IFKNGDKADEFVGANPPALLATITKQL

    >gi|85107468|ref|XP_962378.1| hypothetical protein [Neurospora crassa OR74A]
    MRWLPLFLGAARLAVAASTTTETETEDEVKVYTKFNDVPVPPLIELTPDNWEKESKASKWLMVKHYSPYCPHCIDFAPTY
    QTLYEFYYTSKPVGDENANFTTFYDFRFGTINCVAYYDLCSAHKASSYPTTTLYKNGEQVAALKGVKSMPVLSEIVEKAL
    EATKPGSRPAKLELPKPGEIVAPGYVPKVAAPQDTKETSNVDIAKDVPKVDLVKDSATVEQPVKDTFITGNDEYLMPTPK
    TEDKATEKVVDKVVDKAADKATETKATETKAVESKAASKADPSTEATAKIEKAKGKEEEEKKKSTSPAYYEAPAVAAAAA
    ASIKGNKPKTTPNPNGISQPLTAESFQSQVTMTQEPWFIKFYAPW
    CHHCQAMAANWAQVAREMKGRLNIGEVNCEQEARL
    CKDVRVTGYPTIQFFRGGERVEYTGLRGLGDFLAYAEKAIDISKGVQDVDAASFKALEEKEEVIFVYFYDHATTTEDFLA
    LERLPLSLIGRAKLVKTRDPELYDRFKITTWPRLLVSREGRPTYYQPLTPNEMRGTRQVLNWMKSVWLPIVPEMTASNAR
    EIMDGKIVVLGLLNRDDEESFNGAIREMKSAASEWMDKQIQLFQLERQELRNAKQLRIEEAEDRNDQRALRNAKNIRINM
    DRADRKEITFAWVNGVFWQRWIRTTYGIDVKDTGDRIIINDEDNRRYWDQTTTGNPIVPSRTSILETITKISQNPLNIKP
    KLTISAFEKLFFDIRMTFSEHPYLSMGCILGIAFGCLSWFRNSARAQRRAGHGTHFKLEEGGIGAPSEKGSTGGFIQSVF
    GGSGGSSNGPKAD

    >gi|85109377|ref|XP_962887.1| THIOREDOXIN [Neurospora crassa OR74A]
    MSDGVKHINSAQEFANLLNTTQYVVADFYADWCGPCKAIAPMYAQFAKTFSIPNFLAFAKINVDSVQQVAQHYRVSAMPT
    FLFFKNGKQVAVNGSVMIQGADVNSLRAAAEKMGRLAKEKAAAAGSS

    >gi|85109504|ref|XP_962949.1| hypothetical protein [Neurospora crassa OR74A]
    MPPLRCANAPAPASLFVQMSMRRTAPFSVLADILLPLRARAHHNVARRIATVSTTTPVSKTPWRARQSLSSSQFNMRLFT
    TTAPSKATHTLFNPQNDEDGNEMRLSEIMTKDSNPYLALRIQVESGG
    CHGFQYLMKLVTLPEQLPQLPLAEGAAEESEIR
    EDDTIFSYYPDDSPAPASPDLTLPKIILDGPSLELLKGSKVDFTMELIGSQFKIVDNPLATSSCGCGTSFDIKI

    >gi|85110659|ref|XP_963568.1| hypothetical protein [Neurospora crassa OR74A]
    MNAQRILSRRTLSSALCNSNRTVAHAQRHQFSTTPSPAVTAFQSYTLPSHPPSPPRSGNDSMAFPVQPPMPRVHETRPHK
    IASPPKQQQQQQQQLNNFAQTSPSTSSSPSQPTPVAPKQEQSKAAAAAAQASSAPTQPTPSKPAPRASRLRAPRKAAINL
    TSAAVEHLRAMLDQPEPKLIKVGVRNRG
    CSGLAYHLEYVDKAGAFDETVEQDGVKVLIDSKALFSIIGSEMDWVEDKLSQ
    RFVFRNPNITRGGPGVEAEAPFSRTVMRDTTRL

    >gi|85111703|ref|XP_964063.1| hypothetical protein [Neurospora crassa OR74A]
    MSTIKDITSIEAWNNHVSSLPASTLLIVSFHAPWAAPCAQMATVLKTLASEYPVTEPLSTSWVSIDAEELSEISETYNVT
    AVPFLVLARNNQVLETVSGSSAVKVRNAIETHAKKSAQFGTEASEKTPAIANGAATAEGQAGDVVPQDPKKQKEELFRRL
    GDLVKAAPVMLFMKGTPSEPK
    CGFSRQLVAILRENAVKYGFFNILADDEVRQGLKEFADWPTYPQLWVDGELVGGLDIVK
    EELANDADFFKPYSVKANGDASAGQS

    >gi|85111985|ref|XP_964200.1| hypothetical protein [Neurospora crassa OR74A]
    MSALKAGDSFPEAFANKKVVLVAVPGAFTPTCQQQHVPSYLAKLEEFKSKGVDQIIFIASNDAWVMAAWGKANGVKDESI
    LFMSDADCKFSKSIGWTQGDRTKRYAIVIDHGKVTYAELDEVPKSIANTGADGVLAKL

    >gi|85112518|ref|XP_964356.1| hypothetical protein [Neurospora crassa OR74A]
    MHHSTLCALAVGILSALPGAQAGLYTKKSPVLQVDGKDYDRLIAKSNQTSILEFYAPWCGHCQNLKPAYEKAAKNLEGLA
    KVAAVNCDEDANKPFCGSMGVQGFPTLKIIRPSKNGKPIVEDYQGQRTASAIVDAVVSRINNHVVKVEDKNLDKFLSDKN
    ETAKALLFTDKGTTSPLLKSVAIEFLGVMPVGQVRNTQSKAVSTFGVDKLPTLILLPGGDAPGIVYDGEINKAAMVEFLS
    QAAQPNPDPAPANGKTNGKTNGKTNGKANGKANGKANGKANGGEKNGKQDSKKVASSETSSETSSETPAPTQEIPVIIHT
    ALPIPSLNTPEKLVKECLTSKSSTCLLALVSSSNEKAQKALTHLAEIKFKYALGQHKLFPFYEVPLDTNPAGASLLKSLG
    LKEDADIELIVINARRGWWRRYDAVGEGDDFSDHDKVEAWIDAIRLSEGTKKKLPEGIVVEASSTEEEEKKKEKKESGKA
    EKAASKEGETPEAQSKTASGHDEL

    >gi|85112689|ref|XP_964389.1| hypothetical protein [Neurospora crassa OR74A]
    MQNGGASSDQNGSISSVPRDTSRPLTEDELDRYSRQMIVPGMGKEAQLRLINAKVLIIGAGGLGCPAAQYIAGAGIGTIG
    IADGDTVERSNLHRQVGHSTSRIGQSKVSSLITHLRGLNPLPTYVAHTTHITPLNAADLISQYDLILDCTDNPATRYLIS
    DVCVLLCKPLVSAASVQTSGQIIVLNCPPTPQGQLDGGPYPPCYRCCFKKPPPANAQLS
    CGEAGILGPVVGLMGVAQAGE
    AIKILASALHIPTTTTTTTSPPAQGVPRAAPVVEPTLLLYSYSLTSFLSPFTFRALKMAPRKKNCFACGEGSKQRLTLEG
    VKNGEPNYDFFCGLGGGGPEKGVLSEEERITPREFVERVQGKDGNGKGKKYVVLDTREKEHFSFGSIEGAVNLPFGKLLS
    KAAQLKRSGETPKVGDILPPEIQVRDGHGDKDIPIYVVCRRGLDSQEAVEKLKEMGLDNGGSRKIVDIAGGMKAWKEQVD
    PSFPYL

    >gi|85113776|ref|XP_964583.1| hypothetical protein [Neurospora crassa OR74A]
    MSHAIAPMRTFSSVLSRTPARQCQRFISTATTTRPTVPRLQAQLHQPVAQRRTYKTVEEAKSKYRSGPFSWKAGLLFVLT
    GAGLLWYFEHEKQRMQRKRIADATKGVGRPKVGGPFELIDQNGKPVTEKDLKGRYSLVYFGFSH
    CPDICPEELDKMAAMF
    EKVEAERPGALKPVFVTCDPARDTPQVLKEYLAEFHPLFIGLTGTYDQIKAMCKAYRVYFSTPSKVEPGQDYLVDHSIYF
    YLMDPEGDFVEALGRQHSPDQAAKVILDHMKDWQVLLSGSDTERWCLKVLGYASGGLGSLLSL

    >gi|85113895|ref|XP_964601.1| hypothetical protein [Neurospora crassa OR74A]
    MKPASRLFYLSLFALWSPEAQCKSDESCAISPKAIVSDACASYSTLEQLNRDIKPALEDLTRTTDFFSHYRLNLFNKECP
    FWNDENGM
    CGNIACAVETLDNEEDIPEVWRAKELGKLEGPRAKHPGKSVQKEEPKRPLQGKLGEDVGESCVVEYDDECDD
    RDYCVPDDEGASSKGDYVSLLRNPERFTGYAGDGAKQVWDAIYRENCFQKSSFPKSASLGDTYSVPKNPAAQDFRAVMQA
    AGRQHMLEQQREQNPLVPFVTKTGLESEDECLEKRVFYKIVSGMHASISTHLCWDFLNQTTGQWQPNLSCYINRLHKFPE
    RISNLYFNYALLTRAVAKLGPYLSSHEEYTFCTGDPAQDADTRAKVLAVTSKAANTVPGPVFDESIMFKNGEGPSLKEDF
    RNRFRNISRLMDCVGCDKCRLWGKLQTAGYGTALKVLFEFANNDTSATSSETDEIPFKLKRTELVALFNTYARLSSSLDA
    IQKFRAMVEESEEGQQPQSHEQIEGSENSGAHHIPDRAKKPRHVIVPTPDAADHAEASDTNTATTAVDEAKAAGVTPAPK
    VEHQQQVEVDNNDDDDDDDEFHEFQRQPQQPDTDPNFVYKKRTLKDDFENEFRAVFAAFKLVIRSYLNLPALIYEITITE
    LKRFWQFYVGLPVMPRTWEFRRPSLDEL

    >gi|85114535|ref|XP_964710.1| hypothetical protein [Neurospora crassa OR74A]
    MPRQVDSYLELLGHDIIHGAGWEPTTRVPRADKTAPLPEPEHGLAIPGLPASGGSCQGLTRGPEAGQGHGSKNPKLDTLL
    SALTYLHVPTLSKLPRTLSSSIRTPFVRKLNTRSPPVPLQVHHCTMFSASSSNPSTQKPASVDTSLQGSPTGAAALFASS
    HSSPHPLKLYGGWF
    CPFVQRVWITLAEKNIPHQYIEINPYHKAPEFLALNPRGLVPTLAVPTSTDPKTGKVKEVKPLYES
    LVLCEYLDEAYADENVYGDRLLPQDDAYERARCRLWIDHISSRVVPAFYRFIQHTPDKPYTIDEIRTEFHGHLKAFAKEM
    LHASSPSSSPGPFFLGDKFSLVDIMLAPWAKRLFLIDHYKPGGVGIPPSGQRGSEVDEEIWKRWEEWYKAVTERESVKKT
    WSEDEQYVGAYKRYAEDTTQSEVGRATRSGRGLP

    >gi|85117048|ref|XP_965167.1| hypothetical protein [Neurospora crassa OR74A]
    MPSQRRMRALLYIALAGFITLLFFTSRARHAQEPDPRSIQDFYHKTKSAMEGSRIGGGSRRGQAVVGTQKVEFDEDDAIV
    AKAMQERLRKAEQMAKSNANAKAPNKPDDPEAVVGVGSSAHGQNHLGKGDSVETEEHHAILEELRSILKKSPIIIFSKSY
    CPYSKKAKSLLLGDYQIDPAPYVVELDQHPLGPGIQAELGDRTGRKTVPNILVGGISIGGSDDIAKLDQEETLIEKIMSL
    AGKRLTVTKHSKSN

    >gi|85117384|ref|XP_965244.1| hypothetical protein [Neurospora crassa OR74A]
    MAPAYIQVPSGHMATTTLKVEGMTCGACTSAVEAGFKGVNGVGSVSVSLVMERAVVMHDPDQITADKIKQIIEDRGFDAE
    VLATDLPTPMIARHPEQDLEASDDSPLMITTVAIEGMTCGACTSAVENAFKDVSGVRHFSISLLSERAVIEHDPTLLSAD
    GICEAIEDRGFGATVVESVHKQPERESVPGAATSSQPSNATTTVAIEGMT
    CGACTSAVEQGFKDVNGVLKFNISLLAERA
    VILHDPTLLPADKIVEIIEDRGFDAKILTSTFDQPSQSGGTSTAQFKIYGNIDAAAANKLEDAVLALPGVASAKLAIATS
    RLTVTHLPNVTGLRAIVETVEGAGFNALVADNDDNNAQLESLAKTREINEWKQAFRISAAFAIPVFFISMILPMFLKFLD
    FGKVRLIPGLYLGDVVCLVLTIPVQFGIGKRFYVSAWKSIKHKSPTMDVLVVLGTSCAFFFSIVAMVVSILFPPHTRPST
    IFDTSTMLITFITFGRFLENRAKGQTSKALSRLMSLAPSMATIYADPIAAQKAAEGWDRNADSSDSQEPREGNAADEKVI
    PTELIQVGDIVLVRPGDKIPADGVIVMGETYVDESMVTGEAMPVQKKKGSLLIGGTVNGAGRVDFRVTRAGRDTQLSQIV
    KLVQDAQTTRAPIQRLADTLAGYFVPMILFLGMMTFFTWMILSHVLSTPPKIFLEDASGGKIMVCIKLCISVIVFACPCA
    LGLATPTAVMVGTGVGAENGILVKGGAALETITKITQVVLDKTGTITYGKMSVAKTNIVPVWLDNDWRRRLWWTLVGLAE
    MGSEHPVGKAVLNAAKTELGLEAEETIDGTIGNFTVAVGQGITAEVEPATSLERTRYRVHVGNIRFLRDNDIEVPESAIN
    AAEEINEAAASSRYKSTPSNTPAGTTTIFIGIDGKYAGHLCLSDTIKDGAAAAIAVLHRMGVKTAIVTGDQRSTAIAVAS
    AVGIDPEDVYASASPDQKQAIIQQLQSRGAVVAMVGDGINDSPALATADVGIAMSSGTDVAMEAADVVLMRPNDLMDIPA
    ALHLARTIFRRIKMNLAWACMYNLIGLPFAMGIFLPFGYHLHPMGAGAAMAASSVSVVVSSLFLKFWARPKWMDKTLNEF
    EMDTIGGGPIKGRMKKRGAGWGLFGGVVSKVRDLLGVGAARRNMDDGYVPLDNLDAAEHAV

    >gi|85117428|ref|XP_965255.1| THIOREDOXIN REDUCTASE [Neurospora crassa OR74A]
    MHSKVVIIGSGPAAHTAAIYLARAELKPVLYEGFMANGIAAGGQLTTTTEIENFPGFPDGIMGQELMDKMKAQSERFGTQ
    IISETVAKVDLSARPFKYATEWSPEEYHTADSIILATGASARRLHLPGEEKYWQNGISA
    CAVCDGAVPIFRNKHLVVIGG
    GDSAAEEAMYLTKYGSHVTVLVRKDKLRASSIMAHRLLNHEKVTVRFNTVGVEVKGDDKGLMSHLVVKDVTTGKEETLEA
    NGLFYAIGHDPATALVKGQLETDADGYVVTKPGTTLTSVEGVFAAGDVQDKRYRQAITSAGTGCMAALDAEKFLSEHEET
    PAEHRDTSAVQGNL

    >gi|85119569|ref|XP_965663.1| hypothetical protein [Neurospora crassa OR74A]
    MSSPEVLPDSEAKRWKYLNNVRTRPGAFVDPEEFDGSTVVENMNKIKIFGAGGLGCEILKNLALSGFKDISVIDMDTIDI
    SNLNRQFLFRHADVGKFKAEVAAKFVERRVKGVKITPYNCKIQDFDEDFYQQFQIVVCGLDSIEARRWINATLVNMASCE
    NPDSMKPLIDGGTEGFKGQARVILPTMGSCIECQLDMHAPRAAVPL
    CTLASIPRQPEHCIEWAHVIAWDKEKPFPQLDKD
    DPEHITWLYQKALERAKEFNISGVTYSLTQGVVKNIIPAIAATNSVIAAACCNEALKIASSCAPFLGTPGEGEPNYMMYS
    GNDSIYTYTFKHEQKEDCPVCGMTARVLKVNPKWTLEELIESFATLPEAQLKKPSVRAEGKTLYMQLPPNLEEQTRPNLE
    KTLEQLGLTEGTELAVTDPAFVGVVFNFSLKFA

    >gi|85074741|ref|XP_965738.1| hypothetical protein NCU00598.1 [Neurospora crassa OR74A]
    MASDLKLVSHLYADWCGPCKMIAPVFESLSAKYSKPNKITFCKIDVDSQQEVAQQYGVRAMPTFLILHNGSVIETIQGAN
    PPALTAAVDKAVKLAGGAAGGGAVFKTAGHRLGGSGVAGSRPGTSVARPFKWDFNSLIKTIIAFIGLYVTSLFSVRDHCH
    PSRIWTRFTNKVLIQLDPYKAAESSPFNKKNSPPQSQSYTGSAASKKPAPRATFKTLSDLGN