Nasonia vitripennis

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|156542755|ref|XP_001600851.1| PREDICTED: similar to selenoprotein M [Nasonia vitripennis]
    MKPSRVAVFAISAIVLSVLTDLAFASKGMYSRAVVESCRGCQLNRLPDVKAFILEDVPLYDNAEFKHIQGAPPELVLYDH
    AEKEIERLQIGLLTREECNELMYEKGFKKSKPIKDEI

    >gi|156542757|ref|XP_001600982.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MNIRCKNIHFLFLVLVIQAIGIIGEEETQVVAEENLESLPSDQPAETKNEITEVDPEAFSEFKETDLLSNATSSEVSSQE
    KSNVTITDASVTNFTKVNCLIDKTYGPVEIVNYTRLMELLILDIGTPNRTRNSKEDKQLPGACILVMFYARW
    CVFSSQAA
    PHFNAIPRFYPHLKVVAIDAMKYQNFNTQYGIVGVPTLMLVHNAKPVAKFNATVYNLETFSKFLSQFTNLQPNDSLYVTS
    ADFSGPVSSTPSNETDYCLVLSWVFIAACLLYFTTKSHWWRQFIELVQNTWRESNAQHEHAD

    >gi|156543266|ref|XP_001606764.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MAESTEDVGAEESTSKRPQFGNRTLDHKDNVFRHNAWDNVVWDKEQEETAQRKVEENSKVSASAEEIAKYEDEADKFWDK
    FYGIHQNRFFKDRHWLFTEFPELARNAVKQDKERPLRVLPESQSGSADQESNSMDNSMEPARRIFEIGCGVGNTVFPLLL
    YNNDPELFVYCCDFSSAAIEILQKSKEYDTKRCKAFVLDATLEDWNPPFEENSLDIIILIFVLSAIHPEKMQHVVKQIHR
    YLKPGGLVLFRDYGRYDLAQLRFKKGR
    CLAENFYVRGDGTRVYFFTQDDVRELFTNCGFSEVQNLVDRRLQVNRSRQLQM
    YRVWVQCKYRKLPDT

    >gi|156538224|ref|XP_001602519.1| PREDICTED: similar to GA22042-PA [Nasonia vitripennis]
    MNSRLSIVFVALAAFGCLSSAAGEKLTVDVYYESLCPDSVYFITKELAPAYNDLKSIINVNFVPFGKASWVVGEQSKRTE
    FTCQHGPNECRGNRAQACALYEIEQTIKAEDQQQQKKVDVVSCVMGSRNPASAVLQCAERNGLSTGSVQKIQSCARTDLG
    SQLLVAQGEKTKAFESPLTFVPTIVINGEKKSEAFRNFANTVCQLIPDGEKPSACSQY

    >gi|156537209|ref|XP_001604879.1| PREDICTED: similar to ubiquitin-activating enzyme E1 [Nasonia vitripennis]
    MNSRLWSAIKRRDEGETRKLLLQGARVDARQKHDGYTYLMLSTSCDDLTITKMLIDFGCPVNVISRYGNCTALHLAVAYV
    NYDIAFELIKAGANVHIKNQHGGSTALHLAVVDLTHVDLLGEVVPNVQLKEKNAYCMDCIRFADMSRSKSGICVTIASDS
    NNWIKKRILLVKMLLDVGADVNAKDNNNCTAIHSAVYTGDLQLMKILIEAGADVNNQNRIGATPLHEAILCRNAEMVNLL
    LNSSANVSAKTVLGNTPLHWASMLNVDAAILTNLMKFQSSCIDDLNADGLSAFDVLLQNGDPMSVKLFVEKYDANLMHVD
    NNGVTALHHAACNPDPNLLKLVLDSTAGGLAVDQACNNGLTALHVASKELLPQNVRLLIARGANVNAKDKHGKTALFLSV
    HGSNTSENLKKVTELLLEHGTDLNQKYIEREAEKTILQVSIQGVCSIVTRMIIMHAVKVEFKTNQRVFDDYNLAVIQDDE
    LAMRQYSAARNELMIMSNSVFEDTSITHLALLTGSEREVLRYARNKNLLKAFENSYDRTTYLYYGPIMKRRFDAAVAKQK
    DMENVCIILSELLRFAGPEHPAFEIIFHGLSDEDVKFLLDQSKVLVVGAGGIGCEILKNLVLSGFPDIEIIDLDTIDVSN
    LNRQFLFQKQHVGKSKAAVARETALTFNPDVKIIHHHDSITTTDYGINFFKKFTFVMNALDNRAARNHVNRMCLAAEIPL
    IESGTAGYDGQVELIMKGLTQCYECTPKVAQKTFPG
    CTIRNTPSEPIHCIVWAKHLFNQLFGEEDPDQDVSPDTADPEAA
    GDTAGEGALQTEANDKGNVERVSTRTWAQSNSYDPEKLFTKLFHDDIKYLLSMDNLWKKRRPPVPLDWNNLPDGVAGCSR
    DESETGLRDQQQWSIAKCGLVFAESIKNLSTAFTACREKSATDHLIWDKDDQAAMDFVAACANIRAHIFGIPQKTRFDIK
    SMAGNIIPAIATTNAIIAGVVVLHAFRILLKKLEDCKSVYLRPKMNHKNQLLVPEKCINEPNPKCYVCAKTPTAALAADL
    KKMTVKQLEDTVLKAGMNMVAPDVMIDGKGIVVISSEEGETEQNDDKVLEEVGIVDGAILSVDDFLQNYSLKVTVVHREK
    PLPNSDEPEFVITADAEDLKPKEEENNVNEKPSTSNGQSTKNDVEVSPQTSEPGSAKKRKTEPIVDGTPSKKRKIEVNNV
    SDSDDDICIVEHDSSTSVTSQLPSKYKSIAPAPSNDDDDDDCFIIDGPDDDFYVITN

    >gi|156546314|ref|XP_001606269.1| PREDICTED: similar to Dnajc10 protein [Nasonia vitripennis]
    MIRLEVEELDFYRISETKIFDEGLCNRCLCKLTFTKLQAKPGSFSIVSTPLYLDLAGNIVTRRSSILITLFVFASLTSAE
    DYYKLLGVERTADQRDIRKAFKKLAVTEHPDKKTDDPEAHERFIKLTTAYEVLKDPDLRKKYDLYGEEGLDDSKRRSNYH
    SYTYYQNNFGIYDDDPQIITLNRNDYFDSVTESEKMWFVNFYSPQ
    CSHCHHLAPVWRKIAKDLEGVIRVGAVNCEDDWHL
    CSQVGIQSYPTLMHYPPNSKQGVRYKGEKSYEEIMRFVLDKIDADIREISKSVWNLLFEGNDKSIENPVLIFVCGENRYC
    FTKDERLRIAAIFDEMVDVKVFHCKDNDCGSVLSDSTGVVYLPPPNDANFKPVLFEDVLEVEDLVKKILEQLPEPQDIND
    DQFEDILDDLKRKSNDGWLICFYIGHATDFDVLLKHLPSILKDVNLAKINCGRYSTLCKNLNVNHYPAWGVLKPGGAFEL
    SHGKNTMNDVANFAKSSLKAQNVWALSAQKIHDILGRQNGEVWFLDWYAPW
    CPPCMKFLPEVRKASLEFDSSVLHFGTVD
    CTTHAEICRQYNIRSYPTAMLVNGSTTHHFSTQRTAPHIVEFINEAMNPTVIHLTSNNFDKKLGKKRGRHLWVVDYFAPW
    CGPCQQLAPEWTQVAKALKPLSNVKIASVDCEAQKSVCQAQSIRSYPTIRLYPMGSEGLNSVALYNGQRDATSLLKWITQ
    FLPVKVQDLNDHNLEKSVLKTDDIVLVDYYAPW
    CGHCIILEPQFAIAAQLLENKVRFARLNCDHYRYYCGQAGIRAYPTL
    KLYSTRQHRNSLQDGIRIKASTAESIRDEVLALLPKNPAVEKKPTLAQQDNP

    >gi|156538242|ref|XP_001602405.1| PREDICTED: similar to protein disulfide isomerase, putative [Nasonia vitripennis]
    MVSLTRILLFATYCVIVNSTAASRVLELSDRFLDIHKEGQWLVMMYAPWCAHCKRLEPIWAHVAQYLHSSSIRVGRIDCT
    RFTSVAHSFKIKGFPTILFLKGDQQFVYNGDRTRDEIVKFATRLSGPPVQEVTRTTSFNTLKKDRDLYFLYVGEKSGTLW
    DSYNNIATVFQPHAFFYHSHPVVVEKHAPIEKTPALFVYKENLHYNFTDHHTITDKDKLNETLYKWVNAERFPTFPKVTR
    GNIHQLYLTNKNLVLAVVEENQLEEVPPDMLEFKEMVESVIKKKRQKYHDHFQFGWITNHDLVNSIAMMVVPLPSLIVIN
    STTSHHYIPDDEPEKLTPHVIELFLENIQNESAPKYGGNSWIVRIYRSWFEVRSALASMWKGNPVLTIVLFGLPAIFLLM
    ICYHIWCPDIFDADEEEEETKGSSHIKKD

    >gi|156545822|ref|XP_001606135.1| PREDICTED: similar to LD41494p [Nasonia vitripennis]
    MLSYCDSRAARLVGIVCLLIFAQCTSVSGEATGATSLNQDNIDMTLASTELVFINFYAEWCRFSNMLQPIFDEASDKVRE
    AFPEAGRVVMGKVDCDKESSIASRFHITKYPTLKVIRNGQPSKREYRGQRSVEAFVEFIKKQLEDPIKEFHDLKELRDLD
    DKKRMIIGYFDRKEVPEYQLFRRVATNLKDDCQFHVGFGDSSKAMHPPGQPIIVFRSDKALSNDDDETYHGSLTNYDELN
    IWAQEKCVPLVREITFENAEELTEEGLPFLILFHDSKDTESVKQYKDIVMNTMYDEKQNVNFLTADGYKFAHPLHHLGKK
    LSDLPLIAIDSFRHMYLFPNFQDIFVPGKLKAFLQDLYSGKLHREFHYGPDPNNNKIPQLEGKVPTSPPESTFKKLAPSK
    NRYTLLRDEL

    >gi|156548334|ref|XP_001603220.1| PREDICTED: similar to thioredoxin reductase [Nasonia vitripennis]
    MPPIGEFIASSSRENLEILAGYILYLVHILYILSLLRKFFCAISSARSLNTDQYQYDLVVLGGGSGGLAAAKQATELGAK
    VAVFDYVIPSPQGTKWGLGGT
    CVNVGCIPKKLMHQAALLGEAVHEATAFGWQIPEVKSVKIDWEALTTAVQNHVKSVNWV
    TRVELRNKKVEYINALGYFKDPHTIGGIMKNGEEKVVTAKNVLIAVGGRPNYPDIPGAVEYGITSDDIFSLSKPPGKTLV
    VGAGYIGLECAGFLNGLGYDATIMVRSIILRGFDQQMANIIAEEMETRGVHFIYQAKPKALEKQADGSILVHWVDKDGQI
    HKDVYDTVLFAIGRKALTKDLKLENAGVFVVPENEKIDALNEQTNVPHVYAVGDVLHKKPELTPVAIHAGKLLAKRLYGN
    ATELMDYTNVATTVFSPLEYGCVGLSEEQAIAIHGEDSIEIYHAYYKPTEFFVPQKDNSRCYLKVVALRNNDQKVLGLHF
    VGPNAGEVIQGFATAIKCNLTFPLLKSTVGIHPTIAEEFTRVNITKRSGMDPKPQSC
    CS

    >gi|156542307|ref|XP_001599351.1| PREDICTED: similar to GA12415-PA [Nasonia vitripennis]
    MSIYFGMAKLTRSVWGLSSNFSSNQYFSRLLATPWIPASDLRLRNSSTKVASSACEDEILISDSCVKRLKEITEEGSCLR
    VTVEGGG
    CSGFQYKFNLDSSINKDDKVFQKDGAKIVIDSTSLEYIKGSTIEYHTELIRSAFRITDNPLAEQGCSCGASFA
    IKVD

    >gi|156537243|ref|XP_001605359.1| PREDICTED: similar to protein disulfide isomerase [Nasonia vitripennis]
    MKFTLSLFAVLACLLGAAFAKIETEDEVLVITKDNFDEALEKHPYILLEFYAPWCGHCKALAPEYAAAAKKLVEQNSEVK
    LGKVDATIESDLAEKHKIRGYPTLKFYRKGSQIEYTGGRKADDIINWVLKKTGPIAKDLSTVDEAKAFIEANNVAVVGFF
    KDAESENAKVFLEVANSIDDTVFAISSNADVFAEYGVEDGKVVLFKKFDDNKAEFADEHNVANLKKFIQVESLPLIVEFN
    QETARTIFNGDIKSHLLVFLSQEAGHFDKYADDLKTPAKEFRGKVLFVTINADDADHERILEFFGMKKDNTPAMRLIQLE
    EDMAKYKPENSEISADNVKEFVSAFLDGKLKRHLLTQDLPEDWDKNPVKVLVGTNFAEVAYDKSKNVLVEFYAPW
    CGHCK
    QLAPIYDQLGEKYKDNEKVVIAKMDATVNELEDIKIASFPTITLYKAETNEAVEYNGERTLEGLSKFIDSDGAYGEGADE
    TEEEDEDDDAPRKDEL

    >gi|156554855|ref|XP_001606659.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MRSYNLLIKIFMAVLVLVIFWQISNLWKSATPEKSELEKLIEKQQIQPVVVTVFYEALCPDSRSFIKHQLKPTFDKIEDY
    IDVNLIPYGKAETIVTSDDYEFKCQHGETECEANMIHACAIHKVLNSRRRLELVECMISNNMHPQAILETCAKGMDELKD
    IVQCSKSMEGRKMLKRFGDLTKSLDPRVSFIPTITLDHEIDNQILILKNLLRQVCQRLDSPPSECKS

    >gi|156542825|ref|XP_001608075.1| PREDICTED: similar to thioredoxin-like protein [Nasonia vitripennis]
    MGLVRVINDDGHFHGELSNAGTKLVVVDFTATWCGPCQRIAPVFEQLSTKYPNAVFLKVDVDKCAETAAGQGVSAMPTFI
    FYRNKIKLDSCQGADPAGLESKIKQFYGSGDADDSEGSVAGHMDLSSFIMKAQCECLNESDDHCLDHCLTSNGGYLESDC
    DEQLIISITFTQAVKVHSLKIKAPADKGPKNLKLFINQPRTIDFDMADSNTSVQDLTLSAKDIEEGNPVQLRFVKFQNVQ
    NLQIFIKDNQSGSETTQIDHLVIIGSPISTTNMGDFKRVAGKKGESH

    >gi|156549385|ref|XP_001602237.1| PREDICTED: similar to l(2)01289 long form [Nasonia vitripennis]
    MSTTNDASRGQQHQHLHRRCCFLLLLLLLLLTWFGASPASAALRASSKDQPTQQHHGKEPGGGGGGGPGHGKLKEDPVIE
    EVTSKQLERLLKEKDFVAVYWYARSCTTCDKVLAELEKIDDDTDTFGVDFVKINDKRLAKQYGIKTFPALTYFREKEPII
    YEGDLMDEENVLEFLTSLEAMDLPDRIEEVNAKILSKIVEDADFVAVLFCPGAERCAGADFNKPDCKKCARALQELENID
    DEADQLGIGFVKIADERLAEEYNLGPLPVLVYYRHQIPIVYEQELSREEDVLEWLIANKSTGDEEDVIEDVTAKTLTTLI
    GNIDNLVVLFYDHGDEDSMQVLTELEKIDDDCDKHGIQFVKIDDVKAAKEFGIDSIPAIVYFEKQLPNVYDGDLQNEDEI
    LEWLLSQLEKDEIEDVTDEMLDRLVKEGKTLAVLFYDNNDRKSQRVLNELENIDDECDQLGVVFVKIDNAEEAKEYGIEK
    IPSLLYFEKGIPTLFEGNLEDEEKVLKWLDSQQKSDHIEDITDEMLDMVIDKMPHVAVLFYDKDQKKSAKILAELENIDD
    DCDEHNIAFVKIDDAEEAKEYGIDQLPTLVLFERKIPHIYDGDLMNEDQLLGWLLHQKKHSEIPEVTDEMMEKLIETTPY
    LAVLFYDKDDKQDIRILNELENIDDELEKEGIVIIRIDNDAEAKEYGIDHLPTLVYFEDKIPALYEGDLLNEDEVLKWLI
    EQKNTATIEEVTDEILKDLIDEHEYVVVYFSGNCEDGDECETVLKELENIDDELDETGIVFVTTEDTGLAKKHGIKNLPT
    LAFFRNKEPLIYKGDIEDEDEVLSWLTDENTLEIPGKIEEVNARMLENILDENDYVVVFFYKEGDKKSQKILQELENIDE
    ECEEKDIDFVKISDEGIEKEYDLPSLPALAFYRHKFRQVYTGDMMHEEQILDWVLDLRTSTPDVIESVDRKTLQVLINDV
    EHLAVFFYDDDCESCKEILEELETIDDDTDKHGIQFVKSKDAKLAAEIGIFSFPALVYYETGVPIMYDGNLLDEAEVLDW
    MVRQKNDASIEEIDRDTLAKYIETKEFLGVVFYKDEEPESPRILRHIELIDDEASEYGIKIVKMSDRLMAKKYGFRNPPG
    ITYFRKGKYINYDGDIDDEEEILDWLTNPENMELNDHIERVNRKMFQKIRQNSDYVAVFFYSNDCKQCSRVLSEIEHIDD
    EADGAGINFVKIDDKQLAKEYGVFALPGILFFKLGSKEPVIYAGDLYDEQQILQWLMTQKDPSGEMIEEKEGEDLLNMIR
    ESESLAVYFYSDDCEHCAGILEELENIDDDCDRHGITFVKTEDFKVAEDYGVTDFPVLVYYENQIPNVFEGNLAEEEEVL
    QWLITQKTEDRIELITRTMLESFVEDTQYLAVYFYKQN
    CFICDEILEGLEKVDDECDVFGIHMVKIQDPQLAKRYSIKTF
    PALVYFRNGNPLLFEGDLQNEESVLEWLIDDDNRELADEIESVNGRMLERLLEESPFLAVFFYDEDCPECEEIMEALEKI
    DGEADLFGIDFVKVSAPEAAEKYGILNVPSLVYFRKKTALIYDGDLTQEDKILQWLTSQDVFEIKNEIEEVNKKMLDKLL
    DENEFLAVFFYEHGARESEEVNERLENIDGETDNLDITFVKMADPRYARKWGVTKLPAIVYFRKRFPSIYRGDLRKEEDV
    LEWLRKNRFRQPELNIYMYMLIAVAILFAMYTGFLLSCFRTEPAPPAPHPKQA

    >gi|156543844|ref|XP_001606751.1| PREDICTED: similar to phospholipid-hydroperoxide glutathione peroxidase [Nasonia vitripennis]
    MIRAPTIVVLICVALVQADFNQDTDWSSAQSFYDFKARDLQGNEISLDKYRGHVVVAINGATKCPASSKGFKQLQALLER
    YGESDGLRVVNFTVDGLAGGSGTSEEIAAFFQSKDFALDVLEKIETEGDKAHPVYKWMKSQLPTQDKIMPGSKIVIDKNG
    KVVYRGMPTGPVAELEDTLKQYF

    >gi|156546878|ref|XP_001606689.1| PREDICTED: similar to thioredoxin-like 2 [Nasonia vitripennis]
    MPVVKLTSNDEYVNFLKSNDLSVIHFYAPWADQCTQMNEVLEQMTKLDEYKNVKFANIVAEDLPEISMKCSITAVPTTVL
    FNKENIVGRVNGANPSEVKEQIKKHLSNKNESSQTLEDKLQALIDKAPCMLFMKGNRDTPR
    CGFSRTIIALLEEHKADYE
    TFDILEDNEVREGLKKYSNWPTYPQLYIRGELIGGLDIAREMSESGELDSMLPKKSQGNLEDRLKKLINQAPCMLFMKGN
    RDVPR
    CGFSRTIINLLNEHKADYQTFDILEDNEVREGLKKYSKWPTYPQLYINGELIGGLDIVKEMSEAGELDSMLPKKE
    A

    >gi|156543362|ref|XP_001608132.1| PREDICTED: similar to phospholipid-hydroperoxide glutathione peroxidase [Nasonia vitripennis]
    MMRFTVILGLVCIAGVFGQSCDKTKEECPEAKEAEVKFNQDTDWSKAKSIYEFHAKDIRGNDVSLDKYRGHVAIIVNVAS
    Q
    CGLTDTNYKQLQSLFEKYGKSKGLRILAFPSNEFAGQEPGTSEEILNFVKKYNVSFDMFEKIQVNGDEAHPLYKWLKSQ
    EEGAGTITDGIKWNFTKFLIDKNGKVVSRFAPTTEPFSMEDTITKYL

    >gi|156550937|ref|XP_001605789.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MLLPFLGLLLLLLNDASCQYRTKSSQTASLSDRVQQLTDMAMKRPVMKFNTAKFKEFVKTTPRNYSVIVMFTAMAPQRQC
    QICRHANDEFVIVANSFRYSQSYSNKLFFALVDFDEGSEVFQMMRLNTAPVYMHFPAKGKPKAADTMDIQRVGFAAEAIA
    KWISERTDIQIRVFRPPSYSGTVAVVMLLILIGGFLYLRRNNLDFIYNKTIWGFGALFFTLTMVSGQMWNHIRSPPFIYK
    SPNGNVAYIHGSSQGQFVLETYIVMVLNGAVVLGMILMTEAASRKGDVKKRRIFTVIGLALVAIFFSLLLSIFRNKAQGY
    PYSLLFK

    >gi|156547927|ref|XP_001604421.1| PREDICTED: similar to ENSANGP00000006758 [Nasonia vitripennis]
    MSSTSSDMGNKQNKHLNKLALEKSPYLLQHATNPVDWYPWGEEALEKARREDKLIFLSVGYSTCHWCHVMEKESFENPEV
    AKIMNRYFVNIKVDREERPDIDRVYMTFIQSISGHGGWPMSVFLTPDLTPITGGTYFPPVDKYGQPGFSRILESIATKWI
    ESKQDLLKSGSKILQVLKKSVESKDPEEASVPSVDCANTCVKQLINGFEPSFGGFSRAPKFPQPVNFNLLFLMYARDPTG
    ETGKQCLNMCVHTLTKMANGGIHDHVGQGFSRYSVDGKWHVPHFEKMLYDQGQLLRSYSEAYLASKDPLFAEIVNDIVTY
    VARDLRHPEGGFYSAEDADSFPSFEDTEKKEGAFYVWRYEDVESLLDKVISEKEGLTLSDLFCYHFNVKPEGNVQRQQDP
    HGELMNQNVLIAFGSIAETAEHFKLSIDSVKAHLEKSISILFEERNKRPRPHLDDKIVTAWNGLVISGLSHAASALDNPK
    YTKFAEDAARFIERYLYNKDDKVLLRSCYRGDSDQILQTSVPIKGFQVDYAFAIRGLLDLYEVSFNAHWLEFAEELQDIQ
    DSLFWDDKSGGYFSTTTDDRSVILRLKDDQDGAEPSGNSVACGNLVRLASYLDRTDLSSKAEKLLSSMQEILIQFPVACP
    ELVTALVTLIDSTTQVYIIGKKDTDDTKQLLKVLQSKLVPGKIVMLADGVNQDNVLYKKNEVIGKMKQQNGRATAYVCHH
    HICSLPVTDPKDLESLLDKKSIEAMH

    >gi|156544401|ref|XP_001607483.1| PREDICTED: similar to nucleoredoxin [Nasonia vitripennis]
    MAACSAGALSENNNPASNNCNKLLQMSGSASANQAQKPWQQRLLGKHLVRCGPAVKDKLPTSEVTQSCEVLGLYFSFVDP
    GASCDDFTRHLVDLYNSVNGGSSNGANDAAAAGCKKRLEVIHVLLWSNVQDVIDLDESFRNHVAELPWLAVPSDDYERKT
    RLTRRYRIKAGVPTLILLESVNGTVLTRGGVERALADPTGQSFPWKPPHPKATLEDGPLLPCGGRDSNEPMLHEELRHCY
    KGVYFSAHW
    CPPCKAFTPQLIDTYQRIRERGHDFEVIFVSSDRSEESYKTYTDTMPWLRIPFAQEERRQKLARALDVQAI
    PTLVILDPRDNIITLEGRTEVLEDPEGLNFPWTSRLVNILTEKYATSLHDAPAIILFVEGEDCEIQFGESVLLPAAEMYR
    RDRPDYDPNYDDPDDTLQFYIALDCETSDILREFVGLDDAVPLLTAIDIPRGVYAVMEDGAEITVDSVQQFVDGYRNDKL
    PTNKIAAVHKTVKPE

    >gi|156542899|ref|XP_001601265.1| PREDICTED: similar to ENSANGP00000012664 [Nasonia vitripennis]
    MPITREAVDQLIASDKVVIFSKTTCPYCKMAKEVFDKLKQSYTAIELDKRDDADEIQDILGEITGARTVPRVFLNKEFIG
    GGTDVKKLYESGELAKKL

    >gi|156552000|ref|XP_001603228.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MSCELEMPARALKGAGRSEMEGELCTNEEDSWIPSSRYSQEDIDSPVFYNSSNISDFNSKTKADYKDCATLKVPSKLSNM
    QKSYVRLTIDLLSTLFTNKKKQSSMELNAQLTGFLLKMSIILISLVFVMQLLPLASASERLGNPYHILGVSRHATLKEIR
    KAYKLLAKEWHPDKNGHPEAADKFVEITEAYELLSDPERRRKFDNHGITEEGLPGRDRTFRQKREFNMPDPFEELYSGNF
    QFHYQSRDISLFHEMSISYRAYENIYVSKSYRAPILILFYSDW
    CFTCLKVEKTWRRLIHELEPLGVNLVTVHAERDSALA
    RKLSVHSLPCLAVTVDGRASIYKESLFSAPKIVEFLRSKLPYRLLYNINKDNVDSFLSGWMDNKIRALIFQNRETPRLRY
    LLIALHHRDRVVFGFVQTGIRETEEITSKYKVSEDLDTLLLFNENLEKPVASISMQDIPNEMMQNVIGSNKFLILPRLSN
    QAMLDSICPKDWPRPQKRLCAVLISQNSPEDDLARNKFREAALSAPYSSERVRYTYVFKETQPQFISALSAGEGSPLDPL
    HHIVIIWRRDSSHINYEWFSAGWTEATTDETQWNETRQSLEKTIQRLLRASEALPYAAEVQELTDEHALGTVDKIIGKAM
    LAVDYLSDNLTKEQILPLLSVLATLLLIGAVGYGMSYLVKLEEASVQAKYGQFKENSKAVTTQPQLRLHEMRAETYNGLV
    RLLKPGCRTIVLLVDAQTKLKLLPSFHRAVWPYRKNKTLLFSHLSLERGLEWYKKILTLSLPEPRELNINAKNCVGTVLS
    LNGHRKYFCMYHAKHPECKKGKGSKRMEKMTKRLARPEDAEAGAFIGFDSSSDSDVSQDEMQSDVLYQDKLLDGLPMWLD
    RLFEGSTQRYYINYWPDFTAK

    >gi|156554954|ref|XP_001602170.1| PREDICTED: similar to molybdopterin biosynthesis moeb protein [Nasonia vitripennis]
    MSEESLLEEIASLKAKLREKEANLAKLRREKQILQSHGLNNAEIARYSRQILLPDIGVKGQVKLKNASVLIVGAGGLGCP
    SALYLAGAGVGHIGIVDYDDIEITNLHRQLLFSTLDIGTSKVGAAAESLQRLNDNIKITPYKLQIHSSNALEIVRQYDVI
    LDATDNVATRYLLNDACVIAGKPLISGSALQFEGQLTVYNYSGPCYRCIFPKPPPPETVNN
    CGDSGVLGAVVGTIGVMQA
    LQAVKIILNMPGILSGRLLMFDGMETTFRNLKLRQKNLECAVCGTNPTIHKLIDYEEFCGAKANDKNPNLKILNANERIT
    VNEYKELSKISSKPYLLVDVRSQEEFEMCSLEDSINIPFTKIRSENSLATIKKELDKAGSEVSDIFVLCRRGNDSQKAVR
    ILKDSLSNHDVQIKDIAGGIHAWTRNIDPEFPIY

    >gi|156540692|ref|XP_001601021.1| PREDICTED: similar to ubiquitin-activating enzyme E1 [Nasonia vitripennis]
    MECHTINYGLDAIYHYLRSILCLEPFEGAEGNLKRTVIVHSYAVLNIDQINQESQDINEDLVRPNKIISNSWYLCSPMSS
    AEVVESSVDPPNKKRKIASTAGGVKNLFSIAGMAKNGSKPSAIQSDIDEGLYSRQLYVLGHDAMRRMANSDILISGLGGL
    GVEIAKNVILGGVKSVTLHDNMICQIEHLGSQFYLNENDIGKNRAEACCQQLSELNNYVPTRYYSGPLTYEILKNFSVVV
    ITETSLDEQLRISEITHSNNIALIIGETRGLFSQIFCDFGDSFSVIDATGEPPISAMVASISRDNQGVVTCLDDTRHGME
    DGDYVTFSEVQGMSELNGCEPRKIKVLGPYTFSIGDTSMYSEYIQGGIVTQIKMPKNLHFRPLKDALMNPNIVISDFGKF
    DYPEQTHLAFITLHRFMKHKHRLPEAWNTEDFQEFLNLAINIKSEYKLNCDIQEDLFGLFCKTSCGDFSPMNAVVGGIIA
    QEVMKACSGKFHPIFQWLYFDAVECLPKCQPEINKENYLSEGSRYDYFIKIFGKDFLERLANLKYFIVGAGAIGCELLKN
    FAMLGIATKDGNITVTDMDFIEKSNLNRQFLFRPADVQKSKASTAAAAIKKMNPEINIIAHENRVGPETEKVYNDEFFES
    LDGVANALDNVDARIYVDRRCVYYRKPLLESGTLGTKGNTQVVVPFLTESYSSSQDPPEKSIPI
    CTLKNFPNAIEHTLQW
    ARDNFEGLFKQSAENAAQYISDSHFIERTLKLPGVQPLEVLESVKTALVDERPKTFDECITWARCHWQDQYNNQIRQLLF
    NFPPDQITSSGQPFWSGPKRCPVPLDFDVSNELHLDYIIAAANLKAIVYGIPINRNRDEIAKIASTVEVPGFTPKSGVKI
    AETDSQVQVSNGNGNIDHERLNQLLVELPKVEELEEKKHSPPSSDGLDMRSKCLLVKRDFIKLSRERFTSYSLAGKYNTD
    VARYCKRHLAVLRLQLPGLWGQLLVKFEIVVCCRGRDPPIGSHALAKKVTLVVLFMSQEGMFPQIGIGLNLLKELASGLG
    LKYIWHRGGRFLVKIRDGEISDLFASAADLHAIAASYKDLNNNEVPENISSSRPSAGTAQFLASPHYHLFGLAESRFGPK
    VGDECVHIDGYSVLRQNRNTQGGGVLQQGSLPPVFVAVIYRSPGVSFTANSDLLDDLSNYSSGFNHRIVMGDLNANLLSS
    LQDTVFVRELACKFNLKLVDHGPTHHVGDSHTWIDVIFTDDDNVVLSSNNTMAPFPSRHNLIDVEIEFATLIKPRVLHDF
    T

    >gi|156536873|ref|XP_001605846.1| PREDICTED: similar to viral IAP-associated factor, putative [Nasonia vitripennis]
    MATLEDKILGEKSQYYCSSSSEDEGNDSASSDNEGEASNAYDMPAKQPSMDFSEWDGTSSNTGPKGVIRDWQRFKQIENE
    KRAEQEKERIELMKKLTLTCRSTLDDEREKMLETDPEFAELMADEFLLAYQKQRMREMIAKAEKLRFGSVINLEEAEQYL
    KAIDEEDKSVTIIIHIYQKDVPG
    CTAMNGCLITLAQEYPFVKFCRILASAVGVSKHFKKEGVPALLVYKGGQIIGNFVHI
    TNTLGDDFYASDVESFLIEHGLLRDKNCVPSIIQSNEDDDSDSD

    >gi|156552541|ref|XP_001599355.1| PREDICTED: similar to CG7484 [Nasonia vitripennis]
    MAHILAFLQLSLLLTVTNVLSEFSAEDCKSLGYNKATLLCSTCEKFKKFELNDIHEKCQECCLKDEGDDNSSSKRYPKAV
    LEVCT
    CKFGAYPQIQAFIKSDRPNKYKNLQIRYVRGLDPIIKLYDAENKLEDVLDIHKWDTDSVDEFLATHLQMD

    >gi|156552057|ref|XP_001604123.1| PREDICTED: similar to CG6000-PA [Nasonia vitripennis]
    MSGQGDNLKVNYDELLKAQKDESILIIDVREDSEIQETGKLPGSIHIPMGEVTNVLTNTTSHEFEQKFSKKKPDKDTKII
    LS
    CRSGRRSASVQSEIQKLGYNNAYNYEGGWLDWESKQAA

    >gi|156537934|ref|XP_001608294.1| PREDICTED: similar to AT26381p [Nasonia vitripennis]
    MASRIAASATVRAVKGRKILPTRAALVLTSNAVNKIKEILKDKPEYIGLKVGVRQRGCNGLSYTLDYATDKSKLDEEVVQ
    DGVRVIIDRKAQLSLLGTEMDYIENKLSSEFVFNNPNIKGTCGCGESFSV

    >gi|156548535|ref|XP_001601189.1| PREDICTED: similar to mitochondrial thioredoxin 2 [Nasonia vitripennis]
    MLRTGFRVVYRAVGTRGYTSAAPEKTVASSSFKVQDSKDFTDRVKNAKVPVIVDFFATWCNPCRLLTPRIEQVVAEKQGK
    ILLAKVDIDENTDLALDYEVGSVPVLMVMKDGKVLEKIIGLQDTDKLRKFVSKHADS

    >gi|156542034|ref|XP_001601016.1| PREDICTED: similar to 2-Cys thioredoxin peroxidase [Nasonia vitripennis]
    MPVPAIQKPAPEFKGTAVVNGQFKDIKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAKEFEAIGVQLIAASTDSHFS
    HLAWINTPRKQGGLGEMQIPLLADKSAKIARDYGVLDEDSGVPFRGLFIIDRKQNLRQVTINDLPVGRSVDETLRLVQAF
    QFTDEHGEVCPAGWKPGKKTMKPDPVGAKDYFKDS

    >gi|156545050|ref|XP_001600762.1| PREDICTED: similar to glutathione transferase o1 [Nasonia vitripennis]
    MYDSASCSYAGALDLKGPTAGSGGGGGGGGGPASNNAGASGPASNNGILGAAGSNATAAGVKQENWPYRGLSCGSTFQQL
    KQSVEKAKQALADRGGYLAGAFSPPPRANPSAISPTAAITDASSSYKGGWSHAASPAPGQAEYIAKLKNKIVNRVLLRQE
    HNDQGSKAPPVENGKLRLYSMRF
    CPYAQRIHLVLDAKKIPYDVVYVNLSQKPEWLVEKSPLGKVPCLELENGDTLYESLV
    IAEYLDEAYPEHHLFPTDPLAKAKDKLLIERFNDVITSMYKLYSGKTVDKDLFNEALLGLEIFDRELAKRATPFFGGNQP
    GMLDLMIWPWCERADIIRILRGEQFVIPRERFLRLLEWKLAMKEDPAVKGSFLDAETHAKYMKSRQAGAPQYDLLV

    >gi|156554552|ref|XP_001605564.1| PREDICTED: similar to transmembrane protein, putative [Nasonia vitripennis]
    MLRIAIFAVLCLFSSVSSATLETVSDDDLLNLIKTEKYVVTLFTKKDCEACDQVENQLLHVREDLVDTLSAWVVRVVNSQ
    MLRLYSPDKEPQVIFFRQGIPLLYDGPLDDGEEILATFTENKEPIVKELTDDTFEHLTQASSGATTGDWFVMFYSTD
    CVD
    CQRLGARWEAVGAKLKQRINIARVNKYLTGASTARRFGVYEVPQFILFRHGKMYRYLIPKYDVKSFVSFAKDWYKNAHAE
    KVPVPQSPFDDFTQMIAHTLKDNPWIMKLGSITVGVLVIVTVASKLRKKAEAPQKKNK

    >gi|156545064|ref|XP_001601032.1| PREDICTED: similar to CG6662-PA [Nasonia vitripennis]
    MSKLHLGPGELTIDIISCTDSIDCSEQPPRVDGKVRLYSMKYCPFAHRVILALSFKKIPHDIVNINLKAKPEWYLQIHPE
    GKVPALVDLDGNVVVDSTVIVNYLEEKYPDPTLYNKSTITRDLELLDHYDKIVKVFSNCIHKRDSRPLQEAVNEICTYLV
    EFENELKNRNTTFFTGDKPGMLDILMWPFVERAKALPILYKESLDFEKEKFPCTMKWIAEMKNQEFVKENAVSYETFAKV
    LEASNAGTIDYDNI

    >gi|156547106|ref|XP_001602650.1| PREDICTED: similar to thioredoxin-like protein, partial [Nasonia vitripennis]
    HVRNCEELKTKLTEAGEKLVVIDFFATWCGPCKMIAPKLDELSQELTDVVFLKVDVDELEGVAEEYDVNSMPTFVFIKNG
    SVLDKFSGANIEKVKLTVQKHK

    >gi|156550632|ref|XP_001606905.1| PREDICTED: similar to GA22042-PA [Nasonia vitripennis]
    MPRFSAALVALAILSTGSMSAAERVKVDVYYEQLCPYSVMFVTQQLVPAYEYLKDYVTVNFVPFGKASYVKGFPVRFTCQ
    HGPAECQGNKRQACALFEIQQSVSLTHRQRAAVDIVGCVMANSRKSSAALDCAKRIGLTEASIDNIERCSNGITGDELLI
    SYGEETKAFESPLLGVPSVALNGVKNKKATEDFIGEVCHLIADKNKPAVCRQSLSEQTSR

    >gi|156548610|ref|XP_001607910.1| PREDICTED: similar to peroxiredoxin [Nasonia vitripennis]
    MRLNSVVPNFEANSTQGPINLYDWQGDSWVVLFSHPADFTPVCTTELGRLAVHKPHFEKRNTKLLALSVDQLDDHVDWVN
    DIKSYCRDIPGDFPYPIVADPDRSLAVQLGMIDEEGKDDPANAMTIRALYVISPDHRLRLSMHYPTSTGRNVDEILRVID
    SLQLVDRKPEVVTPANWVPGDKVMIVPTIKDEDLPKLFPKGVDKVSMPSGKVYVRTTTDY

    >gi|156554116|ref|XP_001602967.1| PREDICTED: similar to protein disulfide isomerase [Nasonia vitripennis]
    MQEMPIGLTLLLLGAVGVQCMYPSSSDVVDLTPNNFDNKVINSDSIWIVEFYAPWCGHCQQLKPEYEKAATALKGIVKVG
    GVNADDHKSLGSKFNVRGFPTIKIFGADKNKPEDYNGARTAQGLVDAALKAASEKARSTLSGKKSSSGGSKSEGSKDSKD
    VIELTDENFDKLVLNSEDMWLVEFFAPW
    CGHCKNLAPQWASAASELKGKVKLGALDATVHTIKASQYEIRGYPTIKYFAP
    GKKDSDSVSDYDGGRISSDIVTWALDKLAENVPAPELTQIINEKSLKKACEDKPLCIVSVLPHILDCQSDCRNDYLKILT
    TLGEKFKKKMWGWVWAEAGAQPHIEEALEIGGFGYPALAAVNIKKMKYSLLKGSFSQDGINEFLRDLSYGRGGTAPLKGT
    ELPKIYETEPWDGKDAEPPQEEDIDLSDVDLDEKDEL

    >gi|156541662|ref|XP_001602334.1| PREDICTED: similar to Quiescin-sulfhydryl oxidase4, putative [Nasonia vitripennis]
    MGRQLLLELVLIVFGLFLVGGFANVIPQKEQDEGNQGLYNSSDFVTILDVKNFKSSVYNSRKTWLVEFYNSWCGFCHRFA
    PIWKDVAKSIHGWKNIVVIAAIDCANDDNNPLCREYEVMRYPTLKFFPVNSKKDFLGLEVQKGNDEAQIIQAVIDQLVKE
    QQEQRGATSWPNLVPFRGTEIETLWHGVPQSVQYEFLIFEEPKSYLGAEVILELHKLDTIRIRRVTSENVFLSVTSKVTK
    FPSLIVIDRDNSQTFLKIDTITREGIRNVITEFLISKGISADIKDDIEETHERHPHKTISKDENEPEDSNNSSDKLYQLD
    LEATLRYSLNNEIPLSSAITGEKFKALKSYLKVLAEYFPVHMPKGKMYLQVLQEIVEGKKNITGKEFKGHVRDKEEKFMP
    VYSGPKTWIGCKGSSPTYRGYPCGLWTLFHTLTVAAVEESNGLNDNVPPVLAAMHGYIKYFFG
    CAECSDHFQKMAERRKL
    FDTHDGKESILWLWRAHNEVNERLAGDDTEDPEHKKIQYPSAQHCPECKRPNGVWDENEVLKFLKRKYSRRNIDFQGIND
    EILRRELDSSALSSGASQRKLGWDFTIFDISICVVLYVMSAAILTLVCIKFAFKRTYKKKVSFQNLLGIA

    >gi|156550175|ref|XP_001603445.1| PREDICTED: similar to peroxiredoxin 5, prdx5 [Nasonia vitripennis]
    MSRLVARAITSLGRSAITCNSARSFHATSLNMVIAVGDKVPSVDLYEDTPANKVNLAQLSQGKKIIVFAVPGAFTPGCSK
    THLPGYVQKADELKAKGYSEIICIGVNDPFVMAAWGKDQNTQGKVRMLADPAGAFTDAVDLSVDLAVLGGKRSKRYSMII
    EDGTVKELNVEPDNTGLSCSLADKIK

    >gi|156543632|ref|XP_001604620.1| PREDICTED: similar to dihydropyrimidine dehydrogenase [Nasonia vitripennis]
    MAAASSLVVSKDIPDIENLLSLNPRTKPYASVVPSSQTKQNKQHWKRNIHSKCDSCTPLTKNFDDIKHTTLSERGALYEA
    SRCLKCADAPCQKSCPTQLDIKSFITSISNKNYYGAAKAIFSDNPLGLTCGMVCPTSDLCVGGCNLFASEEGPINIGGLQ
    QFATDIFKQMNIPQTRIPGQTVAHANTKIAMIGCGPASLSCATFLARLGYDDITIFEKQKYVGGLSAAEIPQYRLPYDAV
    SFEVDLVRDLGVKIEFGRELSEKDLTVKKLQNSGYEVIFLGFGLPEPKSVPIFDGLTPEMGFYTSKNFLPAVSQGSKPGM
    CACKSTGLPNLYGNVVVLGAGDTAFDCATSALRCGAKKVFVVFRRGFTNIRAVPEEMELAKDEKCEFIPFASPKKVIVKG
    SKITAIEFYRTEQDENGEWKEDEDQLVRLKVSFVISAFGSGLYDSAVKNALEPVKLNRWGTPEVDGNSMRTTIPGVFCGG
    DLAGVSQTTVESVNDGKTASWYIHKYIQEKHGLTVPKEPQLPKFHTPIDDVDLSVEVCGIKFENPFGLASAPPATSCAMI
    RRSFEAGWGFAVTKTFGLDKDMVTNISPRIVKGTTDGYHYGPEQSSFLNIELISEKTAAYWCKGITELKRDFPEKVVIAS
    IMCTYNKADWTELAQMAEATGCEALELNLSCPHGMGEKGMGLACGQDPELVRNIARWVRAAVKIPFFVKLTPNITDVVAL
    AKAAYEGQADGVSAINTVQGLMSVKADGTPWPAVGSAKATTYGGVSGNATRPIALRAISKVAKALPGFPILGIGGVDSAE
    VSLQFLQCGARILQVGSAIQNQDFTLIEDYTTGLKALLYLKSVGHLKGWDGQSPPTFKHQKGKPVSLQHALGQSVPYFGE
    YQKLREKKAAEIKEQSNLLDVELKPTRPAPKPVQPIPTINDLIGKALPHIGNYTQLDNKKQVVALIDDDMCINCGKCYMA
    CADSGYQAIQFNAETHIPKVTDDCTGCTLCLSVCPIIDCITMVPKKIPHVIKRGIPPKGITELPA

    >gi|156548698|ref|XP_001602801.1| PREDICTED: hypothetical protein [Nasonia vitripennis]
    MSSEESRELEESADTSSDAEELEPTEPDSKEQSGSNIKKEISLNNPKSTLEEKLSSKMFTYARETICFFLAVAFTALAAL
    HSSPPRISKPPIARPLFNESSLVLDFYKGHLGALVDRVTDADFSFVMYYAPWDAE
    CQAIQEEFESVAQYYQSQVFFAAIN
    CWHPGSECRTRYSKIQSYPVLMLYPSKESGVQYKGIRSAPYMIRFIHKFMNPIIRVNSDEELMKLIKSYDAVMIGYFNFS
    GLRKTPGYREYYRAALRTLEKDPNGEIAFVAITSRDLAWDHEVTQFPSASLLMWNETLFFPDNSEWLAENLSNWINNVVH
    RVVTWLQPPGIKSLTFAPYLWDGPLLFLFTPRNPLHSENGNYNLLREIGLQYYDCSENSQIQEIVSRLRKSRLEAALKAF
    ETREWCVNLLEEGKGQQLPLNGSSQKHRWSNGTANCCSDIATNKCVICASTKPVDSLDSKVCAAPGAACRGSDIFGLPFA
    FEEGVSPVTAQPEFSYINAATVEGDIDGTCQVNSCDSSTRDEDVDDPRSSTSVRKAFYREECRQFLAGYSYQRPIFPREP
    DNDSDEVELTEAICRVNKTLALVAIDSLHYFHFAESLGIDVGNAKDKTTVVILDPADESQFVMQDEYGRNTLVQFINNYT
    NGYLARTMRSNNPRRLARSFVPKSDCKGNSKSKICVPELSTDNFLDTVLNPHKDVVVMYHSPYCAFCSAVAYVYLTVANY
    LSKMDHLEFVRIDGDNNDLPWEYTMNRYPSILFFPAKRKEDSTLYPWQLPVSVGNLLSFVLANLDEESHVEALINVCAAG
    AGGSSSACLARIRWLCLDVLEDHLREFRRLRRSRLSTVDRARARMMLLLRLEHVRQVHLLIGSTGDLSKDVAKVRLLRSM
    FKLLYAKLENLRHDKTRSENCAARVEERTLTSRSS

    >gi|156553206|ref|XP_001599732.1| PREDICTED: similar to CG8983-PA [Nasonia vitripennis]
    MVGKYLALFGLALVASTGTWAAEEDVFEWGDGDFAEELRRHDNTLVMFYAPWCGHCKRLKPEYAKAAELLRGSDPPITLA
    KVDCTEAGKDTCNKYSVSGYPTLKIFAKDELVNDYNGPREAAGIAKYMRGQVGPASKELKTLAAFEEFLNSDEISVVGFF
    EKDDSPLSAAFHNVAKKLREKVRFGHTIAKEVLEKEGLENNIVIFRPKVLQNKFEPSKQVYEGGDSISEVSAFIKQNYYG
    LVGVRTRDNAGEFKNPLIVAYYAVDYVKNPKGTNYWRNRIMKVAKDFAKEYDYTFAISSKDEFQHELNEFGIDFVKGDKP
    VILARDERNQKFALQEEFSLEAFEIFLNDLQAGSLEPYQKSEPIPEDNSGSVKVAVAKNFDEVVTNNGKDTLIEFYAPW
    C
    GH
    CKKLALIFDELGDKLVDEDVEIVKFDATANDVPQPYEVRGFPTLFWVPKDSKDSPVKYEGGRDLDDFVKYIAKHATNP
    LKGYDRSGKPTKAPQDEL

    >gi|156542179|ref|XP_001601480.1| PREDICTED: similar to ubiquitin-activating enzyme E1c [Nasonia vitripennis]
    MDFEYTHRKLSSLRKILERSGPFCRPDFEPSSEALKFLMHDCKILVIGAGGLGCECLKNLALMGFRQMHVIDMDTIDLSN
    LNRQFLFRHKDIGTSKSETAAKFINDRIPGSNVIPHFCRIQDKSEEFYRQFHLVICGLDSIIARRWINGMLTSLLVYENG
    ILDQSSIIPFVDGGTEGFKGNVRVVIPGLTPCIECTLDLYPPQITYPL
    CTIANTPRLPEHCIEYVKIIQWPKENPFDCCI
    DGDDPQHISWIYEKSNERALNFGIRGLTYRLVQGVVKHIIPAVASTNAVIAAICCTEVFKLATSCSASLNNYMVFTDTDG
    IYTYTYKAEKNEQCLACSQISRELQLNSINLKLKDLIELLCSQNDLQMKNPGITANIFGKTKTLYIQSVPSIEEKTRQNL
    SKTLFDLGLRNESEIIVADETTPNTVVFKLKFTM

    >gi|156548724|ref|XP_001603389.1| PREDICTED: similar to methionine sulfoxide reductase [Nasonia vitripennis]
    MPGQLEEVSVSSKRATFGMGCFWAGDSLFGACPGVIRTSVGYAGGTKDNPAYRSLGDHTEVIHMEYDPEVISYSQLLDLF
    WNNHEYGLTTNIKRQYMSLILYHDEEQRLAAEKSRDHQQRERNEKFVTEISPFNKFYPAEDYHQNCIEGGGETVPVRKPL
    DGPAASATSTAPVTSEQQAAATDSAAVSEQGLAVASKMNSALATGNKSPENNNSLHQENRNRRAAQLRFKTRPSSFDAAL
    IVRGRSKNSLLLAPTQPCSPLRRRRNAAPADWDDASSSSGCSSDPGSASDSDSETELRVSENVSNEEGSKPIGMSAEEEE
    AFRLTVGRGHFSRSKKDRFLNHLRLEKRLNDLNNDYFGLACKGHHHHHHHHRHRHLQRRHSGDLHRIV

    >gi|156544189|ref|XP_001606559.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MYLSRLSLCVIFVLLCSLESRANLNDDAPLTKLGSKTGPSLKFFYCYSCGYRKVFEDYVNILRQKYPELQIDGENYNPPG
    ANMMLAKGLGIAKILVIVLIFSKINIFQWIGQPQPFWWQWCMDNRLYSCVMLFFACNAAEGYLISSGAFEIHFNDVPIWS
    KLETGRIPQPPELFQIIDTHMQMIFPEMEAGKIGLNK

    >gi|156544718|ref|XP_001605724.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MSRVVRSIVVLLALALAGASIQKKTSWVDRLDEDNWDRMLTGEWMVEFYAPWCPACKALEEIWESLAFQKKELGINVGKV
    DVTDAPGLSGRFMVTALPTIYHVKDGVFRQYKSPRDKDSLVEFVTKKTWQKVDPVSSWKSPTSIQMSIISQFFRISQVLR
    GIHNKLMEDFGLPTWGSYLIFAIATIVLGAILGLLIVCIIDFIYPPKDLMYQVKKKQKGDSGGFMTEKSTGDDELMDGVK
    DDLVDEDGSDSEEKSENDKTDKESKSSPNSPNVRKRRARKAD

    >gi|156546246|ref|XP_001605234.1| PREDICTED: similar to RH03087p [Nasonia vitripennis]
    MLTSRVFRAAQLLRGFATKPEEIGQLVKKNKVVVFMKGVPEEPRCGFSNAVVQIMRMHGVQYDAHDVLKDENLRQGIKDF
    SNWPTIPQVFINGEFVGGCDIVLQMHQNGELIEELKKVGINSALLTKEQEKDSSKSDKGSKD

    >gi|156550783|ref|XP_001606643.1| PREDICTED: similar to peroxiredoxins, prx-1, prx-2, prx-3 [Nasonia vitripennis]
    MRYAQALGLLVLLLATSTRAANKFGEDESCYSFAGGTVYPGSSKHEGHQLQTTKAVIGKKAPYWEGTAVVKGEFKEIKLT
    QFKGKYLVFFFYPLDFTFV
    CPTEILAFSDRVEEFRKLNVEVVAASVDSHFTHLAWINTPRKEGGLENIRIPLLSDLTHKI
    AKDYGVYLDDLGHTLRALFIIDGKGILRQITMNDLPVGRSVDETLRLVQAFQYTDEHGEVCPAGWKPGQDTIIPNPVDKK
    KFFSKNQV

    >gi|156548262|ref|XP_001600739.1| PREDICTED: similar to CG3083-PA [Nasonia vitripennis]
    MVLLGEVFPNFIAKTNVGEIDFHKWLGDSWGILFSHPNDFTPVCTTELAKVAKLMPEFQRLGVKVIAISCNSVDSHRQWI
    EDIKSYGEISENGFPYPIIADETRDLAINLGMLDPAELNSQGLPVSARAVFVIDPQKKMRLSILYPATTGRNFDEIIRVI
    ESLQLTEKHNVATPANWKKGEPVMVVPTISDEEAKKTYGSNMKTLSLPSGKPYLRIVPQPTDS

    >gi|156555760|ref|XP_001602610.1| PREDICTED: similar to CG7430-PA [Nasonia vitripennis]
    MRYSKTQTEKPEDIKIIVRKQILSVALVGMVVKSSPLPFSRRQFTELMQRRYASSLDADIVVIGSGPGGYVAAIKAAQLG
    MKTVCIEKDPTLGGT
    CLNVGCIPSKSLLNNSHYYHMAHSGDLDNRGVKVSGVSLDLPKLMEQKSSVVKALTGGIAGLFKK
    NKIELVKGHGKITGKNQVTALGSDGSTVATVNAKNILIATGSEVAPFAGVEVDEKKIVSSTGALSLDSVPKRLIVIGAGV
    IGLELGSVWQRLGSDVTAVEFMTSIGGVGIDGEVSKTMQKIMSKQGLKFKLGTKVTAAAKSNGEIQVVLEDAKDPSKKET
    VACDVLLVCIGRRPYTSNLGLEEIGIERDEKGRIPVNSRFQTVIPNIYAIGDCIHGPMLAHKAEDEGIITVEGIAGGAVH
    IDYNCVPSVIYTHPEVAWVGKSEEDLKKEGIDYKVGKFPFMANSRAKTNLEIDGFAKVLADKATDKILGVHMIGPAAGEL
    INEAVLAMEYGASAEDVARVCHAHPTCAEALREAHLAAYCGKPINF

    >gi|156544758|ref|XP_001606047.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MGGRDRVMQRPTTMLLLLIAVSFQAVSGNLFGTNRQRTDDQCFCELNGAIDDCSCTVDTVDYFNNVKIYPRLQSLLVRDY
    FRFYKVNLKRDCPFWADDSK
    CAIRFCHVQPCQDKDIPVGLKGELPRNIHVNESPSDKYKANMQISDCDQNNHDHNIELGY
    LNTTISSENYKEFERWQQHDDAQDNFCVTETDTGEYVDLLLNPERYTGYKGPSAHRIWRSIYMENCFRPDNSPHTFIQSS
    KVDGNHFATINHNNMCLEKRVFYRAVSGLHSSINIHLCSKYLLSSQSRLEVAPEGQWGANVVELQRRFSPETTGGEGPNW
    LKNLYFLYMLELRALAKAAPYLQRLDYYTGNEVEDSDTRLAINDILNVVRTFPEHFNESVMFNGGVEAQVLKEEFKQHFR
    NISRIMDCVGCDKCKLWGKLQIQGLGTALKILFSGKFEKYEPTVLTFSKKHFFLERSEVVSLINGFGRLSESIFELEKFR
    KLIR

    >gi|156537684|ref|XP_001607897.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MNVQSVVEDLTQTCVVLRTVLRSSKDEKEKEEIVLKHIKAYADSGVQVNDFAKGLEWFNVSESLSMYKHLAGKIVVLDFF
    TYC
    CINCMHILPDLEALEKRFTIQDGLVVVGVHSAKFANERDSSKILSAVQRYNIGHPVVNDAKLSMWRDIGIVCWPSLV
    VLGPKGQPLFVLLGEGHREDLFLYTKIALKYFKSLKQISNDSIPLKLAQHILPMNKGSLLFPGKIHSFKTDAGEKLVVSD
    TGNNRILIMGKDGKVEHVVGGYSPGFKDGDFETARFNAPQGVCVLKDDVFVADNENHAIRKINLKTKTVISIAGTGSQGR
    DYTGGKIGKEQELSSPWDVAIYQHEQKGETVPVLLIAIAGSHQIWALFLEDTIWWKNKQCKAGTCCNIVGNGKEANRNNT
    YPHAASLAQPSGLAVSQELKSVFFADSESSTVRRVCLDDGKVFAVCGADNDPSNLHCFGDQDGKKYSAKLQHPLGVAWNK
    FDQMVYIADTYNHKIKKTDSEGNCVTVCGEGKPSKNSIFNEPSGLAVSQNGDILYIADTNNHSIKTLDLKDIQKIDVLPV
    VLPAEAWNRGDHTFNFKVAVSTNEANLSLTFNPTFNDDLKLNAEAPQKWSLNLPSIDWNASQSNGDLSTPLSIKIPPGNE
    EKQMHIMLDVMTCRATECIPKKLSVVYTIVRDAAAPATVVEKKELNIR

    >gi|156552337|ref|XP_001601709.1| PREDICTED: similar to ENSANGP00000014381 [Nasonia vitripennis]
    MLSTVRNLIRLSTRNITLLSQRHKKFQINDNTEFVDKVMNSSVPVIVNFHAEWCDPCKILTPKLEELIGPMNELNLAIVN
    VEDNPELVHTFEVKAVPAVIAVSNGLVVDKFIGLVDANMIDNLIKKLTGGQHPPGKADTATQ

    >gi|156541799|ref|XP_001602414.1| PREDICTED: similar to ENSANGP00000011417 [Nasonia vitripennis]
    MAVLCRFRGFARKTKYLQETLFLKDVTSSSSASRSLCTYVQQPKSRSILKFSLIGAGVGVVAGAGYAISKINDARKKLAL
    EGTEVEVKVLKYKPDVKPSRKIVSPVDTTGLKLTLFQYQT
    CPFCCKVRVLLDYYGLSYDVVEVDPVLRREVSWSDYRKVP
    ILLAKVNKGYQPLNDSSLIVSVLASFLHDKSQKIDELSKCYPVIAMHDEKGVFKHEIVNKYFLMYQNSTPKDRSLNDIVE
    ERKWRKWADDVFVHTLCPNVYRTLGEAYQTFNWFSDVGRWEEYFPSWERAIMVNVGALAMWLISKKLKKRHHLKEDVRES
    FYDEINIWLNAIKARGGTFMGGANPDLSDLAVYGVLKSIEGCEAFQDALKYTQLGTWYNAVKEKVDSHAGSVYLSN

    >gi|156551878|ref|XP_001603537.1| PREDICTED: similar to GH10422p [Nasonia vitripennis]
    MQDPNEDTEWNDILRAKGIIPEKKKDAEVTEDQIVQMLENTIDQRTGRVQTNLDDKTLDELDELEDEEDERVLLEYRRKR
    MAEFQELASKAKYGDVKEISAQDYVQEVNKAGEDVWVVLHLYKSGIPL
    CTLVNQHLAALARKFPTTKFLKSISTTCIPNF
    PDANLPTIFIYKDGSMEKQYVGPIELRGMKLTEEELEWMLGSVGAVPSKIKDDPKPKVRDVMFAKLAAENDDNDW

    >gi|156542698|ref|XP_001603236.1| PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis]
    MFGLKKDFHRLKRDLRQLMRPYYLINIFLSVSYIFAKKLPYICHFLFSQTECELDDREAEILFFLIIVIVLRTRKAGSVN
    MISYLSSSFVYTKVANLILWFYADIHLGILYGIIFLLCGLVLPEPTYQGPENVIYLRGESSLQEELQRDTRICWLIAFYT
    AWNPA
    CVNFAPIFSELSAKYALENFKFGKVDIGRYPDAAAKYHISDSSKSQQLPTLILFKEGKEVERRPYADHKGKLVKF
    QFSMDNIRDAFDLNGVYDTCSKNPIKKKDKKPIKAE

    >gi|156550769|ref|XP_001605455.1| PREDICTED: similar to ENSANGP00000018231 [Nasonia vitripennis]
    MSYMLSHLHNGWQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYNIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY