M musculus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|110224442|ref|NP_001035978.1| thioredoxin reductase 1 isoform 2 [Mus musculus]
    MNGSKDPPGSYDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQAL
    KDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHRIVATNNKGKEKIYSAERFLIA
    TGERPRYLGIPGDKEY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
    EEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTD
    EEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIE
    VYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFT
    TLSVTKRSGGDILQSGC
    CG

    >gi|28316734|ref|NP_783577.1| Dim1-like protein [Mus musculus]
    MSFLLPKLTSKKEVDQAIKSTAEKGLVLRFGRDEDPVCLQLDDILSKTSADLSKMAAIYLGDVDHTPVYTQYFDISYIPS
    TVFFFNGQHMKGDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNVPKYDLLYQDI

    >gi|94371589|ref|XP_001000802.1| PREDICTED: peroxiredoxin 6, related sequence 2 [Mus musculus]
    MPEGLLPGNEAPNSETDTTTIRIYFHDFLGDSWDILFSHPRNFTPVCTTELGRAAKLSPEFAKRNVQLIALPVDSVEDHL
    AWSKDINAYSGTAPTEKLPFPIIDDEDRDLAILWACWIQXRRMIMTCLXPPVWCSYFALTRNXSCLSSTQPSWAGTLMRF
    SEXLILFSXQQQSQLIGRRGRAXWSFPTSLKRKPNDKESSPKSSHLAKNTSIIHPSL

    >gi|6671549|ref|NP_031479.1| peroxiredoxin 6 [Mus musculus]
    MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHL
    AWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDANNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEI
    LRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP

    >gi|112817607|ref|NP_083424.1| thioredoxin domain containing 13 [Mus musculus]
    MTGGFCVPVLLAAWLAAAAAEGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWETFAKNGETL
    QISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQNYILEKKWQSVEPLTGWKSPASLTMSGMAGLF
    SISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMGLILVVISECFCVPLPRASSERCEQEQSTGEAQGAEQLQDA
    EEEKDDSNEEENKDSLVDDEEEKEDIGDEDEGEEDEEEDNLAGIMAEERSDTNERAVVKEGSVSPKEDGAHPADTQDVVE
    DALRQRKSQNANKGS

    >gi|76781489|ref|NP_001028338.1| selenoprotein H [Mus musculus]
    MAPHGRKRKAGAAPMETVDKREKLAEGATVVIEHCTSCRVYGRHAAALSQALQLEAPELPVQVNPSKPRRGSFEVTLLRS
    DNSRVELWTGIKKGPPRKLKFPEPQEVVEELKKYLS

    >gi|7305479|ref|NP_038787.1| selenoprotein X 1 [Mus musculus]
    MSFCSFFGGEVFQNHFEPGVYVCAKCSYELFSSHSKYAHSSPWPAFTETIHPDSVTKCPEKNRPEALKVSCGKCGNGLGH
    EFLNDGPKRGQSRF
    CIFSSSLKFVPKGKEAAASQGH

    >gi|149252189|ref|XP_001475379.1| PREDICTED: hypothetical protein LOC77032 [Mus musculus]
    MCCEGRPRGDKRTLHARVTKKTRLGLAPSPTPALPPCRQHSAREAAWCLCESGREVPLSAGAGCGALKSLDSACRKKSRK
    EPRKGSGQQPRGPREPIVMLARLVLGTSGRAALGSVEPALGGLKSIWRCSQAFCSTPKGVTYRELKSLLNSKDIMLIDVR
    NTWEILEQGKIPGSINIPLDEVGEALQMNPVDFKEKYCQVKPSKSDRLVFS
    CLAGVRSKKAMDTAISLGFNSAQHYAGGW
    KEWVTYEISEEKQES

    >gi|6677917|ref|NP_033182.1| selenoprotein W, 1 [Mus musculus]
    MALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAI
    KAALAQCQ

    >gi|149267887|ref|XP_922530.2| PREDICTED: similar to MSP23 isoform 1 [Mus musculus]
    MWYRNSQRKEYKCESSNAKDGPKHLDVPSTGKSDSTQVFGSNFQFTVVISIVVMLIIQALRGLKQEDCFKWNTKKSHHPI
    RNLFLLSDSQDLWLDPADSKMSSGNAKIGYPAPNFKATGVMPDGQFKDTSLSEYKGKYVVFFFYPLDFTFV
    CPTEIIAFR
    DRADEFKKLTCQVIGVSVDSHFCHLPWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILQ
    QITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPSSDTIKPDVNKSKEYFSKQK

    >gi|46430522|ref|NP_997414.1| anterior gradient homolog 3 [Mus musculus]
    MLHSALALCLLLITVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEF
    AKNEEIQEMEQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRL
    IQSEL

    >gi|6678878|ref|NP_032624.1| O-6-methylguanine-DNA methyltransferase [Mus musculus]
    MAETCKMKYSVLDSPLGKMELSGCERGLHGIRLLSGKTPNTDPTEAPATPEVLGGPEGVPEPLVQCTAWLEAYFREPAAT
    EGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGETVSYQQLAALAGNPKAARAVGGAMRSNPVPILIP
    CHRVVRSDGAIG
    HYSGGGQAVKEWLLAHEGIPTGQPASKGLGLTGTWLKSSFESTSSEPSGRN

    >gi|19526842|ref|NP_598544.1| prostaglandin E synthase 2 [Mus musculus]
    MAQAARLSWVLVSSRCALTEGLLTRPWQPLSAQSRAGFTRVAAGSRGAAVRKGSPRLLGAAALALGGALGLYHTVRWHQR
    SQDLRAERSAAQLPLSNSLQLTLYQYKT
    CPFCSKVRAFLDFHSLPYQVVEVNPVRRTEIKFSSYRKVPILVAQEGDSLQQ
    LNDSSVIISALKTYLVSGQPLEEVITYYPPMKAMNDQGKEVTEFCNKYWPMLDEKEAQQMYGGKEARTEEMKWRQWADDW
    LVHLISPNVYRTPAEALASFDYIVREGKFGAVEAAMAKYVGAAAMYLISKRLKSRHHLQDDVRVDLYEAANKWVTAVGKD
    RPFMGGQKPNLADLAVYGVLRVMEGLEAFDDLMRHSHIQPWYLRMERAIEEAPSVHHVNPSCKD

    >gi|27370032|ref|NP_766300.1| ubiquitin-activating enzyme E1-like 2 [Mus musculus]
    MERSEPLAVLSCEEASCSSWGACGASKNLPTMTTESLEIDDGLYSRQRYVLGDTAMQKMAKSCVFLSGMGGLGVEIAKNL
    VLAGIKALTIHDTKKCQAWDLGTNFFLCEDDVVNERNRAEAVLHRIAELNPYVQVSSSSAPLDETTDLSFLEKYQCVVLT
    EIKLTLQKKINNFCHSHCPPIKFISADVHGIWSRLFCDFGDEFEVSDTTGEEPKEIFISNITQANPGIVTCLESHPHKLE
    TGQFLTFREIHGMTGLNGSVQQITVISPFSFSIGDTTKLDPYLHGGIAVQVKTPKTFCFEPLESQIKHPRCLIADFSKPE
    APLEIHLAMLALDQFQENYNRKPNIRCQQDSDELLKLTVSINETLEEKPEVNADIVHWLSWTAQGFLPPLAAAVGGVASQ
    EVLKAVTGKFSPLCQWLYLEAADTVESLGNPGHEEFLPRGDRYDAIRACIGNTLCQKLQNLNIFLVGCGAIGCEMLKNFA
    LLGVGTGREKGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAAEATLKINPQLKIDAHLNKVCPATESIYSDEFYTK
    QDIIITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHTEIIVPQLTESYNSHRDPPEEEIPF
    CTLKSFPAAIEHTIQW
    ARDKFESSFSHKPSLFNKFWQAYPSAEDVLQKIQNGQSLEGCFQVIKLLSRRPRIWSQCVELARLKFEKYFNHKALQLLH
    CFPLETRLKDGSLFWQSPKRPPSPIKFDLNEPLHLSFLQSAAKLYATVYCIPFSEKDLSVNSLMDILSEVKIEEFKPSNK
    VVQTDETARKPDHVPVSSEDERNAVFQLEEALSSNKATKSDLQMTVLSFEKDDDRNGHIDFITAASNLRAKMYSIEPADR
    FKTKRIAGKIIPAIATSTAAVSGLVALEMIKVAGGYPFDAYKNCFLNLAIPIIVFTETSEVRKTEIRNGISFTIWDRWTV
    HGKEDFTLSDFINAVKENYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPSTEKKYVDLTVSFAPDADGDEDLPG
    PPVRYYFSHDTNE

    >gi|13384700|ref|NP_079610.1| endoplasmic reticulum protein ERp19 [Mus musculus]
    MSLRFGATCLLSFSFLLLITSSDGRTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEI
    SELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDA
    FREKHFQDEL

    >gi|6755114|ref|NP_036151.1| peroxiredoxin 5 precursor [Mus musculus]
    MLQLGLRVLGCKASSVLRASTCLAGRAGRKEAGWECGGARSFSSSAVTMAPIKVGDAIPSVEVFEGEPGKKVNLAELFKG
    KKGVLFGVPGAFTPG
    CSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLL
    LDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL

    >gi|33859722|ref|NP_082615.1| thioredoxin domain containing 1 [Mus musculus]
    MAHLGRLMVPLAALVLLLWAVPGAHGRRNNVRVLTDENWTSLLEGEWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVKV
    AKVDVTEQTGLSGRFIITALPSIYHCKDGEFRRYVGPRTKKDFINFVSDKEWKNIEPISSWFGPSSVLMTMMSALFQLSV
    YIRTSHSYFVHDLGIPAWGSYLVFAFATVLSGLLLGLCMIFVADCLCPSKRRKPQQQYAKKTSPEFSQPLKKVEEEQEAD
    EEDVSEEEAEDREGASKATSQSSIRQRCVGLPSATDTS

    >gi|119392105|ref|NP_065602.2| arsenic (+3 oxidation state) methyltransferase [Mus musculus]
    MAASRDADEIHKDVQNYYGNVLKTSADLQTNACVTRAKPVPSYIRESLQNVHEDVSSRYYGCGLTVPERLENCRILDLGS
    GSGRDCYVLSQLVGEKGHVTGIDMTEVQVEVAKTYLEHHMEKFGFQAPNVTFLHGRIEKLAEAGIQSESYDIVISNCVIN
    LVPDKQQVLQEVYRVLKHGGELYFSDVYASLEVPEDIKSHKVLWGE
    CLGGALYWKDLAIIAQKIGFCPPRLVTADIITVE
    NKELEGVLGDCRFVSATFRLFKLPKTEPAERCRVVYNGGIKGHEKELIFDANFTFKEGEAVAVDEETAAVLKNSRFAPDF
    LFTPVDASLPAPQGRSELETKVLIRDPFKLAEDSDKMKPRHAPEGTGGCCGKRKNC

    >gi|46909575|ref|NP_075527.2| growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration) [Mus musculus]
    MAAPSEPAGFPRGSRFSFLPGGARSEMTDDLVTDARGRGARHRDDTTPAAAPAPQGLEHGKRPCRACVDFKSWMRTQQKR
    DIKFREDCPQDREELGRHTWAFLHTLAAYYPDRPTPEQQQDMAQFIHIFSKFYP
    CEECAEDIRKRIGRNQPDTSTRVSFS
    QWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

    >gi|23956246|ref|NP_444497.1| selenoprotein M precursor [Mus musculus]
    MSILLSPPSLLLLLAALVAPATSTTNYRPDWNRLRGLARGRVETCGGCQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADP
    ELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAQVPPEYLWAPAKPPEEASEHDDL

    >gi|149262205|ref|XP_001476778.1| PREDICTED: similar to red-1 [Mus musculus]
    MSGFLEELLGDKLVTGGGEEVDVHSLGARGIALLGLYFGCSLSAPCAQLSASLPEPRHRLEIVFVSSDQDQRQWQDFVRD
    MPWLALPYKEKHRKLKLWNKYRVSNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSL
    ESSSLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAGQEFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRL
    NRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAVQLNEGPCLVLFVDSEDDGESEAAKQ
    LIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVETFVNDFL
    AEKLKPEPI

    >gi|27229039|ref|NP_080408.2| thioredoxin domain containing 8 [Mus musculus]
    MMNGTATVILHLNQQERVSSKSQMLIMVKRIKNMSELKELFSDAGNKLVVVEFSAKWCGPCKTIAPVFQAMSLKYQNVTF
    AQVDVDSSKELAEHCDITMLPTFQMFKYTQKVTPFSRLKRVLCCLRSGPKSKMIFECHGADAKQLEKKIQELM

    >gi|9903609|ref|NP_064297.1| thioredoxin 2 [Mus musculus]
    MAQRLLLGRFLTSVISRKPPQGVWASLTSKTLQTPQYNAGGLTVMPSPARTVHTTRVCLTTFNVQDGPDFQDRVVNSETP
    VVVDFHAQW
    CGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAF
    LKKLIG

    >gi|21728388|ref|NP_663426.1| odorant-metabolizing protein RY2D1 [Mus musculus]
    MAQKLWGSCLFSLFMAALAQETLNPQKSKVDCNKGVTGTVYEYGANTIDGGGFVNFQQYAGKHILFVNVASFCGLTATYP
    ELNTLQEELKPFNVTVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGYVPNFQLFEKGDVNGDNEQKVFSFLKNSCPPTS
    ELFGSPEHLFWDPMKIHDIRWNFEKFLVGPDGVPVMRWFHHTPVRIVQSDIMEYLNQTSTQ

    >gi|42415475|ref|NP_035162.1| prolyl 4-hydroxylase, beta polypeptide [Mus musculus]
    MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIR
    LAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVI
    GFFKDVESDSAKQFLLAAEAIDDIPFGITSNSGVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVI
    EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLI
    TLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPW
    CG
    H
    CKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
    GDDEDLDLEEALEPDMEEDDDQKAVKDEL

    >gi|82914282|ref|XP_918670.1| PREDICTED: protein disulfide isomerase-like protein of the testis [Mus musculus]
    MAHSSKAPSPGPLESQNSEHSFRGSCDLHVLKQELPFCSWVSWAHSLADRSCSQHKRKLKAFSSDFCTLPDCHRADCPSS
    MWPDSPESNPAACRPSMELLWTPLLLVAACLSEVLGSPEIDTGINISQPLHILEDHNLMVLTPAGLTQTLNETRFLMVIF
    HNPSLKQSRKLAKELGKAAEIFGKGKNGLGFGKVDITKETELQQEFDITHAPELKLFFEGNRLKPISCKDVVESTALVVW
    LRRQISKKALLFNNSDEVADFVKSRPLVIVGFFQDLEEEVAELFYDTIKDFPELTFGAIQIKNSFGRFHVILDSVLVFKK
    GKIVKRQELINDSTNKDHLNQVIKQQLTGFVIELNPENKDLIYELNILNHMLLFISKSSEPYSTISRHYRQIAKEFQNKI
    LFVLVNADEPKNKRIFEYFQISRVNVPSVQILNLSSDGRYKMPTDDINFESLKKFCNSFLSKTAKKHKASEEIPKYWDQG
    PVKKLVGKNFNVVVLDKEKDVFVMFYAPWSEK
    CRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFP
    TDSQEAVMYKGEHTMKGFCDFLESHVKVRIEEEDELLYIEQNEEEEVLAEPEIQLIEKLPENPLLKIEDTSKQDRPVKES
    PVLDSIRKPEEPERRKETAEREAAAAQPKEQPKPERKLEVKEEL

    >gi|149273657|ref|XP_001474649.1| PREDICTED: similar to ubiquitin activating enzyme E1 [Mus musculus]
    MIGVDHAPPFRFRLGQRHLVSRVRRRTLILWKEFPERNWLLARDLKVEAAPFWDRILEEEEMSSSVLSKKRKVSGPDSSL
    DSSWSPTYSVMFGVPPGPTNEMSKNKEMDIDESLYSRQLYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVKAVT
    LHDQGIAQWADLSSQFCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQVVVLTNTPLEYQLQVGEFCH
    SHGIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQPLSAMVSMITKENPGIVTCLEDSRHGFESGDFISFTEVQGMSELN
    GIGPIEIKVLGPYTFSICDTSSFSEYIRGGIVSQVKVPRKINFKPLLASLAEPEFVVTDFAKCCHPAQLHIGFQALHQFC
    TQHSRPPRPHNEEDAEELVTLAQSVNAQALPAVQQDCLDIDLIRKLAYVAAGDLAPMNAFFGGLAAQEVMKACSGKFMPI
    RQWLYFDALECLPEHRVAFMEDKCLPNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEDGEITV
    TDMDTIEKSNLNRQFLFRPWDITKLKSETAAAAVRDINPHIRIFSHQNRVGPETEHVYDDDFFQKLDGVANALDNVDARL
    YVDRRCVYYRKPLLESGTLGTKGNVQVVVPFLTESYSSSQDPPEKSIPI
    CTLKNFPNAIEHTVQWARDEFEGLFKQSAEN
    VNQYLTDPKFMERTLQLAGTQPLEVLEAIHCSLVLQRPQTWADCVTWAYQHWHTQYSHNIQQLLHNFPPAQLTSSGALFW
    SGPKRCPHPLTFDINNPLHLDYVMAAANLFAQTYGLGGSQDCAVVAKLLQSLPVPKFAPKSGIRIHVSEQELQSTSATTI
    DDSHLEELKTALPTPDKLLGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYGISPADRHKSKLIAGKIIPAIATTTSAI
    VGLVCLELYKVVQGHQQLESYKNSFINLALPLFSFSAPLAPECHQYYDQEWTLWDRFDVQGLQPSGEEMTLKQFLDYFKT
    EHKLEVIMLSQGVSMLYSVFMPASKLKERLDQPMTEIVSCVSKQKLGHHVKSLVFELCCNSDSGDDIEVPYVRYIIR

    >gi|110735449|ref|NP_694802.2| thioredoxin reductase 3 [Mus musculus]
    MSSPPGRRARLASPGTSRPSSEAREELRRRLRDLIEGNRVMIFSKSYCPHSTRVKELFSSLGVVYNILELDQVDDGASVQ
    EVLTEISNQKTVPNIFVNKVHVGGCDRTFQAHQNGLLQKLLQDDSAHDYDLIIIGGGSGGLSCAKEAANLGKKVMVLDFV
    VPSPQGTTWGLGGT
    CVNVGCIPKKLMHQAALLGHALQDAKKYGWEYNQQVKHNWEAMTEAIQSHIGSLNWGYRVTLREKG
    VTYVNSFGEFVDLHKIKATNKKGQETFYTASKFVIATGERPRYLGIQGDKEY
    CITSDDLFSLPYCPGCTLVVGASYVGLE
    CAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGKLKVVAKSTEGPETVEGIY
    NTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIGDILDGKPELTPVAIQAGKLLARRLFGVSLEK
    CDYINIPTTVFTPLEYGCCGLSEEKAIEMYKKENLEVYHTLFWPLEWTVAGRDNNTCYAKIICNKFDNERVVGFHLLGPN
    AGEITQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGC
    CG

    >gi|21313208|ref|NP_083895.1| methionine sulfoxide reductase B2 [Mus musculus]
    MARLLRALRGLPLLQAPGRLARGCAGSGSKDTGSLTKSKRSLSEADWQKKLTPEQFYVTREKGTEAPFSGMYLNNKETGM
    YHCVCCDSPLFSSEKKYCSGTGWPSFSEAYGSKGSDESHTGILRRLDTSLGCPRMEVVCKQCEAHLGHVFPDGPKPTGQR
    F
    CINSVALKFKPSKP

    >gi|111119005|ref|NP_081928.2| selenoprotein I [Mus musculus]
    MAGYEYVSPEQLSGFDKYKYSALDTNPLSLYIMHPFWNTIVKVFPTWLAPNLITFSGFMLLVFNFLLLTYFDPDFYASAP
    GHKHVPDWVWIVVGILNFAAYTLDGVDGKQARRTNSSTPLGELFDHGLDSWSCVYFVVTVYSIFGRGPTGVSVFVLYLLL
    WVVLFSFILSHWEKYNTGVLFLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIIGCALCVTLPMSLL
    NFFRSYKSNTLKHKSVYEAMVPFFSPCLLFTLCTVWILWSPSDILEIHPRIFYFMVGTAFANITCQLIVCQMSSTRCPTL
    NWLLLPLLLVVAAVIVGAATSRLESALLYTLTAAFTLAHIHYGVQVVKQLSRHFQIYPFSLRKPNSD
    CLGMEEQNIGL

    >gi|25286717|ref|NP_742051.1| thioredoxin domain containing 9 [Mus musculus]
    MEGNGSVDMFSEVLENQFLQAAKLVENHLDSEIQKLDQIGEDELELLKEKRLAALRKAQQQKQEWLSKGHGEYREIGSER
    DFFQEVKESEKVVCHFYRDTTFR
    CKILDRHLAILAKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALLRDGKTQDYVVG
    FTDLGNTDDFTTETLEWRLGCSDVINYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

    >gi|6753010|ref|NP_035913.1| anterior gradient 2 [Mus musculus]
    MEKFSVSAILLLVAISGTLAKDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDE
    CPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALL
    YDNMKKALKLLKTEL

    >gi|125628657|ref|NP_075552.2| interferon gamma inducible protein 30 [Mus musculus]
    MSWSPILPFLSLLLLLFPLEVPRAATASLSQASSEGTTTCKAHDVCLLGPRPLPPSPPVRVSLYYESLCGACRYFLVRDL
    FPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCL
    QVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELLSIVCQLYQGTEKPDICSSIAD
    SPRKVCYK

    >gi|13195626|ref|NP_077160.1| glutathione peroxidase 7 [Mus musculus]
    MVAAVATAWLLLWAAACAQSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNV
    LAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDP
    TVPVAEIKPRITEQVMKLILRKREDL

    >gi|6755911|ref|NP_035790.1| thioredoxin 1 [Mus musculus]
    MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCEVKCMPTFQFY
    KKGQKVGEFSGANKEKLEASITEYA

    >gi|31560539|ref|NP_035693.2| peroxiredoxin 2 [Mus musculus]
    MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVDLFFYPLDFTFVCPTEIIAFSDHAEDFRKLRCEVLGVSVDSQ
    FTHLAWINTPRKEGGLGPLNIPLLADVTKSLSHNYGVLKNDEGVAYRGLFIIDASGVLRQITVNDLPVGRSVDEALRLVQ
    AFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

    >gi|6754976|ref|NP_035164.1| peroxiredoxin 1 [Mus musculus]
    MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK

    >gi|84370340|ref|NP_001033681.1| glutaredoxin 2 isoform a [Mus musculus]
    MSWRRAASVGRRLVASGRILAGRRGAAGAAGSGMGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIF
    HDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH

    >gi|7657067|ref|NP_056589.1| ERO1-like [Mus musculus]
    MGRAWGLLVGLLGVVWLLRLGHGEERRPETAAQRCFCQVSGYLDDCTCDVETIDKFNNYRLFPRLQKLLESDYFRYYKVN
    LKKPCPFWNDINQ
    CGRRDCAVKPCHSDEVPDGIKSASYKYSEEANRIEECEQAERLGAVDESLSEETQKAVLQWTKHDDS
    SDSFCEIDDIQSPDAEYVDLLLNPERYTGYKGPDAWRIWSVIYEENCFKPQTIQRPLASGRGKSKENTFYNWLEGLCVEK
    RAFYRLISGLHASINVHLSARYLLQDTWLEKKWGHNVTEFQQRFDGILTEGEGPRRLRNLYFLYLIELRALSKVLPFFER
    PDFQLFTGNKVQDAENKALLLEILHEIKSFPLHFDENSFFAGDKNEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQ
    TQGLGTALKILFSEKLIANMPESGPSYEFQLTRQEIVSLFNAFGRISTSVRELENFRHLLQNVH

    >gi|34328489|ref|NP_034474.3| glutathione reductase 1 [Mus musculus]
    MALLPRALGVGAAPSLRRAARALTCAMASPGEPQPPAPDTSSFDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTC
    VNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCEGKFSWHVIKQKRDAYVSRLNTIYQNNLTKSHIEIIHGYATFADGPRP
    TVEVNGKKFTAPHILIATGGVPTVPHESQIPGASLGITSDGFFQLEDLPSRSVIVGAGYIAVEIAGILSALGSKTSLMIR
    HDKVLRNFDSLISSNCTEELENAGVEVLKFTQVKEVKKTSSGLELQVVTSVPGRKPTTTMIPDVDCLLWAIRRDPNSKGL
    NLNKVGIQTDEKGHILVDEFQNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIG
    TVGLTEDEAVHKYGKDNVKIYSTAFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKA
    DFDNTVAIHPTSSEELVTLR

    >gi|29789158|ref|NP_080087.1| NHL repeat containing 2 [Mus musculus]
    MAAPGARGASLSGLLPAQTSLEYALLDAVTQQEKDELVYQYLQKVDGWEQDLAVPEFPEGLEWLNTEEPLSIYKDLCGKV
    VVLDFFTYC
    CINCIHVLPDLHALERRFSDKDGLLIVGVHSAKFPNEKVLDNIKSAVLRYNITHPVVNDADASLWQELEVS
    CWPTLVILGPRGNLLFSLIGEGHRDKLFSYTSIALKYYKDRGQIRDGKIGIKLFKESLPPSPLLFPGKVAVDHATGRLVV
    ADTGHHRILVIQKNGRIQSSIGGPNPGRKDGMFSESSFNSPQGVAIADNVIYVADTENHLIRKIDLEAEKVTTVAGVGIQ
    GTDTEGGEEGDKQPISSPWDVALGTSGSEVQRNDILWIAMAGTHQIWALLLDSGTLPKKSDLKKGTCIRFAGSGNEENRN
    NAYPHKAGFAQPSGLALASEEPWSCLFVADSESSTVRTVSLRDGAVKHLVGGERDPMNLFAFGDVDGAGINAKLQHPLGV
    AWDEERQVLYVADSYNHKIKVVDPKTKGCTTLAGTGDASDASSSFAESAFNEPGGLCIGESGRLLYVADTNNHQIKVMDL
    EARTVSVLPVCKSDSAVVDGSFPREKQKTVPKVPKSAAHIGLPPVTVHPGQALQLRLKLQLPPGAKLTEGAPSCWFLEAE
    GNEWLLQEQTPSGDIENISNQPAISLQIPTHCLSLEAVVSVVVFLYYCSADSSACMMKGVVFRQPLQITSTQPACAAPVE
    LAYAF

    >gi|84370332|ref|NP_001033682.1| glutaredoxin 2 isoform b [Mus musculus]
    MGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERT
    VPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH

    >gi|65301475|ref|NP_619611.2| 3-mercaptopyruvate sulfurtransferase [Mus musculus]
    MAAPQLFRALVSAQWVAEALKAPRSSQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPNAT
    HFADYAGSLGVSAATHVVIYDGSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRHWLNQNLPISSGKSHSEPAEFSAQLDP
    SFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTNEGLEKSPEEIKRLFKEKKVDL
    SKPLVAT
    CGSGVTACHVVLGAFLCGKSDVPVYDGSWVEWYMRAQPEHIISEGRGKTQ

    >gi|31981458|ref|NP_444338.2| glutaredoxin [Mus musculus]
    MAQEFVNCKIQSGKVVVFIKPTCPYCRKTQEILSQLPFKQGLLEFVDITATNNTSAIQDYLQQLTGARTVPRVFIGKDCI
    GGCSDLISMQQTGELMTRLKQIGALQL

    >gi|82887806|ref|XP_916934.1| PREDICTED: similar to molybdenum cofactor synthesis 3 [Mus musculus]
    MAAPEDVAALQAEITRREEELASLKRRLAAALTAEPEPERPLRVPPPPLAPRAALSRDEILRYSRQLLLPELGVRGQLRL
    AAAAVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLARQVLHGEAQAGESKARSAAAALRRLNSAVECVAYPRA
    LAEDWALDLVRGYDVVADCCDNVPTRYLVNDACVLAGRPLVSASALRFEGQMTVYHHDGGPCYRCVFPRPPPPETVTN
    CA
    DGGVLGAVPGVLGCAQALEVLKIAAGLGSSYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTRLQDYEAFCGSSA
    TDKCRALKLLCPEERISVTDYKRLLDSGAPHVLLDVRPQVEVDICRLPHSLHIPLSQLERRDADSLKLLGAALRKGKQES
    QEGVALPVYVICKLGNDSQKAVKVLQSLTAVPELDSLTVQDIVGGLMAWAAKIDGTFPQY

    >gi|81295807|ref|NP_082181.2| selenoprotein O [Mus musculus]
    MASVRAAVGASLAVARTRPRCVGLALPSSAPRSAWAAAMEPTPRWLAGLRFDNRALRELPVETPPPGPEDSLATPRPVPG
    ACFSRARPAPLRRPRLVALSEPALALLGLEASEEAEVEAEAALFFSGNALLPGTEPAAHCYCGHQFGQFAGQLGDGAAMY
    LGEVCTAAGERWELQLKGAGPTPFSRQADGRKVLRSSIREFLCSEAMFHLGIPTTRAGACVTSESTVMRDVFYDGNPKYE
    KCTVVLRIAPTFIRFGSFEIFKPPDEHTGRAGPSVGRDDIRVQLLDYVISSFYPEIQAAHTCDTDNIQRNAAFFREVTQR
    TARMVAEWQCVGFCHGVLNTDNMSIVGLTIDYGPFGFLDRYDPDHICNASDNAGRYTYSKQPQVCKWNLQKLAEALEPEL
    PLALAEAILKEEFDTEFQRHYLQKMRKKLGLIRVEKEEDGTLVAKLLETMHLTGADFTNTFCVLSSFPADLSDSAEFLSR
    LTSQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALIGTQANVTKELERVEHQSRLEQLSPSDLQRKNRDHWEAWL
    QEYRDRLDKEKEGVGDTAAWQAERVRVMRANNPKYVLRNYIAQKAIEAAENGDFSEVRRVLKLLESPYHSEEEATGPEAV
    ARSTEEQSSYSNRPPLWAAELCVT
    CSS

    >gi|38348230|ref|NP_080460.2| endoplasmic oxidoreductase 1 beta [Mus musculus]
    MSPGFRRAVTGQGAAAAVQLLVTLSFLSSLVKTQVTGVLDDCLCDIDSIDKFNTYKIFPKIKKLQERDYFRYYKVNLKRP
    CPFWAEDGH
    CSIKDCHVEPCPESKIPVGIKAGRSNKYSQAANSTKELDDCEQANKLGAINSTLSNESKEAFIDWARYDDS
    QDHFCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLC
    LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFRRRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPY
    FERSIVDLYTGNVEDDADTKTLLLSIFQDTKSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWG
    KLQTQGLGTALKILFSEKEIQNLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKALLQHRR

    >gi|31982856|ref|NP_031887.2| dihydrolipoamide dehydrogenase [Mus musculus]
    MQSWSRVYRSLAKKGHFNRISHGLQGVSSVPLRTYADQPIEADVTVIGSGPGGYVAAIKSAQLGFKTVCIEKNETLGGTC
    LNVGCIPSKALLNNSHYYHMAHGKDFASRGIEIPEVRLNLEKMMEQKHSAVKALTGGIAHLFKQNKVVHVNGFGKITGKN
    QVTATKADGSTQVIDTKNILVATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVT
    AVEFLGHVGGIGIDMEISKNFQRILQRQGFKFKLNTKVTGATKKSDGKIDVSVEAASGGKAEVITCDVLLVCIGRRPFTQ
    NLGLEELGIELDPKGRIPVNNRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVA
    WVGKSEEQLKEEGIEFKIGKFPFAANSRAKTNADTDGMVKILGHKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
    ARVCHAHPTLSEAFREANLAAAFGKPINF

    >gi|23943824|ref|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [Mus musculus]
    MSTEESEFPQQVSSTPMFSENTVHPRHEVSPKPSSKNTQLKQENISKSSGYSKQTNYSNTPKSLAKTTHPKQGSTLKPAT
    NSTHYREDDIPKSSEDIIQPKKGDRPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQS
    KKEDRPKSSEDIIQPKKEDRPKSSEDSVPSKKGDRPKSSEDSVQPKKEDRPKSSEDSVQSKEGEVHKPLKDSIQSKETKV
    PKSPQDSIQSKEDKTHRPLKDSVQSKESEEPKSSHESIQSKEDKIHKPLKDSIPSKEGDIPKSPEDTIQSQEEITASEED
    TIQSQEGNTIKSSEEDVQLSESKLLGLGAEIETLEEGLVRVIKDKEEFEEVLKDAGEKLVAVDFSAAW
    CGPCRMMKPLFH
    SLSLKHEDVIFLEVDTEDCEQLVQDCEIFHLPTFQFYKNEEKVGEFSGALVGKLERSISELK

    >gi|23956334|ref|NP_705787.1| quiescin Q6 sulfhydryl oxidase 2 [Mus musculus]
    MAAARAVARDPGAYARQPPSLRAARLPRLLFLLAVVAAVGPREGGGARLYREGSDAVWLLDSGSVRSATGNSSAAWLVQF
    HSSWCGHCIGYAPTWRALAADVRDWAAAIRVAALDCAEEKNQDVCRTYDIHFYPTFRYFKAFTKEFTTGENFKGPDRELR
    TVRQTMIDFLQNHTEGTWPPACPPLDPIQSSDILSFMDSHSGQYHAIVFESNGSYVGREVILDLIPYENIMVSRALDTDK
    AFLGTLGITSVPSCYLIYPNGSHGLVNVAKPLRSFFSSHLKSLPDVRKKSLFLPEKSNKEEKSEVVVWKEFDRAKLYTAD
    LESGLHYLLRVELAAHRSLAGAQLKTFRDFVTVVAKLFPGRPAVKKLLETLQEWLANLPLDKIPYNAILDLVNNKMQISG
    IFLTSHVKWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALAGTGFEGHPQAVLQAIRRYIRTFFG
    CKECGEHFEEM
    AKESMDSVKTPDQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPWPTPDLCPACHEEIKGLDSWNEGQVLLFLKQHYSRDN
    LVDAYSVDQGSPGSVLRARPWLGQMARLSHVNLLPHFPVEEVSSLKPGVLCLKTNKPRSSLGVSKDEHSWSVSLRIGPI

    >gi|102468565|ref|NP_038739.2| thioredoxin reductase 2 precursor [Mus musculus]
    MAAMVAAMVAALRGPSRRFRPRTRALTRGTRGAASAAGGQQSFDLLVIGGGSGGLACAKEAAQLGKKVAVADYVEPSPRG
    TKWGLGGT
    CVNVGCIPKKLMHQAALLGGMIRDAHHYGWEVAQPVQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYFNI
    KASFVDEHTVRGVDKGGKATLLSAEHIVIATGGRPRYPTQVKGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFL
    TGIGLDTTVMMRSIPLRGFDQQMSSLVTEHMESHGTQFLKGCVPSHIKKLPTNQLQVTWEDHASGKEDTGTFDTVLWAIG
    RVPETRTLNLEKAGISTNPKNQKIIVDAQEATSVPHIYAIGDVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMDYSNVPT
    TVFTPLEYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAGEVTQGF
    ALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLEPTVTGC
    CG

    >gi|28916703|ref|NP_796230.1| peroxiredoxin 5 related sequence 1 protein [Mus musculus]
    MPGGLLLGEEAPDFEANTTIGRIRFHDFLGNSWGMLFSHPKDFTPVCTTELGRAAKLAPEFAKRNVKLIALSVDSVEDHL
    AWSKDINAYNGATPKEKLPFPIIDDKDRDISILFCMLDPVEKDANSMPLTARGVFIFGPDKKLKMSLLYPNSTGRNFDEI
    LRVIDSLQLTETKPVATPVDWKKGESVMVLPDLPEEEAKRCFPKGISTTKLPSGKNYLRYTPQP

    >gi|51761889|ref|XP_133805.2| PREDICTED: protein disulfide isomerase-like protein of the testis [Mus musculus]
    MAHSSKAPSPGPLESQNSEHSFRGSCDLHVLKQELPFCSWVSWAHSLADRSCSQHKRKLKAFSSDFCTLPDCHRADCPSS
    MWPDSPESNPAACRPSMELLWTPLLLVAACLSEVLGSPEIDTGINISQPLHILEDHNLMVLTPAGLTQTLNETRFLMVIF
    HNPSLKQSRKLAKELGKAAEIFGKGKNGLGFGKVDITKETELQQEFDITHAPELKLFFEGNRLKPISCKDVVESTALVVW
    LRRQISKKALLFNNSDEVADFVKSRPLVIVGFFQDLEEEVAELFYDTIKDFPELTFGAIQIKNSFGRFHVILDSVLVFKK
    GKIVKRQELINDSTNKDHLNQVIKQQLTGFVIELNPENKDLIYELNILNHMLLFISKSSEPYSTISRHYRQIAKEFQNKI
    LFVLVNADEPKNKRIFEYFQISRVNVPSVQILNLSSDGRYKMPTDDINFESLKKFCNSFLSKTAKKHKASEEIPKYWDQG
    PVKKLVGKNFNVVVLDKEKDVFVMFYAPWSEK
    CRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFP
    TDSQEAVMYKGEHTMKGFCDFLESHVKVRIEEEDELLYIEQNEEEEVLAEPEIQLIEKLPENPLLKIEDTSKQDRPVKES
    PVLDSIRKPEEPERRKETAEREAAAAQPKEQPKPERKLEVKEEL

    >gi|149263924|ref|XP_484225.3| PREDICTED: hypothetical protein LOC432732 [Mus musculus]
    MSASLVRATVWAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVIQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV

    >gi|84370330|ref|NP_075994.2| glutaredoxin 2 isoform b [Mus musculus]
    MGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERT
    VPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH

    >gi|7304963|ref|NP_038913.1| chloride intracellular channel 4 (mitochondrial) [Mus musculus]
    MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITF
    NSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLP
    DEIDENSMEDIKFSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV
    EIAYSDVAKRLTK

    >gi|13384744|ref|NP_079646.1| hypothetical protein LOC66129 [Mus musculus]
    MAAPVTRQVSGCAGRVPSPAGSVTERGQPLAAAVAELPVLDASGRRVTFGALFRERRAVVVFVRHFLCYVCKEYVEDLAK
    IPKSVLREADVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEISSSGQSPHIKSNLLSGSLQSLWR
    AVTGPLFDFQGDPAQQGGTLILGPGNNIHFVHRDRNRLDHKPINSVLQLVGVQPVNFMSRPTVIHV

    >gi|27229118|ref|NP_082129.2| methyltransferase like 7B [Mus musculus]
    MDALVLFLQLLVLLLTLPLHLLALLGCWQPICKTYFPYFMAMLTARSYKKMESKKRELFSQIKDLKGTSGNVALLELGCG
    TGANFQFYPQGCKVTCVDPNPNFEKFLTKSMAENRHLQYERFIVAYGENMKQLADSSMDVVVCTLVLCSVQSPRKVLQEV
    QRVLRPGGLLFFWEHVAEPQGSRAFLWQRVLEPTWKHIGDG
    CHLTRETWKDIERAQFSEVQLEWQPPPFRWLPVGPHIMG
    KAVK

    >gi|86198316|ref|NP_033917.2| protein disulfide isomerase associated 4 [Mus musculus]
    MKLRKAWLLVLLLALTQLLAAASAGDAHEDTSDTENATEEEEEEEEEDDDDLEVKEENGVWVLNDGNFDNFVADKDTVLL
    EFYAPW
    CGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKV
    REVSQPDWTPPPEVTLSLTKDNFDDVVNNADIILVEFYAPW
    CGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLA
    KRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVVIIGLFQGDGDPAYLQYQ
    DAANNLREDYKFHHTFSPEIAKFLKVSLGKLVLTHPEKFQSKYEPRFHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSN
    DAKRYSKRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGK
    KFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDAIVMDPKKDVLIEFYAPW
    CGHCKQLEPI
    YTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTKEE
    L

    >gi|117606385|ref|NP_938037.2| thioredoxin domain containing 10 [Mus musculus]
    MANAVGRRSWAALRLCAAVILLDLAVCKGFVEDLNESFKDNRKDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPV
    KVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFDHVRKRHRVFFVYI
    GGESPLKEKYIDAASELIVYTYFFSASEDVVPEYVTLKEMPAVLVFKDDTYFVYDEYEDGDLSSWISRERFQNYLTMDGF
    LLYELGDTGKLVAIAVIDEKNTSLEHTRLKSIIQEVARDFRDHFHRDFQFGHMDGNDYINTLLMDELTVPTIVVLNTSNQ
    QYFLLDRHIKDASDMVQFINSILDGTVPAQGGDSIFQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIY
    TADTDGGYIEERYEVSKSEMENQEQIEESKEQESSSGGSLAPTVQEPKDVLEKKKD

    >gi|28893017|ref|NP_796066.1| methionine-R-sulfoxide reductase B3 [Mus musculus]
    MSAFNLLHLVTKSQPVAPRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPAFHDVISSEAIEFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFT
    PADSSEAEGSGIKESGSPAAADRAEL

    >gi|13384990|ref|NP_079835.1| hypothetical protein LOC103742 [Mus musculus]
    MSGEPAPVSVVPPPGEVEAGSGVHIVVEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLEN
    GGFPYEKDLMEAIRRASNGEPVEKITNSRPPCVIL

    >gi|110224447|ref|NP_001035988.1| thioredoxin reductase 1 isoform 1 [Mus musculus]
    MPVDDCWLYFPASRGRTFVQTVWVAPTCPNCCWFPGFLPPVPRPPHVPRVLLRGPRGAVLPASRPSKTLPSSSQTPCPTD
    PCICPPPSTPDSRQEKNTQSELPNKKGQLQKLPTMNGSKDPPGSYDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTP
    TPLGTRWGLGGT
    CVNVGCIPKKLMHQAALLGQALKDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVV
    YENAYGRFIGPHRIVATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEY
    CISSDDLFSLPYCPGKTLVVGASYVALECA
    GFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNT
    VLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCD
    YDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAG
    EVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQSGC
    CG

    >gi|6680690|ref|NP_031478.1| peroxiredoxin 3 [Mus musculus]
    MAAAAGRLLWSSVARHASAISRSISASTVLRPVASRRTCLTDILWSASAQGKSAFSTSSSFHTPAVTQHAPYFKGTAVVN
    GEFKELSLDDFKGKYLVLFFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIT
    LLSDITKQISRDYGVLLESAGIALRGLFIIDPNGVVKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPESPT
    IKPSPTASKEYFEKVHQ

    >gi|52693935|ref|NP_780359.2| disulfide isomerase [Mus musculus]
    MQLLCWWQVLLWVLGLPAHGLEVAEDSGHPWREERPVPALQVGAVYLHEEEVAQDHRDQARAAEPMEASLGPRGDPMVVL
    SVVPGAAEDQRSPEAHDGTCSAQGEEDPSCGRENLFGLQGAGGFQDREEEYYAEPGVTEAEPVATEDANSTDSLKSPKVN
    CEERNVTGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPW
    CRFSASLAPHFNSLPRAFPTLGFLALDASQHSSLSTR
    FGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNVVVTQADQMGPLPSTLIKTVDWLLVFSLFFLISF
    IMYATIRTESIRWLIPGQEQEHAE

    >gi|82546883|ref|NP_001032356.1| selenoprotein H [Mus musculus]
    MAPHGRKRKAGAAPMETVDKREKLAEGATVVIEHCTSCRVYGRHAAALSQALQLEAPELPVQVNPSKPRRGSFEVTLLRS
    DNSRVELWTGIKKGPPRKLKFPEPQEVVEELKKYLS

    >gi|21312189|ref|NP_081197.1| HESB like domain containing 2 [Mus musculus]
    MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVIQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV

    >gi|21312153|ref|NP_082695.1| glutaredoxin 5 [Mus musculus]
    MSASLSRAAAALLRWGRSAGGGGLPGAGVRAASSGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRD
    YAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALVDEKDQDSK

    >gi|94400195|ref|XP_001003388.1| PREDICTED: similar to MSP23 isoform 2 [Mus musculus]
    MSSGNAKIGYPAPNFKATGVMPDGQFKDTSLSEYKGKYVVFFFYPLDFTFVCPTEIIAFRDRADEFKKLTCQVIGVSVDS
    HFCHLPWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILQQITINDLPVGRSVDEIIRLV
    QAFQFTDKHGEVCPAGWKPSSDTIKPDVNKSKEYFSKQK

    >gi|31543902|ref|NP_058072.2| thioredoxin-like 1 [Mus musculus]
    MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFL
    FFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDADIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDMSFLESD
    CDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
    VNSVTLFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|68131562|ref|NP_001020116.1| quiescin Q6 sulfhydryl oxidase 1 isoform a [Mus musculus]
    MRRCGRLSGPPSLLLLLLLLSPLLFSGPGAYAARLSVLYSSSDPLTLLDADSVRPTVLGSSSAWAVEFFASWCGHCIAFA
    PTWKELANDVKDWRPALNLAVLDCAEETNSAVCREFNIAGFPTVRFFQAFTKNGSGATLPGAGANVQTLRMRLIDALESH
    RDTWPPACPPLEPAKLNDIDGFFTRNKADYLALVFEREDSYLGREVTLDLSQYHAVAVRRVLNTESDLVNKFGVTDFPSC
    YLLLRNGSVSRVPVLVESRSFYTSYLRGLPGLTRDAPPTTATPVTADKIAPTVWKFADRSKIYMADLESALHYILRVEVG
    KFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSINDWLQKQQKKRIPYSFFKAALDSRKEDAVLTEKVNWVGCQGSE
    PHFRGFPCSLWVLFHFLTVQANRYSEAHPQEPADGQEVLQAMRSYVQFFFG
    CRDCADHFEQMAAASMHQVRSPSNAILWL
    WTSHNRVNARLSGALSEDPHFPKVQWPPRELCSACHNELNGQVPLWDLGATLNFLKAHFSPANIVIDSSASRHTGRRGSP
    EATPELVMDTLKLESRNSVLGHEQAASAESPGATALDVPAEKPEASGPQELYTGLRMGGASPGQGPPERMEDHQRDMQEN
    APGQQHLSKRDTEALFLPEVNHLQGPLELRRGGRSPKQLAPILEEEPEALAIQGQGQWLQVLGGGISHLDISLCVGLYSV
    SFMGLLAMYTYFRARLRTPKGHASYPTA

    >gi|83921612|ref|NP_663342.3| thioredoxin domain containing 5 [Mus musculus]
    MPPRPGRLLQPLAGLPALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQR
    LQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPAT
    PEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVC
    SEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDT
    IAQGITFVKFYAPW
    CGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGR
    DLDSLHSFVLRQAKDEL

    >gi|31560120|ref|NP_081126.2| phosducin-like 3 [Mus musculus]
    MQDPNADTEWNDILRKKGILPPKESLKELEEEEAEKEEQLLQQSVVKTYEDMTLEELEENEDEFSEEDERAIEMYRQQRL
    AEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPL
    CSLINHHLSGLARKFPDVKFIKAISTTCIPNYP
    DRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTALEENPKKPIQDLLLSSVRGPVPMRRDSDSEDD


    >gi|84370335|ref|NP_001033683.1| glutaredoxin 2 isoform b [Mus musculus]
    MGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERT
    VPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH

    >gi|124486724|ref|NP_001074539.1| protein disulfide isomerase associated 2 [Mus musculus]
    MDKQLLPVLLLLLGVSGSWGQGEEPGGPSEVLPEEPTGEEVPKEDGILVLNHRTLSLALQEHSALMVEFYAPWCGHCKEL
    APEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATH
    LEDEEGVQALMAKWDMVVIGFFQDLQGKDMATFLALAKDALDMTFGFTDQPQLFEKFGLTKDTVVLFKKFDEGRADFPVD
    KETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDVAA
    DNSHVLNYFGLKAEEAPTLRLINVETTKKYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKN
    FEQVAFDETKNVFVKFYAPW
    CSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVID
    YKSTRDLETFSKFLDSGGHLPKEEPKEPAASAPEAQANSTLGPKEEL

    >gi|6754062|ref|NP_034473.1| glutathione peroxidase 5 [Mus musculus]
    MVTELRVFYLVPLLLASYVQTTPRPEKMKMDCYKDVKGTIYDYEALSLNGKEDIPFKQYRGKHVLFVNVATYCGLTIQYP
    ELNALQEDLKPFGLVILGFPCNQFGKQEPGDNLEILPGLKYVRPGKGFLPNFQLFAKGDVNGENEQKIFTFLKRSCPHPS
    ETVVMSKHTSWEPIKVHDIRWNFEKFLVGPDGVPVMRWFHQAPVSTVKSDIMAYLSHFKTI

    >gi|6679160|ref|NP_032776.1| nucleoredoxin [Mus musculus]
    MSGFLEELLGDKLVTGGGEEVDVHSLGARGIALLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGAGAGAGAAAEP
    EPRHRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRVSNIPSLIFLDATTGKVVCRNGLLVIRDDPEG
    LEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAGQEFEIIFVSADRSE
    ESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNA
    VQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDM
    SARAKYVMDVEEITPAIVETFVNDFLAEKLKPEPI

    >gi|22165362|ref|NP_083449.1| nucleoredoxin [Mus musculus]
    MVDVLGGRRLVTREGTVVEAEVALQNKVVALYFAAGRCSPSRDFTPLLCDFYTELVSEARRPAPFEVVFVSADGSAEEML
    DFMRELHGSWLALPFHDPYRHELKKRYEITAIPKLVVIKQNGAVITNKGRKQIRERGLACFQNWVEAADVFQNFSG

    >gi|149241041|ref|XP_001479521.1| PREDICTED: similar to nonselenium glutathione peroxidase [Mus musculus]
    MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHL
    AWSKEAKQCFPKGVFTKELPSGKKYLRYTPQP

    >gi|149262992|ref|XP_001476035.1| PREDICTED: similar to Protein disulfide isomerase associated 6 [Mus musculus]
    MRVIGMARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDV
    VKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGD
    SSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIK
    GFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNS
    YLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLR

    >gi|13569841|ref|NP_056577.2| thioredoxin reductase 1 isoform 2 [Mus musculus]
    MNGSKDPPGSYDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQAL
    KDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHRIVATNNKGKEKIYSAERFLIA
    TGERPRYLGIPGDKEY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
    EEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTD
    EEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIE
    VYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFT
    TLSVTKRSGGDILQSGC
    CG

    >gi|19072792|ref|NP_083848.1| thioredoxin domain containing 4 [Mus musculus]
    MNPAVFLSLADLRCSLLLLVTSIFTPITAEIASLDSENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEYP
    DKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSNPVHEIQSLDEVTNLDRSK
    RNIIGYFEQKDSENYRVFERVASILHDDCAFLSAFGDLSKPERYNGDNVIYKPPGRSAPDMVYLGSMTNFDVTYNWIQDK
    CVPLVREITFENGEELTEEGLPFLILFHMKDDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPV
    IAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQDQDVASSPPESSFQKLAPSEYRYTLL
    RDRDEL

    >gi|12963609|ref|NP_075757.1| quiescin Q6 sulfhydryl oxidase 1 isoform b [Mus musculus]
    MRRCGRLSGPPSLLLLLLLLSPLLFSGPGAYAARLSVLYSSSDPLTLLDADSVRPTVLGSSSAWAVEFFASWCGHCIAFA
    PTWKELANDVKDWRPALNLAVLDCAEETNSAVCREFNIAGFPTVRFFQAFTKNGSGATLPGAGANVQTLRMRLIDALESH
    RDTWPPACPPLEPAKLNDIDGFFTRNKADYLALVFEREDSYLGREVTLDLSQYHAVAVRRVLNTESDLVNKFGVTDFPSC
    YLLLRNGSVSRVPVLVESRSFYTSYLRGLPGLTRDAPPTTATPVTADKIAPTVWKFADRSKIYMADLESALHYILRVEVG
    KFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSINDWLQKQQKKRIPYSFFKAALDSRKEDAVLTEKVNWVGCQGSE
    PHFRGFPCSLWVLFHFLTVQANRYSEAHPQEPADGQEVLQAMRSYVQFFFG
    CRDCADHFEQMAAASMHQVRSPSNAILWL
    WTSHNRVNARLSGALSEDPHFPKVQWPPRELCSACHNELNGQVPLWDLGATLNFLKAHFSPANIVIDSSASRHTGRRGSP
    EATPELLL

    >gi|63479994|ref|XP_129558.3| PREDICTED: similar to KAT protein isoform 1 [Mus musculus]
    MAGVPTVSFSELRSLVASGRARLFDVRSPEEAAAGTIPGALNIPVSELEIALNMDPAAFQTLYCAEKPKLEDKNLIFFCQ
    MGRRGLQATQLAQGLGYTGARNYAGAYKEWLEKQG

    >gi|116256507|ref|NP_031537.2| ATPase, Cu++ transporting, beta polypeptide [Mus musculus]
    MDPRKNLASVGTMPEQERQVTAKEASRKILSKLALPGRPWEQSMKQSFAFDNVGYEGGLDSTSSSPAATDVVNILGMTCH
    SCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVE
    GMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDVNKLEST
    NLKKETVSPVQISNHFETLGHQGSYLATLPLRIDGMH
    CKSCVLNIEGNIGQLPGVQNIHVSLENKTAQIQYDPSCVTPMF
    LQTAIEALPPGHFKVSLPDGVEENEPQSGSSQRHQEQGPGRTAVLTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGT
    GAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSET
    PSSPGATASQKCFVQIKGMT
    CASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMED
    NTVSEGDIELIITGMT
    CASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQRNPNA
    HHLDHKTEIKQWKKSFLCSLVFGIPVMGLMVYMLIPSSTPQETMVLDHNIIPGLSVLNLIFFILCTFVQFLGGWYFYVQA
    YKSLRHRSANMDVLIVLATTIAYAYSLVILVVAVAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSL
    QATEATVVTLGEDNLILREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSIN
    AHGSVLLKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIVIGFVDFGVVQKYFPSPS
    KHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPR
    VMRFLLLADVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKVSNVEGILARSDL
    TAHPVGVGNPPTGEGAGPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAA
    LAIYTLKSMGVDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNEGKKVAMVGDGVNDSPALAQADVGIA
    IGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMGSAAMAASS
    VSVVLSSLQLKCYRKPDLERYEAQAHGRMKPLSASQVSVHIGMDDRRRDSPRATAWDQVSYVSQVSLSSLTSDRLSRHGG
    AAEDGGDKWSLLLSDRDEEQCI

    >gi|6678483|ref|NP_033483.1| ubiquitin-activating enzyme E1, Chr X [Mus musculus]
    MSSSPLSKKRRVSGPDPKPGSNCSPAQSALSEVSSVPTNGMAKNGSEADIDESLYSRQLYVLGHEAMKMLQTSSVLVSGL
    RGLGVEIAKNIILGGVKAVTLHDQGTTQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSSFQ
    VVVLTNSPLEAQLRVGEFCHSRGIKLVVADTRGLFGQLFCDFGEEMVLTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARH
    GFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLPASLVEPDFVMTDF
    AKYSRPAQLHIGFQALHQFCALHNQPPRPRNEEDATELVGLAQAVNARSPPSVKQNSLDEDLIRKLAYVAAGDLAPINAF
    IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEALTEEKCLPRQNRYDGQVAVFGSDFQEKLSKQKYFLVGAGAIG
    CELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPYIQVTSHQNRVGPDTERIY
    DDDFFQNLDGVANALDNIDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQPAENVNQYLTDSKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWGDCVTWACHHWHTQYCN
    NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNTLHLDYVMAAANLFAQTYGLTGSQDRAAVASLLQSVQVPEFT
    PKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDISPADR
    HKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHQQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
    QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCC
    NDESGEDVEVPYVRYTIR

    >gi|15617203|ref|NP_254279.1| chloride intracellular channel 1 [Mus musculus]
    MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI
    EEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVARAL
    K

    >gi|149264021|ref|XP_985754.2| PREDICTED: similar to HESB like domain containing 2 [Mus musculus]
    MSASLVRATVWAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVIQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV

    >gi|27229085|ref|NP_081361.1| chloride intracellular channel 3 [Mus musculus]
    MAETTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFAPGSQLPILLYDGDVKTDTLQIE
    EFLEETLGPPDFPSLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDNALYQQLLRALTRLDSYLRAPLDHELAQEPHLRES
    HRRFLDGDQFTLADCSLLPKLHIVDTVCAHFRQLPIPAELSCVRRYLDSALQKKEFKYTCPHSAEILAAYQPAVHPR

    >gi|149260176|ref|XP_893103.3| PREDICTED: hypothetical protein [Mus musculus]
    MLGSKGLTVVDVYQGWCGPCKPMVSLFQKMRIEVGLDRLHFASAEADRLDVLEKYQGKCEPTFLFYTATDEELLGALKWP
    PHRKDGGEDGDIASSGKTCTLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHH
    MCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRELALLFPSFKFS
    DKDKEAPPGEPSQQPQLKLTELG

    >gi|25023734|ref|XP_203592.1| PREDICTED: HESB like domain containing 1 isoform 1 [Mus musculus]
    MAASRALSLTAEAVRAVIPRRSGRLLAVFPRLLTRWETTSSIPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCS
    GFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSVKV

    >gi|6678449|ref|NP_033463.1| thiosulfate sulfurtransferase, mitochondrial [Mus musculus]
    MVHQVLYRALVSTKWLAESIRSGRLGPSLRVLDASWYSPGTRQARKEYQERHVPGASFFDIEECRDTTSPYEMMLPSEAH
    FGDYVGNLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLNLS
    LLKTYEQVLENLQSKRFQLVDSRAQGRYLGTQPEPDIVGLDSGHIRGSVNMPFMDFLTKDGFEKSPEELRAIFQDKKVDL
    SQPLIAT
    CRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPETRVSQGKSGKA

    >gi|27229101|ref|NP_081740.2| hypothetical protein LOC70564 [Mus musculus]
    MGMWSIGVGAVGAAAVALLLANTDMFLSKPRKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCRAE
    AADLMSLKPKLDELGVPLYAVVKEQVKREVEDFQPYFKGEIFLDEKKKFYGPERRKMMFMGLIRLGVWYNSFRAWNGGFS
    GNLEGEGFILGGVFVIGSGKQGILLEHREKEFGDRVNPLSVLEAVKKIKLQTPASGRS

    >gi|16716395|ref|NP_444332.1| 15 kDa selenoprotein precursor [Mus musculus]
    MAAGQGGWLRPALGLRLLLATAFQAASALGAEFASEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETK
    KLYAGAILEVCG
    CKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLE
    RI

    >gi|6754090|ref|NP_034492.1| glutathione S-transferase omega 1 [Mus musculus]
    MSGESSRSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKNKPEWFFEKNPLGLVPVLENSQG
    HLVTESVITCEYLDEAYPEKKLFPDDPYKKARQKMTLESFSKVPPLIASFVRSKRKEDSPNLREALENEFKKLEEGMDNY
    KSFLGGDSPSMVDYLTWPWFQRLEALELKECLAHTPKLKLWMAAMQQDPVASSHKIDAKTYREYLNLYLQDSPEACDYGL


    >gi|6755921|ref|NP_035796.1| ubiquitin-activating enzyme E1C [Mus musculus]
    MAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDM
    DTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLIS
    LLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVRMLQWPKE
    QPFGDGVPLDGDDPEHIQWIFQKSIERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNN
    YLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSI
    EERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFT

    >gi|27369886|ref|NP_766209.1| chloride intracellular channel 5 [Mus musculus]
    MTDSATTNGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGD
    VKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNSPLPEEI
    DTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELA
    YADVARRLSRS

    >gi|7709986|ref|NP_057891.1| SUMO1 activating enzyme subunit 2 [Mus musculus]
    MALSRGLPRELAEAVSGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESV
    LQFHPQANIEAHHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYE
    CHPKPTQRTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
    KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEANADQQNEPQLGLKDQQVLDVKSYASLF
    SKSIETLRVHLAEKGDGAELIWDKDDPPAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEG
    LKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNTNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQI
    EDGKGTILISSEEGETEANNPKKLSDFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDSPEKVGPKQAEDA
    AKSIANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSTDCSGDDKARKRKLEENEAASTKKCRLEQMEDPDDVIALD

    >gi|31712004|ref|NP_853622.1| thioredoxin domain containing 3 (spermatozoa) [Mus musculus]
    MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRD
    KCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVDAIDEEYGEVQYESAAEVYNMAII
    KPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETL
    PQTDTEEEPGVLEEPHVRFAPVMIKKKRDSLQEYMDRQYMSDYCDVEDDAVKVFKLIDILFPDFKTMKSTNVQTTLALLH
    PDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGP
    KTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKPHVTHKERIHRSSRR

    >gi|46485467|ref|NP_659076.2| spermatogenesis associated 20 [Mus musculus]
    MSHHSSPPPKHKGEHKGHGLPRGSERGSSSRDKDRSATTVSSSAPMPAGGKSSRTNCPPPAPPKTVNRLINEKSPYLLQH
    AYNPVDWYPWGQEAFDKAKKENKPIFLSVGYST
    CHWCHMMEEESFQNEEIGRLLNENFICVMVDREERPDVDKVYMTFVQ
    ATSSGGGWPMNVWLTPGLQPFVGGTYFPPEDGLTRVGFRTVLMRICDQWKLNKNTLLENSQRVTTALLARSEISVGDRQI
    PASAATMNSRCFQQLDEGYDEEYGGFAEAPKFPTPVILNFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIQDHVGQG
    FHRYSTDRQWHIPHFEKMLYDQAQLSVVYTQAFQISGDEFYADVAKGILQYVTRTLSHRSGGFYSAEDADSPPERGMKPQ
    EGAYYVWTVKEVQQLLPEPVVGASEPLTSGQLLMKHYGLSEVGNINSSQDPNGELHGQNVLMVRYSLELTAARYGLEVEA
    VRALLNTGLEKLFQARKHRPKAHLDNKMLAAWNGLMVSGFAVTGAALGMEKLVAQATSGAKFLKRHMFDVSSGRLKRTCY
    AGTGGTVEQSNPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQDTQDKLFWDPRGGGYFCSEAELGADLPLRLKD
    DQDGAEPSANSVSAHNLLRLHSFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRTLSAQQQTLKQIVICGDPQAKDTK
    ALLQCVHSIYVPNKVLILADGDPSSFLSRQLPFLSSLRRVEDRATVYIFENQACSMPITDPCELRKLLHQ

    >gi|82887378|ref|XP_130596.4| PREDICTED: molybdenum cofactor synthesis 3 [Mus musculus]
    MAAPEDVAALQAEITRREEELASLKRRLAAALTAEPEPERPLRVPPPPLAPRAALSRDEILRYSRQLLLPELGVRGQLRL
    AAAAVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLARQVLHGEAQAGESKARSAAAALRRLNSAVECVAYPRA
    LAEDWALDLVRGYDVVADCCDNVPTRYLVNDACVLAGRPLVSASALRFEGQMTVYHHDGGPCYRCVFPRPPPPETVTN
    CA
    DGGVLGAVPGVLGCAQALEVLKIAAGLGSSYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTRLQDYEAFCGSSA
    TDKCRALKLLCPEERISVTDYKRLLDSGAPHVLLDVRPQVEVDICRLPHSLHIPLSQLERRDADSLKLLGAALRKGKQES
    QEGVALPVYVICKLGNDSQKAVKVLQSLTAVPELDSLTVQDIVGGLMAWAAKIDGTFPQY

    >gi|58037267|ref|NP_082235.1| protein disulfide isomerase-associated 6 [Mus musculus]
    MRVIGMARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDV
    VKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGD
    SSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIK
    GFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNS
    YLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGST
    APVGGGSFPTITPREPWDGKDGELPVEDDIDLSDVELDDLEKDEL

    >gi|21311857|ref|NP_080895.1| glutathione S-transferase omega 2 [Mus musculus]
    MSGDLSRCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRARLVLKAKGIRHEVININLKSKPDWYYTKHPFGQITVLENSQC
    QLVYESVIACEYLDDVYPGRKLFPYDPYERARQKMLLELFCKVPPLSKECLIALRCGRDCTDLKVALRQELCNMEEILEY
    QNTTFFGGDCISMIDYLVWPWFERLDVYGLADCVNHTPMLRLWIASMKQDPAVCALHTDKSVFLGFLNLYFQNNPCAFDF
    GLCNPIIR

    >gi|82881907|ref|XP_922904.1| PREDICTED: similar to KAT protein isoform 1 [Mus musculus]
    MAGVPTVSFSELRSLVASGRARLFDVRSPEEAAAGTIPGALNIPVSELEIALNMDPAAFQTLYCAEKPKLEDKNLIFFCQ
    MGRRGLQATQLAQGLGYTGARNYAGAYKEWLEKQG

    >gi|149252111|ref|XP_001474554.1| PREDICTED: hypothetical protein LOC77032 [Mus musculus]
    MCCEGRPRGDKRTLHARVTKKTRLGLAPSPTPALPPCRQHSAREAAWCLCESGREVPLSAGAGCGALKSLDSACRKKSRK
    EPRKGSGQQPRGPREPIVMLARLVLGTSGRAALGSVEPALGGLKSIWRCSQAFCSTPKGVTYRELKSLLNSKDIMLIDVR
    NTLEILEQGKIPGSINIPLDEVGEALQMNPVDFKEKYCQVKPSKSDRLVFS
    CLAGVRSKKAMDTAISLGFNSAQHYAGGW
    KEWVTYEISEEKQES

    >gi|27754130|ref|NP_079858.2| hypothetical protein LOC66469 [Mus musculus]
    MNVVDLGRVGACVLKHAVTGEAVELRSLWQEKACVVAGLRRFGCMVCRWIAQDLSNLRSILDQHDVRLVGVGPEALGLQE
    FLDGGYFSGELYLDESKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLL
    HFIQKSPGDYVPQENILQALGISAEVCSSKPPQCDEEVCGR

    >gi|82943564|ref|XP_913323.1| PREDICTED: similar to Iron-sulfur cluster assembly 2 homolog, mitochondrial precursor (HESB-like domain-containing protein 1) isoform 5 [Mus musculus]
    MAASRALSLTAEAVRAVIPRRSGRLLAVFPRLLTRWETTSSIPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCS
    GFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSVKV

    >gi|110224445|ref|NP_001035979.1| thioredoxin reductase 1 isoform 2 [Mus musculus]
    MNGSKDPPGSYDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQAL
    KDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVALREKKVVYENAYGRFIGPHRIVATNNKGKEKIYSAERFLIA
    TGERPRYLGIPGDKEY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
    EEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTIGLETVGVKINEKTGKIPVTD
    EEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIE
    VYHSFFWPLEWTVPSRDNNKCYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFT
    TLSVTKRSGGDILQSGC
    CG

    >gi|76781476|ref|NP_778198.2| selenoprotein V [Mus musculus]
    MNNKARVPAPSSVRANTPARTPAPIRTATPVRAPNPAHNSTPVRTSIRVRAPAQVPNPVPIRFPTPAPVPAPTLTPAPTP
    APVRHAAPVRTPAPVRAPNLGRVFPKISPGRFFPSLASPTAQPLSSRAASALLKDPTLAQNQKPSIHSLAEAIQGPLPVL
    TPSSSKTQGSIPDTASPIDSLASTAMASSTLGPIPGPNPTLEFLASPLKETPGLGKLSTISPAPSFGSTKEIPSTSEDVP
    TPNRILIRVMY
    CGLCSYGLRYIILKRTLEHQFPNLLEFEEERATQVTGEFEVFVDGKLIHSKKKGDGFVDESGLKKLVGA
    IDEEIKKR

    >gi|60097935|ref|NP_766155.2| methyltransferase like 2 [Mus musculus]
    MAASFPEGVPETEDGKRPQFGHRFLSDPARVFHHNAWDNVKWSEEQAAAAERKVQENSSPLVCPEKQVDYEVNAHKYWDD
    FYRIHENGFFKDRHWLFTEFPELAPSHSHLTGVPLEKQRSDVCEDGPGLTAEQHKCSCASPGCETQVPPLEEPVTQKLGH
    LEISGEEFPGSSATYRILEVGCGVGNTVFPILQTNNNPNPFVYCCDFSATAIELLKTNSQYDPSRCYAFVHDLCDEDQSY
    PVPEDSLDVIVLIFVLSAIVPDKMQKAISKLSRLLKPGGVMLLRDYGRYDMAQLRFKKGQ
    CLSGNFYVRGDGTRVYFFTQ
    GELDTLFTAAGLEKVQNLVDRRLQVNRGKQLTMYRVWIQCKYSKPLALRSSQHVPIPHATESSSHSGLL

    >gi|6754092|ref|NP_034493.1| glutathione transferase zeta 1 (maleylacetoacetate isomerase) [Mus musculus]
    MQAGKPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAIMEYLE
    ETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVS
    MADVCLVPQVANAERFKVDLSPYPTISHINKELLALEVFQVSHPRRQPDTPAELRT

    >gi|94371636|ref|XP_357368.4| PREDICTED: peroxiredoxin 6, related sequence 2 [Mus musculus]
    MPEGLLPGNEAPNSETDTTTIRIYFHDFLGDSWDILFSHPRNFTPVCTTELGRAAKLSPEFAKRNVQLIALPVDSVEDHL
    AWSKDINAYSGTAPTEKLPFPIIDDEDRDLAILWACWIQXRRMIMTCLXPPVWCSYFALTRNXSCLSSTQPSWAGTLMRF
    SEXLILFSXQQQSQLIGRRGRAXWSFPTSLKRKPNDKESSPKSSHLAKNTSIIHPSL

    >gi|119508443|ref|NP_077143.2| DnaJ (Hsp40) homolog, subfamily C, member 10 [Mus musculus]
    MGVWLNKDDFIRDLKRISLCLLILYVVVVVGTDQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPG
    CSH
    CHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTEL
    STGNFVNAIETAFAAGVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCDAQDSLCKSLDTTASTTAYFPPGATL
    NDREKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANQLEDRLAHHRWLVFFHFGKNENANDPELKKLKTLLKNEHIQVGR
    FDCSSAPGICSDLYVFQPCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPW
    C
    PPCRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSIHEYEGHHSAEQILEFIEDLRNPSVVS
    LTPSTFNELVKQRKHDEVWMVDFYSPW
    CHPCQVLMPEWKRMARTLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQK
    SSKAYQYHSYNGWNRDAYSLRSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPW
    CGPCQNFAPEFELLARMIKGK
    VRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLETLQSQVKRNKDEL

    >gi|27369633|ref|NP_766057.1| chloride intracellular channel 6 [Mus musculus]
    MAEATEPKEVAPGSQGQPEGATIEGPGEPGAADLEGREASEEAAEAPRDLGAGVEARASGKEEGGCGQDEGTGGAQAQDP
    RTGPEAETPGASGAPGEAEAAERDPEGAIPQGAEEAPSAQQVQGMSSGLDSQGEAPEVPGDSRREPEDPTASEAGEEAES
    GQEAQGGGALGLQINPEVQGLAGDNMDTEAPAGGPLGSESEPQGGGESSPQPQDEAIEIVTTEIGGNESGELAGASAADA
    AGEGETLGKDGSEEAASEDARVDAHENGDQGKLQEETGEEEARPEPELKGPCEGAIQEKPPDGSLDGEEAKSTEHEEESQ
    AELSNHLAEEPSVQGGEELGRVNGRRENGPALEEGDPGQEHDITLFVKAGYDGESIGN
    CPFSQRLFMILWLKGVIFNVTT
    VDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDA
    NEIYEKNLLRALKKLDSYLNSPLPDEIDADSSEDVTVSQRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTG
    IWRYLNNAYARDEFTNTCPADREIEHAYSDAAKRMK

    >gi|31981013|ref|NP_080598.2| methionine sulfoxide reductase A [Mus musculus]
    MLSASRRALQLLSSANPVRRMGDSASKVISAEEALPGRTEPIPVTAKHHVSGNRTVEPFPEGTQMAVFGMGCFWGAERKF
    WVLKGVYSTQVGFAGGHTRNPTYKEVCSEKTGHAEVVRVVYRPEHISFEELLKVFWENHDPTQGMRQGNDFGTQYRSAVY
    PTSAVQMEAALRSKEEYQKVLSKHNFGPITTDIREGQVFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPMAIKK

    >gi|149260250|ref|XP_001473851.1| PREDICTED: hypothetical protein [Mus musculus]
    MLGSKGLTVVDVYQGWCGPCKPMVSLFQKMRIEVGLDRLHFASAEADRLDVLEKYQGKCEPTFLFYTATDEELLGALKWP
    PHRKDGGEDGDIASSGKTCTLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHH
    MCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRELALLFPSFKFS
    DKDKEAPPGEPSQQPQLKLTELG

    >gi|31982812|ref|NP_033856.2| ATPase, Cu++ transporting, alpha polypeptide [Mus musculus]
    MEPSVDANSITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLDEKSATIIYDPKLQTPKTLQEAIDDMGFDALLHNANP
    LPVLTNTVFLTVTAPLTLPWDHVQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGAC
    EEHSTPQAGEVRLKMKVEGMT
    CHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKK
    QPKYLKLGAIDVERLKNTPVKSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVK
    YNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVIS
    KKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNK
    CYIQVSGMT
    CASCVANIERNLRREEGIYSVLVALTAGKAEVRYNPAVIQPRVIAEFIRELGFGAMVMENAGEGNGILELV
    VRGMT
    CASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSANHLDHKREIKQ
    WRGSFLVSLFFCIPVMGLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQFCGGW
    YFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEAL
    AKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTV
    IAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVET
    YFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTI
    THGTPVVNQVKVLVESNKISRNKILAIVGTAESNSEHPLGAAVTKYCKKELDTETLGTCTDFQVVPGCGISCKVTNIEGL
    LHKSNLKIEENNIKNASLVQIDAINEQSSTSSSMIIDAHLSNAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHERR
    GRTAVLVTIDDELCGLMAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTAQSIASQVGITKVFAEVLPSHKVAKVKQL
    QEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVG
    IPIAAGVFLPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYDNYELHPRSHTGQRSPSEISVHVGIDDTSRNSPR
    LGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTTL

    >gi|30794140|ref|NP_082571.1| protein disulfide isomerase associated 5 [Mus musculus]
    MARAWGLLLAIGVVLPTWLSSTKVSSLIERISDPKDLKKLLRTRNNVLVLYSESEVAAESHLKLLSTVAQAVKGQGTVCW
    VDCGDAESRKLCKKMKVDLSPKDKKIELFHYQDGAFHMQYDRAVTLKSIVAFLKDPKGPPLWEEDPGAKDVVHIDSEKDF
    RRLLKREEKPLLMMFYAPW
    CSMCKRIMPHFQKAATQVRGHIVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFLFPY
    ENYGSTAEDIVEWLKNPLPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPW
    CGHCKKMKPEFESAAEVL
    HGDAESSGVLAAVDATVNEALAGRFHISAFPTLKYFKNGEQQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQQTSVLHL
    VGDNFRDTLKKKKHTLVMFYAPW
    CPHCKKVIPHFTATADAFKEDRKIACAAVDCVKDKNQDLCQQEAVKAYPTFHYYHYG
    KLVEKYESDRTELGFTSFIRTLREGDLKRLEKRREEL

    >gi|6755923|ref|NP_035797.1| ubiquitin-activating enzyme E1, Chr Y 1 [Mus musculus]
    MSSSVLSKKRKVSGPDSSLDSSWSPTYSVMFGVPPGPTNEMSKNKEMDIDESLYSRQLYVLGHEAMKHLQASSVLISGLQ
    GLGVEIAKNIILGGVKAVTLHDQGIAQWADLSSQFCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQV
    VVLTNTPLEYQLQVGEFCHSHGIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQPLSAMVSMITKENPGIVTCLEDSRHG
    FESGDFISFTEVQGMSELNGIGPIEIKVLGPYTFSICDTSSFSEYIRGGIVSQVKVPRKINFKPLLASLAEPEFVVTDFA
    KCCHPAQLHIGFQALHQFCTQHSRPPRPHNEEDAEELVTLAQSVNAQALPAVQQDCLDIDLIRKLAYVAAGDLAPMNAFF
    GGLAAQEVMKACSGKFMPIRQWLYFDALECLPEHRVAFMEDKCLPHQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGC
    ELLKNFAMIGLGCGEDGEITVTDMDTIEKSNLNRQFLFRPWDITKLKSETAAAAVRDINPHIRIFSHQNRVGPETEHVYD
    DDFFQKLDGVANALDNVDARLYVDRRCVYYRKPLLESGTLGTKGNVQVVVPFLTESYSSSQDPPEKSIPI
    CTLKNFPNAI
    EHTVQWARDEFEGLFKQSAENVNQYLTDPKFMERTLQLAGTQPLEVLEAIHCSLVLQRPQTWADCVTWAYQHWHTQYSHN
    IQQLLHNFPPAQLTSSGALFWSGPKRCPHPLTFDINNPLHLDYVMAAANLFAQTYGLGGSQDCAVVAKLLQSLPVPKFAP
    KSGIRIHVSEQELQSTSATTIDDSHLEELKTALPTPDKLLGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYGISPADR
    HKSKLIAGKIIPAIATTTSAIVGLVCLELYKVVQGHQQLESYKNSFINLALPLFSFSAPLAPECHQYYDQEWTLWDRFDV
    QGLQPSGEEMTLKQFLDYFKTEHKLEVIMLSQGVSMLYSVFMPASKLKERLDQPMTEIVSCVSKQKLGHHVKSLVFELCC
    NSDSGDDIEVPYVRYIIR

    >gi|31981269|ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
    MAAGAAEAGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSE
    KYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFPPSTNEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPR
    CGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEER
    LKVLTNKASVMLFMKGNKQEAK
    CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIV
    KELKDNGELLPILKGEN

    >gi|21312336|ref|NP_081403.1| hypothetical protein LOC69590 [Mus musculus]
    MEPFAAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRTNSFYSFEVKDAKGRTVSLEKFKGKASLVVNVASDCR
    FTDKSYQTLRELHKEFGPYHFNVLAFPCNQFGESEPKSSKEVESFARQNYGVTFPIFHKIKILGPEAEPAFRFIVDSSKK
    EPRWNFWKYLVNPEGQVVKFWRPEEPLEAIRPHVSQMIGQIILKKKEDL

    >gi|149264442|ref|XP_001472683.1| PREDICTED: hypothetical protein isoform 1 [Mus musculus]
    MAAPVTRQVSGCAGRVPSPAGSVTERGQPLAAAVAELPVLDASGRRVTFGALFRERRAVVVFVRHFLCYVCKEYVEDLAK
    IPKSVLREADVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEISSSGQSPHIKSNLLSGSLQSLWR
    AVTGPLFDFQGDPAQQGGTLILGPGNNIHFVHRDRNRLDHKPINSVLQLVGVQPVNFMSRPTVIHV

    >gi|112293264|ref|NP_031978.2| protein disulfide isomerase associated 3 [Mus musculus]
    MRFSCLALLPGVALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPL
    AKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFF
    RDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSI
    FGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTT
    GEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIE
    FYAPW
    CGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYL
    QREATNPPIIQEEKPKKKKKAQEDL

    >gi|13937367|ref|NP_075997.1| phosducin-like 2 [Mus musculus]
    MQDPNEDTEWNEILRNFGILPPKEEPKDEIEEMVLRLQQEAMVKPYEKMTLAQLKEAEDEFDEEDIKAIEIYREKRLQEW
    KALKKKQKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVPM
    CLVVNQHLSVLARKFPETKFVKAIVNSCIEHYHDNC
    LPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLSEVGAIQSDLEENPKKGIADMMVSSIRNISIYDSDSSGSDTEAK


    >gi|7948999|ref|NP_058044.1| peroxiredoxin 4 [Mus musculus]
    MEARSKLLDGTTASRRWTRKLVLLLPPLLLFLLRTESLQGLESDERFRTRENECHFYAGGQVYPGEASRVSVADHSLHLS
    KAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHL
    AWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQY
    TDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN