Leishmania infantum

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|146071750|ref|XP_001463188.1| protein disulfide isomerase [Leishmania infantum]
    MSLVRKTLAVLLAIALLAVCAKAEVVELNPANFHNVVKDPSKNVFVMFYAPWCGHCNNMKPTWLELADKYPIVGDVIIAR
    IDASEYRGIAKEFDIHGFPTLKFFSKRDKSGKMEYEGPRELSAFVAYVAANKQ

    >gi|146074855|ref|XP_001462624.1| glutaredoxin-like protein [Leishmania infantum]
    MLPFSYRVLMRGVSAVAGASSVALQHRALAGTTRSFSSSSLVWLAPAAPTTQTPPAMGGDTDAEETHPDFQPRMVSSDLA
    QDEIAMIKKDIDDTIRDEDIVVFIKGVPEAPM
    CAFSKRMIDVMEALGVEYTSFDVLAHPVVRSYVKEVSEWPTIPQLFVK
    GEFAGGVDIILKMAEGGDLQMLLDQKGIKHRDTKP

    >gi|146074923|ref|XP_001462640.1| thioredoxin, putative [Leishmania infantum]
    MPFTEVYGVEQFRDIANDPTLTVVCFSAVWCGPCKTIEKDLDRLTYEFANVRFAKVDADNNTEIVSKCRVMQLPTFMLVR
    AGQMLGYVIGADLAQLKAKIREEANKS

    >gi|146076748|ref|XP_001462992.1| glutaredoxin-like protein [Leishmania infantum]
    MRSLSRGLSLAASGRLVCVSRRSSVTASTALAATYASANAVPCSSLSSSMAASAHRASAAFFHTSRVHRAPSDVSDDLAK
    DLHDIICHDRLVVFLTGTPSQPR
    CRFTAQLVDLLDQLGVKYSFFNIMDDEEVCEGLKAYSDWPTYPQVYVDGELLGGFDI
    CKTMMLDGTLTTMLKDKQLI

    >gi|146076772|ref|XP_001462998.1| trypanothione reductase [Leishmania infantum]
    MSRAYDLVVLGAGSGGLEAGWNAAVTHKKKVAVVDVQATHGPPLFAALGGTCVNVGCVPKKLMVTGAQYMDLIRESGGFG
    WEMDRESLCPNWKTLIAAKNKVVNSINESYKSMFADTEGLSFHMGFGALQDAHTVVVRKSEDPHSDVLETLDTEYILIAT
    GSWPTRLGVPGDEF
    CITSNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPCGGYVDLCYRGDLILRGFDTEVRKSLTK
    QLGANGIRVRTNLNPTKITKNEDGSNHVHFNDGTEEDYDQVMLAIGRVPRSQALQLDKAGVRTGKNGAVQVDAYSKTSVD
    NIYAIGDVTNRVMLTPVAINEGAAFVETVFGGKPRATDHTKVACAVFSIPPIGTCGMTEEEAAKNYETVAVYASSFTPLM
    HNISGSKHKEFMIRIITNESNGEVLGVHMLGDSAPEIIQSVGICMKMGAKISDFHSTIGVHPTSAEELCSMRTPAYFYES
    GKRVEKLSSNL

    >gi|146077009|ref|XP_001463060.1| mercaptopyruvate sulfurtransferase [Leishmania infantum]
    MSAPAAAPKHPGKVFLDPCEVKDHLAEYRIVDCRYSLKVKDHGSIEYAKEHVKSAIRADMDTNLSKLVPTSTARHPLPPC
    AEFIEWCMANGMAGELPVLCYDDECGAMGGCRLWWMLNSLGAEAYVINGGFQACKAAGLEMESGEPPSPPTPPTHWPFKT
    AFQHHYLVDEIPPNAIITDARSADRFASTVRPYAADKMPGHIEGARNLPYTSHLVIRGDGKVLRSEEEIRHNIMTVVQGT
    GDATDLSSFVFS
    CGSGVTACINIALVHHLGLGHPYLYCGSWSEYSGLFRLPIMRSIIDDYGMCMQMQTPSLGDNPKANLD
    TMTLKVDGAPCERPDAEVQSAAAHLHAGEAATVYFKSGRVVTIEVPAVPN

    >gi|146077679|ref|XP_001463331.1| methionine-S-sulfoxide reductase, putative [Leishmania infantum JPCM5]
    MPAPIRATFAAGCYWGTEHFFVRNFKDSIVSHQVGFMGGVEGKAVTYPEVTKGTTGHAEVLDLMYDPEKVSYKDLLSFFF
    RMHNSTTLNRQAGDIGTNYRSAIFYHNEEQKKEAEAYIAKLNGADEKLHSSFSKAFGGAPCITSLEKAGTFYPAHEGHQN
    YLEKHPNGYCSHRLYF

    >gi|146077878|ref|XP_001463364.1| ubiquitin-activating enzyme-like protein [Leishmania infantum JPCM5]
    MSDGCMGSVVDVHIGHVVIPRASAAAAAEAAEAAVVFPSAGPAHKKARIEAVATRSSASAPADVVIATAWSEERITDALR
    RYAVAALEAASCEAAAGSASSPSTAAAAAAVLKAVNDAASSWVAVWPAVRLSPTPADMTGSGGEATTSTMASWSTVSFSF
    VPGALESTASATAKGAHAGISKATVPDAAPAVDAVTLRVLAAISLPRGLCVPYRGIATAVTAGGCAGCVSAVLTESIQIR
    AATATPPAASSSVPHSPASRSAASPCTYGMLPAELRARPIFVVGAGGIGCEVLKVLVLSGFTQVHLIDLDTIDATNLNRQ
    FLFRVADVGNSKADTARRAVLDWFAAADDPAPEHVSVLRGRRTPPSIVAYHDNVKADRYDDAFYRQFAVVLSALDNVSAR
    QHVNRMCMRNNIPLIESGTMGYNGQAQPILKNVFECYDCRPKPPETRTFAV
    CTIHARPTTMVHCVHYAKELYEVLFGSDS
    SDMDGKGASALSDVGATAEAGSGSATPLQVDKQQHGATRPTDGGELSYLRAMVSDWRRRQLPAASPGCTGAPTCALAEAS
    STLGHNDVGDRSGREGSRASSAAALALELLRLLFVTKVEELLSLKTSWPTEPPEPLSRRDVDRVAAAHISANATGASPAP
    LSGDHVLSVQDCMELFVRAVTQCLARPTGLTFRKEDDAATSFVSATANMRAHVFHIAEQSLEDVRSIAGSIIPAIATTNA
    TIAGAVVHELISLLRSSSSSFSQPASTSAAQLAPLSQAEVTGVSAPVSMQTSPRAHVVYTRKVPQVRRRRVPLPPGQRYT
    TPALFMEYAGDDAPSANESASKFAAPCAPLQAALALVGAEDSTAYLPRMSGAAEVGGKARRSVAVMDHYLVHSTAPNPPN
    RLHCGVCQDVHPEVCVTLDLRSATLGQLAHLVLESALGLEAPSVSYGSTMLYEDEDYEELADHILADVLQLPPAEAGGVA
    HQRQSYTLTADALNKDVPWSVVLTHDDKGAATSAPSPSTVFFQISGLEEAKAAEERALARLAAQQAQQEPPAEEDEEEAL
    GAPPGTTGLASSAAATTAPVAVEFIVSDDDEVLDVTPATNAPSNVAAKEDIVLLD

    >gi|146078714|ref|XP_001463609.1| hypothetical protein, conserved [Leishmania infantum JPCM5]
    MIRRTWCLCRCLSIDQVAKIVKAKQSCSDAVRNIQLIDVRSTAEVAATGMIPSAINVPLPVLRDVLSQDGILEDDEFEFF
    FGGARPVQGVTQMVLY
    CAHGVRSAIACEIAEELGFENVGNFSGSWAQWYHAYGTPSTSAAAPESLHTPLK

    >gi|146078718|ref|XP_001463610.1| hypothetical protein, conserved [Leishmania infantum JPCM5]
    MQRLTYAAMKALVAKKLSGDLHMCILDVRNADEVAEGAIPASVHVPLDQLETALQLTADEFKKKYSAPKPEVSDHVVTYC
    LRGMRAERAAAALHSSGYTNVDVYPGSWAEWSEQEKCAA

    >gi|146081761|ref|XP_001464336.1| glutathione-S-transferase/glutaredoxin, putative [Leishmania infantum JPCM5]
    MFGRGTFSRKVLVGTTVAGFVGVGGGYAMYQRRMRDNRSVTAEAFNAMQDATKLDEAFKKLCDHKEHPLIQFYRYTTCPW
    CGTVKAFLDYNKIPHECVEVEPMFKTELAESLYKKVPQLRFESKAGDRSYLVDSRIIVDTLSEKMGLGGQLKDEDVDKWR
    TWARSSLVRFVTLEFNRSLPAAWAGYSYIDSCDTIPYANKLFLKVIGAPVMYLVAMMVTKPRLVKAGLMKPDDDPKQRLH
    DEVNRFTAEALVDPKSKKPRTFHGGRKPDLVDLDTYGVLQSVRNHRIYNEMVTETQIGPWLEAMDRLMGKA

    >gi|146082048|ref|XP_001464435.1| hypothetical protein, conserved [Leishmania infantum JPCM5]
    MSDDDVHERLTTIPGACPTPLELGMSGWNILHSSAAVYPYKPSAVQQTAMKNFIESWAHVYACSWCAYHMREYVRDHPPD
    VRDKLTVSRYVCEMHNDVNVRLGKDVFDCSPSVVLRRWHPGYPNKMEDMPTIEEQLAASDREKSTAKEAKHSQQEEEQRF
    SRSGLHAHEAAPNEAVAWRTASEAASKKVDGGLWSWRIFRKPVLGAHAAKSNAPPGTSSSSPPPTTQHEPSISSSGALKA
    PSTGAVAAAASDVGAAHPRHSWSTSTSEAHNSFLTPTPSRGKAVDDDTDIDAVLKRLKRCQVYCPEDEELKH

    >gi|146082084|ref|XP_001464443.1| tryparedoxin peroxidase [Leishmania infantum JPCM5]
    MSCGDAKINCPAPPFEEVALMPNGSFKKISLAAYKGKWVVLFFYPLDFTFVCPTEIIAFSENVSRFNELNCEVLACSMDS
    EYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARAYGVLEEKQGVAYRGLFIIDPNGMVRQITVNDMPVGRNVEEVLRLL
    EAFQFVEKHGEVCPANWKKGAPTMKPEPKASVEGYFSKL

    >gi|146082089|ref|XP_001464444.1| tryparedoxin peroxidase [Leishmania infantum JPCM5]
    MSCGDAKINCPAPPFEEVALMPNGSFKKISLAAYKGKWVVLFFYPLDFSFVCPTEIIQFSENISRFNELNCEVLACSMDS
    EYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARAYGVLEEKQGVAYRGLFIIDPNGMVRQITVNDMPVGRNVEEVLRLL
    EAFQFVEKHGEVCPANWKKGDPGLKVDHNK

    >gi|146082097|ref|XP_001464446.1| tryparedoxin peroxidase [Leishmania infantum JPCM5]
    MSCGDAKINCPAPPFEEVALMPNGSFKKISLAAYKGKWVVLFFYPLDFTFVCPTEIIAFSENVSRFNELNCEVLACSMDS
    EYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARAYGVLAEKQGVAYRGLFIIDPNGMVRQITVNDMPVGRNVEEVLRLL
    EAFQFVEKHGEVCPANWKKGAPTMKPEPKASVEGYFSKQ

    >gi|146082678|ref|XP_001464571.1| hypothetical protein, conserved [Leishmania infantum JPCM5]
    MQTSLLGRIGGAALCQKRLFQSTAAAGAGTTTAATVNSSRSSDSGANASASSDTSLHTQQLYKSVHKGRGTTPIPKSYKE
    PTLRSRVALARGAGAVSSAAAAAETLPPPLVGARSSCAEDAGPVPQRALSPLQKRQLQFRNKAAFVLTPQALRRVKYLLA
    QYSTVHSAAAAKSPLNSDASDEVPSGIRIGVRRRG
    CSGYSYTVNYYFDSAQRSGKGATPSRKMAGLMEDLVVEQDGVKVV
    VDADAQFYVIGTEMDYVITNVEEKFTFKNPNQKYSCGCGESFMPYDADDMDTG

    >gi|146082968|ref|XP_001464642.1| endoplasmic reticulum oxidoreductin, putative [Leishmania infantum JPCM5]
    MCRMNIEVTIKCACSVLLVLFLVFTHETPKPTAGPAVNFNPVRSRIVLNTTKLDYGYCHSSPAEIDEGTKSLLDILNRIT
    VSPYFRYFKVNSAKPCPYWAVSLL
    CTSAENTCDVCKCDENSIPEALRADEDMSELNTPDGSVAKTVLQPVNLDDWGDWLK
    ADDGAEYVDLASNPEGNTGYSGPLAAQVWRAIYAENCLSSDKDGTCQELSILRTLLSGLHMSINIHVCTSFYKDPELSSP
    QRNAGIYNNPNISFFPNCQMYNKRIAPFPDFVGNLYILYQFTLRALAKSRSFFTNDVSIFNTGARGEATLTDLQLHDNIK
    ELFNSRLICSPTFDEGAFLESEKGRSLIPQFKAMMLNVTRLMDCVTCEKCRIWGKLETKGIAVAMKVIMNPENERITLDR
    SEMVTLVNLARQLAFSVRNAQRLGSVCSEDDCARGLSRPRPSQ

    >gi|146085292|ref|XP_001465233.1| glutaredoxin [Leishmania infantum JPCM5]
    MNQALDPARAPQFLDSMLRRNRIVLISATYCQFSTKLKMLLIELKHRFVSLEIDIIPNGREVFQEVVARTGVHTVPQVFL
    NGKYLGGYDDLIALYHKRELSETLEKR

    >gi|146086967|ref|XP_001465682.1| peroxidoxin [Leishmania infantum JPCM5]
    MLRRLPTSCFLKRSQFRGFAATSPLLNLDYQMYRTATVREAAPQFSGQAVVNGAIKDINMNDYKGKYIVLFFYPMDFTFV
    CPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLF
    IIDKKGILRHSTINDLPVGRNVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKAGEFFEKNM

    >gi|146087171|ref|XP_001465746.1| ubiquitin-activating enzyme E1 [Leishmania infantum JPCM5]
    MLSEEEQKRQLYSRQEYVVGSETQAKYGSTHVLVVGATGLSAEIIKNVVLTGVKSVKVLDDAVVTIEDLGTNFFLRPDDV
    GKARGAAVAQAAKELNRFVEVSPVSGDPLLHIPAVHVVIYTNAYTSTLAAANKVARANKVKFISCESRGVCGCIFVDGGE
    SLDIVDTDGEDTVTCVVTAMSSDGLVTLHEEKNHECEAGSKVYFTGLKELPQANTTEPATPSAWKLFEVAEVISPHTMRL
    KGVSELVSAGTIINVGTSAYLHTTKKGRREHYRTLGECLDNPECLMVFDKEEKCTAANTLHAMFTAVARHGCAPTSPAEV
    EAVVKAAQAINPNAEATVMRTLLPVFGGDLNPMACFIGGMAAQEALKVCSGKFTPLHQWVYYDAREVLQVWQYGAKTVSA
    SALSSSVAVFPDAPAARSRYAGQEAVLGHTFQEYLRQQKAFIVGAGALGCELIKNAALMGFGEVSITDMDTIEMSNLSRQ
    FLFRSHHIGRPKSVVAAEAAGHINAEVKITAYEAKMGPETEAIFNEDFWAQQAVILNALDNVMSRKYVDSRCLFYQKPLL
    ESGTLGTKCNMQPVIPFVTESYSSSYDPPEKGIPL
    CTLKNFPNAIEHTIQWARDLFHLLFVSVPADVNQYLNDPVAFANS
    LRNDPAAADAVVQNVNDALSRWPQNEQNCVRLARLLYQEHFNDGFRQLLHNIPLDKRNEDGQLFWSGAKKPPTPQEFDVS
    SEQDTEFVYHCACLFAKVYQLPVFSLSKEETARLAAAVTVPDFVPRHAVFATSESQTSQQTSSSSGLTVEQLPPVAHFGS
    RRMSAEEFDKDDITNHHVQFITYCSNLRARAYSIPVADFNQTKRIAGNIIPAMVTTTSLVTGLVGFEMLKYLLIQFHHAR
    KPAVNGKGSSHNKFYLDADEEPEKLVTLFRSAFVNIALPFIAFSDPIIAPSHLYALPSGKKLRWGIWDRIDVSEGRDMLV
    KELVQLLHDRYELEVFMIALKNGKMIYTEFGGKAKDKEKRVSEVAQDKGEKAQDGIDYFDLVVTGMIGDNDDVDVPIIRY
    RYRF

    >gi|146089537|ref|XP_001470409.1| protein disulfide isomerase, putative [Leishmania infantum]
    MNRRLSVVLALALVVFVLAGSCSSEDPGAVMPGIVQMSKDNFDQLVGKDKAALVEFYAPWCGHCKSMAPEYAALGAAYEA
    STNAKDLLLIGKVDATEDSDLGKRFGVTGFPTILYFASGSLEPEKYKGGRTAEDFAKYLSSAVAGLRLTIPNEPQFAMEL
    VHTNFDAVVKDPSKAVLVMFYAPW
    CGHCKALKPIYNKLAKVFSNDKDVVIARINADDAANRKIATEYAVSGFPTLYFFPK
    GADEKPVEYKNGRNLEDFLTFVNENAGKHRLANGDLSWEYGVIAELAEAVARVATSSGESSKAAVEAVKAVASTLTESED
    AAYYIKAAERIAAKGPAYVESESARLKRTLGGPVAGDRRDNMVMRLNILTSIQKHMK

    >gi|146089591|ref|XP_001470422.1| glutathione peroxidase-like protein, putative [Leishmania infantum]
    MLRLPPFRRAAAAAQASSIYDFKVNGSDHQPYDLGQHKGHPLLIYNVASKCGFTKGGYETATTLYNKYKHLGFTVLAFPC
    NQFAGQEPGTEEEVKEFACTRFKAEFPIMEKVCVNGEHEHPLYHYLKSKCKGILGTTFVKWNFTAFLVDKDGHPVCRFAP
    GATVSEIEKKLLPLLQAAASSKI

    >gi|146089594|ref|XP_001470423.1| glutathione peroxidase-like protein, putative [Leishmania infantum]
    MSIYDFKVNGSDHQPYDLGQHKGHPLLIYNVASKCGFTKGGYETATTLYNKYKHLGFTVLAFPCNQFAGQEPGTEEEVKE
    FACTRFKAEFPIMEKVCVNGEHEHPLYHYLKSKCKGILGTTFVKWNFTAFLVDKDGHPVCRFAPGATVSEIEKKLLPLLQ
    ADSDGAKVLSSTQS

    >gi|146089984|ref|XP_001470524.1| hypothetical protein, conserved [Leishmania infantum]
    MTAQAKLARRAPKAVAASKKAPKEAPSLPKSTSASLGQRAQAASAPLQSAESVQVYLRTVPTPLGPFSLYVDADGAVRFC
    HWRRSAPGDAAALCAEAQEVCATMQSRWYKRTPVTVAGVWADGADGASGLPGERAVTLMRNYFNPSTAKAGRPEELERLL
    LQVPIIYPPASAFMAQTWATLRHTVPSGKTISYKGLGVRVNKALNLPASAAVAPRAIGVAMGANPIPVIVP
    CHRVLSSTN
    SLCGYGLGLRFKVWLLRHEQAGAATNKLRVGEEETAVSTAASRR

    >gi|146090911|ref|XP_001466392.1| molybdopterin synthase sulphurylase-like protein [Leishmania infantum JPCM5]
    MNAGAMEDILPHAAFVSSVPTLTKEDVERFGRQMLVEEIGAAHMEQIRHAHVVCVGAGGLGSTILLYLAASGVGRLTIVD
    FDDVELSNLHRQVIHTTAAIGQPKALSAKASCLRLFPAACVDAVVEALSPENAERLFATCDVVVDGTDNVAARYLINDAA
    MRCGKPLVSGSAMGWEGQLSVYGYRGGPCYRCLFPQPPPQETVGS
    CNDSGVMGPLPGMIGCLQALEVLKVATGVGETLNG
    RLFLFNGLRFSSRVVKLRGRQPHCVACSAAALADATPLPQLAAQARPEYVPYSCPITSVPSPPGTSCSASEYAAHARGSA
    AAQRRVTLDVRVRLQYDMAHLAHSVNVPYQSLLQWKRAGTVVTQLADVLDKALPPQSDTPDCMKEGSAVVSHGDAGPQVV
    VYVLCRRGLNSLKAVALIRAALAEAEARGDEAAVARLGRYVFRNVSGGLNAYHREVDSAFPYY

    >gi|146091117|ref|XP_001466449.1| hypothetical protein LinJ27.1770 [Leishmania infantum JPCM5]
    MLGSGKSSGVVNEASNLKANENLTATIEQMNSKAYRQSRDMNDVIPTHRRPVTEAVRDNGVPVYDPAAEKHAEKVERGNA
    AGAEDDDDELMELRRMRLQCMRANQEKQAEWRSKQHGEYREISQDDFFNIVVREKGGSERVCVHFYHKDFET
    CKVMDRRL
    SELSRTLLAVKFVKIDAERSPFLVERLRVTTLPHCLLFFNDVCIDRIVGFQGCVTEDGTLDANLLRERIVHALKLKGDE

    >gi|146092500|ref|XP_001470311.1| hypothetical protein [Leishmania infantum]
    MTTPLTNCAGPQEKDGSKDMSDEEWRRILTAQEYHILREKGTDPVGGKYDDVFDEGEYVCAGCKTPLYQSSMKFACGCGW
    PGFYDCIPKRVREQPDKDGRRVEIVCNACNSHLGHVFRKEGFRNPPPNERH
    CVNSTSIILRPTQQP

    >gi|146093057|ref|XP_001466640.1| tryparedoxin-like protein [Leishmania infantum]
    MPLRHKGGPFLSQFPDLKVLRQDGTTVAASEAFKGKKYVLIYFSAHWCPPCQRFTPLLADFYDAHKDRYGFEVLFVSSDR
    EEGRMMDFFQNRSSNYVRRPPAAASSSPPPVASSEALDESCPLSCDITHLLGNQTGAATVGGVGLSEGQQPQVPSSTAAA
    GGAPTAAGIAQSPRIPKASGHGNWLALPFKEHEVARFLSRAYSVVSIPKVVVVAVDTNCMVTREGKTMVMKDPDAVRFPW
    RFAEGDMRNRTEGWRESFVLLLLILCGIYYYFWYY

    >gi|146093059|ref|XP_001466641.1| tryparedoxin [Leishmania infantum]
    MSGLTKFFPYSTSFLKGSATDIVLPTLAGKTFFFYFSASWCPPCRGFTPKLVEFYNKHAKSKNFEVMLISWDEEADDFME
    YYKKMPWLALPFEDRKGMEFLKNGFKVETIPTLIGVEADTGKIVTTRARNMVEKDPEGKEFPWPNVSEK

    >gi|146093061|ref|XP_001466642.1| tryparedoxin [Leishmania infantum]
    MSGVSKHLGDVLKLQKQNDMVDMSSLSGKTVFLYFSASWCPPCRGFTPKLVEFYEKHHNSKNFEIILASWDEEEEDFNGY
    YSKMPWLSIPFEKRNVVEALTKQYKVESIPTLIGLNADTGDTVTTRARHALTQDPEGEQFPWRDE

    >gi|146093680|ref|XP_001466951.1| ubiquitin conjugation factor E4 B [Leishmania infantum JPCM5]
    MLEITSLGQLLLHVQRSDVVTVIDFYADWCGPCQQIKPQFEQMARYYDPSKVIFAKCNVDRNRDCASRYGVSTIPTFIVF
    YANERVATVTGGDLGMVQRSIDLAVAQIPETAAPSSAGQTAARRDSVQETQDAFAEQMLRIVEAKSTKNQILEKDSCDAA
    YALLKAKTPYGLLLLPYLASDAFSAVAIDALFSNIASRAGAERHEEGYLINQVLSHLMQLSTHLSWGDMSVVKQLHRVLL
    SLLACPRMQTALMTSPFFTNMFITTGTQLEHTTLLGVLFGLGPKPMAAARAPHGDWLAMLEVFSPQKQDEHQQTVYTIQQ
    EMSTLAKMNVRLVQSLLHVKTARDATLRYLGRALQLNEDYLKTMHHDSPISSRYFMIQLQSVLIELALPIFQARANKEDT
    SSSGGYDYRQIPAHYLLDRLYGPNGVVVSFGSDVERVAHFGDDNPLPRAPSSRDPYKPFIHLFFLAARAVTLCAAVFIDE
    HDRDERQATHPQASRQQRDFFTAEKLLLEGLLGSTELSASRLEFLNHLAHWLLMVMQVDDQGVLPAQPPAEWGYLPQCLV
    DCVIRATSMAPLDGLYSDGMISLMLVLMGNTKYFPKPHTHALFPAYLLRLQENYATRKVLEQHPWFSTHIVRACMECYIA
    VEKSTYERVEVRYELSYAIKTFLKSNLLCEPVREEMESQANNTMLERFSHMAVAEVNEAVDQVIDTLTRMNEMVKAGADL
    SENAVASDSPQNAADGSNGEQQQRQTRRQRSNASRNEDVDAGEDGGEGDEEENADGSQTYHERGMSLRSHLMLFTASMDM
    FIELSLQFPKGVSQNMVAGQISEMLARSLMAFAGPNSRSLKIQNADLYNFRPREVLMRLVDCFTHFRRSKNFLRCLCHCS
    IPLSDIRSVMRTIVDRQLVSEDLIWKVSEMAAAVTSVSKEVDNEEAVWDDAPDYALDALLSTPLLQPVALPADVKDLNDL
    VYVNQETLHHLLLSESKHPFTNEPLTEDKVAAFNKRPDVAAAVEGRRAAIQKWLEDVKAAQV

    >gi|146094694|ref|XP_001467354.1| glutaredoxin-like protein [Leishmania infantum JPCM5]
    MHRLSFPLSPHPFRPLPCALDTRRICIQALPSDPQSSSPSAPSDSPTISVSTLFILTCMLSSRFLYRPSTMPATVAELIH
    RHKVVVFSWVH
    CPYCSRAKEILKSLAKDIQVYECDQMDNGEELRAQILQAYNHDTVPAIFINGEFIGGCSDLQAIQKSGE
    LAAKLA

    >gi|146095131|ref|XP_001467490.1| tryparedoxin-like protein [Leishmania infantum JPCM5]
    MEPNFFNNSELMLLCKDGSAVRAIDVLKDAEYVLMYFSARWCPPCRAFTPLLKSFYETHHAKKKFEVVFMSLDRSEEEMM
    SYFRESHGDYYCLPYADARSMARVWGDTYNIKIIPTLLVFENANPRKLIARCGREMVTQDPFGKFFPWPDAEPQQPAESF
    ILDYTRKAAIVLGILVLLYSLSKRSS

    >gi|146096952|ref|XP_001467989.1| ATP binding protein-like protein [Leishmania infantum JPCM5]
    MSNSTEQALLQIAQQIERAVDDEIDRIDQMDDDEILAIRQKRLKQLKEIQARRDEWLRKGHGQYLEVAEPKEFFDNVKSS
    ERIVVHFMRRSTPR
    CEIIERHLRTIAHEHFETRFCYVDVERIPSLPERFNVMMLPTLMLVEKGHTFHSIIGFDEFGGTDD
    FTTDTVTQVLAHYGMVNDKGMFAADQNDE

    >gi|146097055|ref|XP_001468025.1| dihydrolipoamide dehydrogenase [Leishmania infantum JPCM5]
    MFRRNIAHLASYDVTVIGGGPGGYVAAIKAAQLGLKTACIEKRGALGGTCLNVGCIPSKALLHATHLYHDAHANFAQYGL
    RGGENVTMDVSAMQAQKAKGVKALTGGVEYLFKKNKVTYYKGEGSFVNPNTIKVKGLDGKDETLESKKTIVATGSEPTEL
    PFLPFDEKVVMSSTGALDLDHVPKKMIVVGGGVIGLELGSVWARLGAEVTVVEFASRCAANTDADVSKALTDALVKHEKI
    KIMTNTKVVSGTNNGSSVTIEVEDKDGKHQTLEADALLCSVGRRPHTTGLNAEAINLQMERGFICINDHFETNVPNVYAI
    GDVVNKGPMLAHKAEEEGVACAEMLAGKPGHVNYNVIPGVIYTNPEVAQVGETEEQVKKRGIDYKVGKFPFSANSRAKAV
    GTEDGFVKVVTDKKTDRILGVQIVCTAAGEMIAEPTLAMEYGASSEDLGRTCHAHPTMSEAVKEACMACFAQTINF

    >gi|146097469|ref|XP_001468111.1| thiol-dependent reductase 1 [Leishmania infantum]
    MAARALKLYVSATCPFCHRVEIVAREKQVSYDRVAVGLREEMPQWYKQINPRETVPTLEVGNADKRFMFESMLIAQYLDN
    SGAPAGALMGSSAAQRHQIEFFLAQVGDFIGAAHGLLRDPLSGEKRKAMDDNAAYVDGLLAANQTTGPYYCDGEFTMADV
    ALVPFLVRLKPALMYYAGYDVFCKAPRMKALWAAAAQRASVRETSPTAAQCIENYRHLVPESAPMMGANGGHVLYSNLF
    C
    PFVDRARLASELRKFQMHIVEVPLHPQPEWYKYINPRDTVPALFTPSGEAVHESQLIVQYIDCVATKGSALVPRGDAEKE
    YEVGFFVENAGYFVGGLMSWIIRGGEDAKAELQWAAGELEQQLAKHPFGEGPFFGGKRMNAGDVAILPFLVRAKAFMPEF
    SGGYDLFAHFPLLNGLAEAGMATPEAKSVFRTLEEYKEHIRKRQRRAQSG

    >gi|146098036|ref|XP_001468299.1| copper-transporting ATPase-like protein [Leishmania infantum]
    MGATTAQVAGDRQATRRVTLNVFGMTCRGCAQHVQENLMTLGGVHSVSVDLDAQLAEVDVDATDAASEFRIEQKVVSMGY
    TVQPAVLPSCGAPGREESELSPAPPPLRPSAASLSHVSSIASVPTCCASQLQRPSETSKSTETSSLRQGGGFLPFSRRFR
    RVPCGCGGRGCLCAYAPEPVMVTEETRLIPENDSEECLSERAESPSSVDITVDAVQARASQRRRAPVGVRATSPTAAAAA
    AEAKTSLLIEGMS
    CTSCAARIEAKLKQLKGVLGVSVNFSAMSGQVLHNPALASLQKVVSCVADMGYIVTAQDTTAPLGTA
    DGEPPQQGECKCRTNLRAVPVHVGSLMSGYEHRVVVLGMS
    CASCAARIEHRLRQMPTVLSCTVSFATGTAVITTCTPSGF
    TDACKMVRSMGYTVTETALMKPDSSISRTREALERAREIAEHERNLIGSALLSVPLAAVMVLTVFMDIMARPLLALMIDG
    MQFCVVTPIVFHFGQGFFLSAWRSWQHGAYTMDTLVAIGTGCTYAYSTVVYLLTLFVYPHARMMTYFDTAGMLTTFMLLG
    RFLEARAKRSASGAVIELMSLMPTTAVCVQPDGSEVRVSASQLQKGALVRVLAGDRVPVDGTIVEGSSELDEQMVTGESL
    SKQKKPGEEVVGGTLNITGSLLIRADKVGEETMIAQVLRIVQEAQNTKPSIQRAADRIAMSFVPFVLVFSLLTLGLWLLL
    GVTDAYPVSWRGAETSWQAFAFNFFISTVVAACPCALGLATPTAIMVGTGVGAKNGVLVKSGTTLEEVRSVNCVVLDKTG
    TITNGRLEVVRTHMIMAGLALPPTTTAQPHGSSDAALVRCLVGLVEAQSNHPIAKAVSAKLLAETDSGTDEVQRRARYGV
    SSVVTHGGKGVEASVTVRPASDDNGKVSSEPPPPRAHHVLVGNVALLREHGVSLTREVAHLVEEENGHGLTTVVAAVDGA
    ACVVVSLADGPKREAHGVIRYLHKAGIRVLMVTGDNAGVAGRIAAEVGIHSKDVYAEALPIAKAEIVKELQEQGSRVMFV
    GDGINDSPALAQANVGVALGAGTEVAIEAADAVLVHDSLVDLLNLQSLSKVTVRRIYGNFIWAFGYNLLMLPTASGLLYP
    FFHIRLPPVAAGAAMMLSSLSVLTSSLTIRCFRAHRERDFYFT

    >gi|146099113|ref|XP_001468561.1| hypothetical protein [Leishmania infantum]
    MCRSTPSAVQLLGALFAVACLVHTSLAYPYGRSSAVTELTPASLHAFVNTHKPVVILFYAPWCGHCKQFHPEYERFAESV
    KGTIRVGAIDADKNADIGQQFGVRGFPTIKYWKSGTKSVSSSQEYQGQRTAAALQSLVVEGISSSKVMTVTTAEQMKQAA
    RDAPKKMIGVLLSAKNKVPPMFSVMGMSPKLKELPLVFAGSSSPEKGVAKAFGVSQLPMIGVLRYTPAEGDAEEKFEMVP
    YAKKAIAYEPVARFFLDCAEKECSAGTEAPMNSVSLDEDESQHQTREAARQSSVALPVEPVEYTPKVISLFCAPQTRKIR
    GQSPLCVFSLSEHVNLDNVHQYFKNDPLLFFEASQHKEELLQQLQADFGVQIASTGEAMTSLAGSIVVLRHSKPTTVRYA
    LLENIDSDDDLQAALQRILNGEVHLRSERVGAA

    >gi|146100761|ref|XP_001468938.1| thioredoxin-like protein [Leishmania infantum]
    MLKVSSKEHYAEIKKKAEGSLGLVVHFSATWCEPCTAVNEHLIKQATEYGDNVVFAEVDCGELGDVCEAEGVESVPFVAY
    FRTPLVGDDRRVERVADVAGAKFDQIDMNTHSLFGEKGGNGVQQKDFATVDDYLHYLTKRPGVVMFITGTPSRPR
    CGFTG
    RLCELVHQLGVPFIYYDVMTSDAVCERLKIYANWPTYPQVYVDGELIGGWDICRELSDEGELKSTLKR

    >gi|146100789|ref|XP_001468946.1| hypothetical protein [Leishmania infantum]
    MHRTPRRTPLLVLVVFVATLCLSHALAVEDVGEDASAVLELISEGSTTTYKIPDSMVVLNNANFESYLFPSKRATPRAFL
    VLCYSPW
    CPHCKSLLPQFLNASMQLDLMKVPHSNFAVVDVQKNTAVSEYFDVERFPTLLYTTGKGRQWHLYEGGNTQQGF
    MQFSTYLQNAMDTGSFSEDVTDVSHFNEVEEKSGTTRVPCYVYVPATSSSAPESQRTAHWSHAIDGAASVSNIRFAVIYE
    KSQAEGWAEHASDKYKKVVEKAKACVAAGKASGPGGEALVVFSDRYREPHCYSGPWVEERSVARSSKHRTRQVDADTLTM
    STSLENFLALNGFHAVEDASSAMFATLAYYPKNYLGVVMTNRPIDDKDMDFVPVLREITQAENAALEKKHGSDLPIEEEM
    RTPRVSWSYIDVVEYEVWRSRYDIELDQLPAVMIIDTKRDRFFKMRTHVPRFEAIKMDTPWKVGGEQQQLIAQFAQDVLA
    DAYKAQKLSVAGAVAEYLSHYPGFALMYEALNYEDFVFDIVVMALGFFTFLFFLAIVMEPLMDWYDARSKKKADKVKRD

    >gi|146100793|ref|XP_001468947.1| hypothetical protein [Leishmania infantum]
    MLRLSLRRWCAAAASGSSTSTTHGSPPATMLPDFYGKSFSVSPRAWAQITRKNSEEGFTNDARYLRLAIDSGGCHGYVYK
    FSFEKNEEFNCEGDVAIAEVDVVSPSDEAFTGAQPSPRVVVDTLSASKLENATLDYHSELKGSAFVVVGNELVDESCACA
    MSFSIRKKTRPSAASSSARGASSGAGGGHGGSGAAAPPAGSSLAANARPISRRSATRATS

    >gi|146101433|ref|XP_001469113.1| ubiquitin-activating enzyme E1 [Leishmania infantum]
    MEAESKVLIDQKYLDKQSRTIGTYGLETMAKLIAFKVIIVGCGGVGIEIAKNLALAGIHTIRFYDPRKPTAQDMGVNFAV
    TPQSMASGKTMAELSAAYISELNPNTRVRVLAELTTATVSDNVALIFTAAAPDLSLTTLSEWNAFCHNHTPAISFVLALQ
    TGTMGSVFADHGPSFVVKDADGRPMLQKLITEVVTLRDKTGEMYTRIRYETPEGQTPGALRDYTQIKLSEVQGLLKPDGT
    SVNGQVYDGVVCPSDPRDTVRVYPAFETQGYSPYETGGFLHELKEVRVLSFRPLSEALAAPGAFVPVSPMMDNSEESVTH
    VTLHALLRYADAHSGKLPELHNAAQAAEVVELAKKVLEENKAMPAPPEQRTTGKPGNAEFPYKVPPPPPPAPLVLENLDE
    KAVMAEALLARAELQPLASFFGAVVAQEIVKITGKYSPIHQWFHLSCAAVRPERADHSSEEFRPMNSRYDHIISIFGKGF
    QKLLQNLRLFMVGCGALGCENVKNFALCGITCGTGGSLVVTDNDRIEVSNLSRQFLFREENVGQPKSAAAAARMRQMNPD
    ANVDARQDFIGTTTEHLYPDTFWQSLNVVVNALDNIEARLYVDQQCVRFQKVLVEAGTMGTGGNVDIIVPGRTSSYADGG
    AADQTGGIPM
    CTLRNFPYIYDHCIEWARAQFDDMFVSPMQTAQQIIEDPAAFTQRIHHEVSSGSSAGERRSLIDKNVGPL
    KLLKRTLTILADGPTMDRCVALGWEQLFKMFRDRILDLQAAFPRGAKKKNGEDFWSGHRKYPTALQVTAADITTNPDAKN
    FLVAAINLYACMFGVHPPKHEARFNDEKNRWMQEYRTDAWIQAEVSKLSTPAYVAGFVDNLDDDLAANAQEGKQVTMEES
    EAELQGLLADVAALATKCKGSRAAALEFEKDDDDNFQIDFVAAASNLRAENYGIPTQDRMKVKLVAGKIIPAIATTTSAV
    TGLGLIELFKVLQNKDVSVLRNGMLDVGTNNYVLFERDLPIKNFTKVVATYIPEQDYTYKKKVIRVPEGFTKYDMIRIPV
    TPATTVKAFAAALEAVLNKTLPDGVDQAYEVDGLGVGKGMLWNGRSSHANTNASLMKVIEQQKASEAGGTLPAPFWQNRF
    QFCDVSATVSIDDGDDTVDEVDVETATVCLEIQQ

    >gi|146102742|ref|XP_001469404.1| protein disulfide isomerase [Leishmania infantum]
    MQRSFLAFVVCAILFCVASAEVQVATKDNFDKIVSGDLTLVKFYAPWCGHCKTLAPEFVKAADMLAGIATLAEVDCTKEE
    SLAEKYQIKGFPTLYIFRNGEKVKDYDGPRTAAGIASYMKAHVGPSIKAISKAEELEELKKETFPLCVVKTASADSEMAS
    MITKVADSLRSQMNFVLVTDAAISPNDAMESVTVYRKNAEREAYTGAAPMTAESVKRFLATAVLDYFGELGQESFQKYME
    ANKGKPLGWVFVDKNTDPALKGSLVAVAEKYRSQVLLTFIDGDQYRPVSRQLGIPEDAKFPAFVVDFERRHHVMETYTPV
    TAESVAAFVEKYIKGETKQTLMSDAIPAKETVNGLTTVVGQTFAKYTDGTQNVMLLFYAPW
    CGHCQKLHPVYEKVAKSLE
    SENVIIAKMDATTNDFDREKFEVSGFPTIYFIPAGKPPIVYEGGRTADDIKAFVKSHLTASAAPSGGPSGNSDEEDL

    >gi|146104015|ref|XP_001469708.1| glutathione peroxidase [Leishmania infantum]
    MASIFTYSAVQNGKTVFLQKYSGYATLIVNVASRCSLASTNIEMLNEVQQAYGSRRFTVLAFPCAQFANQEPLNNTEIAQ
    WCKDLGLLFPVFDRVNVKGSSADPLFQMLRVQKGAPLWNYTKYLCDRSGVPRRKLKPGCSMDTLRQSIECVL

    >gi|146104841|ref|XP_001469924.1| selenophosphate synthetase [Leishmania infantum]
    MPHKRPQSSAGESNGTADLKKPRFDPVSLGLPAEFQLTDYTRLKGCSCKLPQPKLLALLQELSTTPGQKDVGMDCSIVPL
    HHTNRKGEALFLVSTTDFFFPSVSDPFLQGQIGAANVLSDLYSMGIPDCDTMLMLLAASTEMDEHERLITTREIMKGFAE
    RARLATTTVTGGQTVMNPWPLIGGVAMAVVSEAEMVRPAGLLCAGDILVLTKPLGCQVAVNLKQWLLRPSPLYEEAIAGH
    ISPEEIEELYNMATDSMRRLNREGARLMRKHGAHGATDVTGFGILGHANNFGAAQTVGDAPRSLCLVLERLPMFKTAVAA
    SKRMNDKYRLLEGYSAETSGGLLVAFPSTTAAEAFCAELTAIDGGCPSWIVGHVEDRAANVVDGVYARLKDGYEIVEV