Lachancea thermotolerans CBS 6340 uid39575

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|255710461|ref|XP_002551514.1| KLTH0A01188p [Lachancea thermotolerans]
    MLHGIRSAIRPASASGLRFFHNTTRTQMFQVGDVIKTGLAGVQENAPSNSIDLGKLVSKGKHIIVGVPAAFSPACSASHV
    PGYIAHLSDLQAKGVQDVFVTCVNDAFVTKAWAESLKTPEQVHIVADTKGEFAKSGDTLFDSEEVFGNKRNYRYAVVVED
    GKVVSTFEEPDKTGVNVSSAENVLKSL

    >gi|255710609|ref|XP_002551588.1| KLTH0A02992p [Lachancea thermotolerans]
    MLRMRLQAGASRRFLSGTSRMLAEKKKHDLVVVGSGPGGYVAAIKAAQLGFDTACVEKRGRAGGTCLNVGCIPSKALLNN
    SHLYHQMKHEAKQRGIDISGDVSVNVAQLQKAKDTSVKQLTGGIEMLFKKNGVTYYKGHGSFEDENNIKVSPVEGVEGSV
    TEETILEAKNIIVATGSEVTPFPGIKIDEERIVSSTGALSLKEVPKRLAIIGGGIIGLEMGSVYSRLGSKVSVVEFLPKI
    GATMDDEVASATQKFLKKQGFDFKLGTKVLSAERNGDVVNIEVENVKSGKKESLEADVLLVAIGRRPYIQGLNAEKLGLE
    VDKRGRLVIDEQFNTKFPHIKVIGDVTFGPMLAHKAEEEGIAAVEYLKEGHGHVNYANIPSVMYTHPEVAWVGKTEEQLK
    EAGISYKIGKFPFMANSRAKTNQDSDGFVKILIDAETERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTL
    SEAFKEANLAAYSKSINF

    >gi|255710975|ref|XP_002551771.1| KLTH0A07194p [Lachancea thermotolerans]
    MFKTSVFRCSQALPRNGTLLRPIARTQSTVAQLQTLQQFQQAVARKNLSVIDFYATWCAPCRAVAPHFDKLSEKHTDVAF
    YRVDVDSAPDIAGFCGVSAMPTFLFARESKTVGKVVGANLRALSEEIESLQK

    >gi|255711110|ref|XP_002551838.1| KLTH0B01078p [Lachancea thermotolerans]
    MVKPGEIDESLYSRQLYVLGKEAMLKMQHSTVLIIGLKGLGVEIAKNIALAGVKSLTLFDPAPVVLEDLSTQFFLSEKDV
    GKPRAAVSQAKLAELNSYVPIDVLDSLQDQEQLKKYQVIVATETLPLERKIELNNFCHAAGIKFIATETRGLFGSVFNDF
    GEEFTVVDPTGEEPQSGIVSDIEPDGTVTMLDDNRHNLEDGNYVKFSEVEGLEKLNDGTPYKVEVLGPFAFRIGSVKELG
    TYKKGGVFTQVKMPLKLSFKTLQQSLPNPEHLYSDFAKFERPGQLHLGFQALDQFQATHQGQLPRPFNEEDANELIELTS
    KLAVQQPKVLGEGNSVNKDIIRELSFQARGDIPGMVAFFGGLVAQEALKACSGKFTPLKQYMYFDSLESLPDAKEYPRNE
    ETTRSINSRYDPQIAVFGLEFQRKLANSKVFLVGSGAIGCEMLKNWALLGLGSGPDGKIFITDNDSIEKSNLNRQFLFRP
    KDVGRNKSEVASEAVSNMNPDLQGKIKWMTEKVGAESEDLFNDDFWNGLDFVTNALDNVDARTYVDRKCVFYKKPLLESG
    TLGTKGNTQVVIPNVTESYSSSRDPPEKSIPL
    CTLRSFPNKIDHTIAWAKSLFQGYFTEAPENVNLYLTQPDFVQQTLKQ
    AGDVKGILESIADSLNNRPYDFDDCIKWARLEFEKKFNHEIQQLLYNFPKDSKTSTGAPFWSGPKRAPEPLVFDIKNPDH
    FYFVVGAANLRAFNYGLTGDEGEPDISHYESVLANTNVPAFSPRSDVKIQANDDEPDPNSNSDVGGDALEALTASLPDPS
    TLAGFKLLPAEFEKDDDSNHHIEFITSASNDRALNYSIETADRQKTKFIAGRIIPAIATTTGLVTGLVNLELYKVVDGKT
    DIEAYQNGFINLALPFFGFSDPIASPQGKYNDKSYDKIWDRFDIRGNITLKELIDHFDEKEGLEITMLSYGVSLLYASFF
    PPKKLKDRLNLPITEVVKLVTKNEVAPHVKTMILEICADDKNGEDVEVPYITIHL

    >gi|255711126|ref|XP_002551846.1| KLTH0B01276p [Lachancea thermotolerans]
    MVAQIGSASEFEQAVKVDKLVVVDFFATWCGPCKMIAPMIEKFAEQYPSAAFYKLDVDQVPEVAQQNEVSAMPTILLFKN
    GQVIDKVVGANPAAIKQKIAAHA

    >gi|255712475|ref|XP_002552520.1| KLTH0C06798p [Lachancea thermotolerans]
    MFVRPLFTARKPLSQQQPMLKSAVRMIRTFKQEEQPRLRINSLAPNFTAQTTQGKLNFHDYLGDSWGVLFSHPADFTPVC
    TTELGAFAQLKPEFEKRNVKLIGLSAEEVDKHQKWIKDIEEISSLDKFAFPIVGDADREVAFLYDMVDEEGFKNLSKGVV
    ATIRSVYVIDPAKKVRLIITYPASVGRNSSEVLRVIDALQKGDAKGVVTPINWQPGEDVIIPPTVSDADAKKKFGDFTTV
    KPYLRYTKA

    >gi|255712749|ref|XP_002552657.1| KLTH0C10076p [Lachancea thermotolerans]
    MKVSLFLPAFFLPLLALCRVHSVASLDFFYDTINTDSYTVVKYFTTWCSHCKRLGPVFSQLSEAFEDRKDINATFLEVDC
    DLFGSTLCDHLPGYPAVEVIKPITEQERLDSNSAQKNTEKLSWWSKLIKTIKQGGYNPAWHMDKSRAVEFNGSRDLPRLK
    NFVDMVVESTEQDKVLEAVLSEATCEDDRCESLRKYLSKVHSTDREAQKLESILRNNPDEELAEIKLKLKLLHKLQEKNS
    EHDEL

    >gi|255713866|ref|XP_002553215.1| KLTH0D11616p [Lachancea thermotolerans]
    MSLFKIISPKALAEKLQQEATRRIVAVDSTWYLPYLQKNAKKEFMELERLPNAVFFDIDGVKDANSPYPHMLPDAATFNA
    SMSELGIRKNDILVVYDRVGNFSAPRCAWTLAVFGHELVYLLNNFPAYKAEGFPLDTTPRTSFSELEPSDYKSDADFTKQ
    EVVSYEEIHKLVEDGKLAEVYNVFDARALPRFTGESSEPRPEIPSGHIPGAQPMPFTDVVKNGIFEMDSRLAAENLEKYL
    ESSGCKYDPSKPTVAM
    CGTGVSGVIIKTALESAGIKHVKLYDGSWTEWALRSEPKYVAKGRS

    >gi|255713976|ref|XP_002553270.1| KLTH0D12848p [Lachancea thermotolerans]
    MRYSYLGHPNRSQPKMWKAIVDAFNGNEGVQSGGKKQTYDFTAVNNIVQDPQSSKILVDVREPEEFEGGHIEKAVNMPFR
    SHPLALHEPAAEFEKNYGFKKPSKDAELVFL
    CASGFRAGNAREEATKSGYQNANVYPGSMKDWISKGGKTI

    >gi|255713978|ref|XP_002553271.1| KLTH0D12870p [Lachancea thermotolerans]
    MLRALLVAPRCAVGSRCMSTSASKVYKFEDIRSLVQKPNPQKILVDVREPSELQQYKLPTAINIPLKSAPGALGLSPDEF
    QDVFDFEKPKTDKELIFF
    CAAGVRAKAAEELAKSYGYENTGVYPGSIHEWLERGGDKL

    >gi|255713984|ref|XP_002553274.1| KLTH0D12936p [Lachancea thermotolerans]
    MLLQRLWLVFLGLCVVWAQNFYDNSPHIMELTPKSFDKVVHKTNYTTLVEFYAPWCGYCKMLKPILQRAAKNLDGIVQVA
    SVNCDLAKNKQLCAKYRVEGFPILMVFRPPKVDLSKKGKDRLKLGNHASEVYKGERKLRPIVDFSISRVKNYITRITRLE
    KLVQHLNRNNEVRYKAVLFSKKDKISPLYKSLALDWLGSVDFSLFLNSKLSTTPEALRDLHPEFQNFLSELRENANDLEK
    SMLVLFDTQDHRYYIYEEESFEKVNIWKLLSKFASPNEGPFTKRQDFLDALKSNKKTRKPPAKQKLEHDEL

    >gi|255714022|ref|XP_002553293.1| KLTH0D13420p [Lachancea thermotolerans]
    MSQYVAEAKQIIRSHKYVMLTANWCPDCVYANSIWRKYGVLNKVSQFEVGGYDRDKLNKYRDAFAEVAGIRNLPTIFVDG
    KVWGTEAELHKFEREGTLLEELKKIGLIN

    >gi|255714939|ref|XP_002553751.1| KLTH0E06182p [Lachancea thermotolerans]
    MRFAMSCHESLAVRSLQAFRLFSSRSILLNSAPAQASHTENHTYRARNAKRFLQTNHLQRTLGNSGPERWSFDFNQEKKS
    APFKKPALTPLKPFHQESKESTIQTAASPNASKWSTYSMPSKESLAKQQDQAKRQGQEIEKQLASEPKPVKKQKRRLRPR
    KALISLTPNAVDHLKLLLNQPEPKLIRVGVKNRG
    CSGLTYDLEYITAPGKFDEVVEQDGVRVILDSKALFSIVGSEMDWI
    DDRLSSRFVFKNPNSKGTCGCGESFMV

    >gi|255715437|ref|XP_002554000.1| KLTH0E12034p [Lachancea thermotolerans]
    MFARLVAQNFARRPAAFARFMSSETREAITAAIKSAPVVLFMKGTPEFPQCGFSRATVSLLGQQGVDPLKFAAYNVLEDP
    ELREGIKELSEWPTIPQLYVNEEFIGGCDILVSMAQSGELTKLLEDAKALVPEDDE

    >gi|255715539|ref|XP_002554051.1| KLTH0E13200p [Lachancea thermotolerans]
    MQLNKNILRLVMTRRMSGSVKHYDYLVIGGGSGGVASSRRAASYGAKTLLIEGKAMGGTCVNVGCVPKKVMWYASDLATR
    LTQANEYGLFQQTELTREKLTFNWPQFKEKRDAYIQRLNGIYERNLAKEGVDFIYGWAKFNKQGQVEVVKHDSTKEVFTA
    DHILIATGGEPIKPDGIEGYEHGIDSDDFFKLTEQPKKVVVSGAGYIGVELAGVFHGLGSETHMVIRGETLLRKFDECIQ
    NTITDHYVNEGINIHKTAKIDKVHKDEGTGKLSVHLDNGESIEDVDQLLWTIGRKTLLGIGIDNVGVKTNERQQVMVDEY
    QNTTAQNIYALGDVVGKVELTPVAIAAGRKLANRLFGPEEFAKQKQDYENVPSVVFSHPEAGTIGLTEEQAVEKFGQENV
    KVYRSKFTAMYYAMLEHKSPTLYKLVCAGKDEKVVGLHIVGDSSAEILQGFGVAVKMGATKADFDSCVAIHPTSAEELVT
    LR

    >gi|255715829|ref|XP_002554196.1| KLTH0E16456p [Lachancea thermotolerans]
    MRFISLVGTALISGKVSAESSIEQTAVHDSTNFCKINKDEVIGSTCDVTFKEINEINAKIRPDLLSLVHSDFFKYFKLNL
    YKQCPFWNDNNGY
    CVNRACAVDVIEDWEKLPEYWQPEVLGGLADESVEVDGSKDDECAFLDQLCDKARNGIVDQPDFNYC
    DVGDFHNNESVLVDLTANPERFTGYGGDQSSQIWSSIYRENCFSSDHEDQCLAKDAFYRLVSGLHASIGTHLSNDYLNTE
    TAKWGPNLDLFMARVGNFPDRVANIYFNYAVVAKALWKIQPYLAHLDFCNAYHEDVKSMIESVVSNLDSKIFNENLLFQD
    QISSSLKDDFRTRFKNVTTIMDCVHCDRCRLWGKVQTTGYATGLKILFEIDSEDEAARQNVVDKLTKYELIALFNTFDRL
    SKSIESINNFEKMYNEKVQSTGGRILSLFKSNNFFKILGNAGKSLSSSLISNSSEEPNTQDVTATSSITKTETPEAKFQD
    LKLPTKKVTKKASKNTLGGAWHTEINNVKEAFIFLGKSYLNLPRTLARMALFKLSRAWNNFVGVPNYVNEVENNSNTYQL
    NIN

    >gi|255715952|ref|XP_002554257.1| KLTH0F01100p [Lachancea thermotolerans]
    MQLSRNLFLGISALAAALGNAQQEATAPEGSAVVKLTSENFADFIKEHPLVLAEFYAPWCGHCKTLAPHYVEAAATLESK
    NIPLAQVDCTTEEELCMEHGIRGYPTIKVFRNHQVDAPSDYQGGRTASAIVSYMISQSLPPVSILEGEEAADDFKDLLAE
    SSGAVIVDGGVEGLNETFHELAELFRDDFTFVQYNGSDAKQKLSVYLPKQDAPIVFEGKNASISHLVDWVQVETKPYFGD
    INGETFQSYMDSNVPLAYFFYTSPEERASYEDFFSKLGKEHRGKINFVGLDASAFGRHAQNLNMKEQFPLFVIHDTVSNL
    KYGLPQLSEEEFSSLTKPLELKTKDIAKFIKSFISGKVEPIIKSEEIPEKQESSVFRIVGKTHEDIINDETRDVLVKYYA
    PW
    CGHCKRLAPVYEELANVYVTDKDAQDKVLVANVDATLNDVNVDLEGYPTLILYPAGNKSTPVVYQGARDMESLMNFIQ
    ENGHHEINGTAILESKKAQEAKEADEEAEAIEEESVEHDEL

    >gi|255715968|ref|XP_002554265.1| KLTH0F01276p [Lachancea thermotolerans]
    MEYSRTLTLVALVFTLFIIRRFFGSGFSKMASPQTVQHVRSLIKDNKIFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLL
    QLDTMKEGSEIQEALTEISGQRTVPNIYILGEHIGGNSDLQALEASGKLDELLEKALA

    >gi|255715972|ref|XP_002554267.1| KLTH0F01320p [Lachancea thermotolerans]
    MIRSTARIFRGFAGTRSIVVSRLIYKRSFSISFVTRMSENWNPNLTTEQLLVLRDKHTERPHTGAYLNNKDTGVYNCANC
    EAPLYKSETKFDSHCGWPAFYEEVKKGAITYHTDYTMGMKRTEICCANCGGHLGHVFEGEGWKERLGLPVDARH
    CVNSAS
    LNFKKQ

    >gi|255716508|ref|XP_002554535.1| KLTH0F07656p [Lachancea thermotolerans]
    MIHRQRLVSILAAVSLLSLWFFFSSNKLSYSTPNDPVVDLDTNTNTEHTDPQGQNKQAKLKFQSIMPSMPDQKAKQELGR
    ASWKYFHTVLSRFPDEPTQEERDKLAQFLQLYAELYP
    CGECSYHFVEMLKKWPPQTSSRTAAALWGCLMHNKVNVFLKKD
    EYDCSKILEDYDCGCGGEDGKINDQLKMNKVSLQKEGKQGG

    >gi|255716606|ref|XP_002554584.1| KLTH0F08756p [Lachancea thermotolerans]
    MPLDQLEAYEKSIVDKANGRTSEVDDDGASLDEILGELEDDTDFMEKYREQRLQQIADDMRKMKHNVESEQYGQVFTMTD
    ESELMRLTSATDQVVIHFYLDSFQK
    CATMDAKLKKLAEKHIMTRFFRISVEKCPFLVTKLQIKVLPCVVAYKNGLERDKI
    VGFTRLGNQTDDFEAGTLETILFNCGVLARKIQPRGIRTGRTDESDSDLDL

    >gi|255716770|ref|XP_002554666.1| KLTH0F10692p [Lachancea thermotolerans]
    MIHRPWVQNIRTAFSPTRPWAGSRLIRFNSTSALDSCVRPSKVLNAKPNLSIGITQRAANRLGQIFKDSREALRVSVESG
    G
    CHGFQYNLKLIPRDEIQLNNTMNSDKKDAAEPHHDAFEDDGEFGADEDVVFVLPDDGGQVVIDEKSLKVLDKTILTYTT
    ELIGSTFKITGGNMKNSCGCGSSFDVEL

    >gi|255716916|ref|XP_002554739.1| KLTH0F12562p [Lachancea thermotolerans]
    MVELRRSTRKKSSDAPKRAPEEEEVAPNAPETKKAKTNGSKGELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAY
    PKASTPG
    CTKQACGFRDNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSPSGTKRSYWVF
    VQGKLRTKRISVSPEASVSEAKKEAIEAAQTDDGENAKEEVKEEQDGEVSGEDEVDGNDEDDEDFNEQEGEDPELEEVGQ
    EEDEEYEEGDLKKDEDSEADVEGGNDDSVDAKEEADGLQEDEAEGEEENESNE

    >gi|255716932|ref|XP_002554747.1| KLTH0F12826p [Lachancea thermotolerans]
    MKLLRIGFLQVRITALHKNETLIKGAVKMRLKQLLLSLVLCTRLVVPLDDAESVDEDPFPQPVSAAGFREAISKHLQLVE
    FYSPF
    CHHCKKLAPVWEKTWKSFREEGEKLNISLIQVNCVENGDLCAEERIQAFPSIKLYGPSGFIKDFPNSWKRNEKTI
    SNFARQEAMNLDNFDTSLLYSKSKSLDGPEFLELIAGNGNLPNLVSFWPSEDLKNVDDNSFEFENCDECHGFQKIWTLLS
    NKLEPEGFVTSHFNCAANKKICQELGLENLAKLTNHRSDRKPQVALVLPNKTVNNLFFYHKYDDSVQSYADFATRTYSNA
    QIPETNMKSLGQLIEEPLELKKGQKSSDANIYVVFKYESETVVQEDFEILEQLIEPISRIPNAFLYKSSDDMMGLSRRLF
    NQMYNVINYEDNEEQKKPNEEFFVMSTLTQYPTFFLFKQGNLVPTVFHGYSTTEMRNLNFILKWLSENSLPLLNEVTSEN
    FDSLLGYHSELYNTMAVQLLDTSSESEYSRSMTYVENFLTSAFDYEATRSDFLYETVLNKRLMKEEAVRSLKNKNAPSTE
    IVKKMRDEIVHNDDHRALFAYLDLASHKALLTQAGLNAYDRTYKNGDVLIIDKVTGSYYYDRDQVGNMLTTTSPSQLKNT
    LARLNFPTKFSRSALAKIPIQNLNRGLTSILRPVLHPGLAGYALACVAFLFAFLRISKAYRKSVIGRKYRSKRDVTGILG
    KPKPIE

    >gi|255717120|ref|XP_002554841.1| KLTH0F15070p [Lachancea thermotolerans]
    MANASAVRLLGQENYERLRSSRVLLVGAGGIGCELLKNLVLMGFGEIHIVDLDIIDLSNLNRQFLFRQRDIKQAKATTAA
    RAIEHVSNSKLVAHQANIMDVNQFPLAWFSQFSIFFNALDNLEARRYVNQMAQYLRKPLLESGTAGFDGYIQPIIPGATE
    CFDCTTKETPKTFPV
    CTIRSTPSQPIHCIVWAKNFLFSQLFASSGSMSADEDLGTDNVEEIERIRQETNELHELQELIRS
    GDKTRIRDVFEKVFVKDIEKLLAIEELWKAREKPTPLYNFKFDEKINKNLNTVWTIQEQVNAFVLATEKLMQRLSSEKQI
    EFDKDDPDTLLFVAAAANIRASVFKLPLKSVFDIKQIAGGIIPAIATTNAIIAGLSSLASLRVLNLLKNQPKANPTELNM
    AFTAKASNMSNNRYLSNPQLGPPNPRCPVCSIARGVLTLSQNDLDTMRLSELVGAVQEKYSYSGEVSVLDKSTQRLLADF
    DFEDLLNKTLAEVKVARGTILLISDEQDSEESIRAPVELYIEQGEPEGINLPDIEVPLIKPAVVEPDETNSEEGVSMPGE
    IILDEDDKNPKKRHLDDASETPAKKALKTEEEHVVILD

    >gi|255717228|ref|XP_002554895.1| KLTH0F16346p [Lachancea thermotolerans]
    MTTDNIPNEVLLELEALRRENEALKQKLSSQTELPMSLEEFRRYGRQMIVEDTRGVEGQIKLRNAKVLVIGAGGLGCPCL
    PYLVGAGVGQVGVVDNDVIDTSNLHRQVLHDSTKVGMLKCESAKDVLRKLNPHVQIKTYPVRLNYSNAFSIFQGYDIVLD
    CTDTPLTRYLVSDVAVCLGMTVVSASGLGSEGQLSILNFASVGPCYRCFYPVPPPPNAVSS
    CQEGGVIGPCIGLVGVMMA
    VETLKIILDIYTLDNFKPFLIQYSGLPNQTLRSFKMRGRQPSCKACGEEKLITRDTIEAGEVNYEAFCGARNYNVCSPEE
    RINVQEFEDSISSNEKLSQILLDVRPHHHYKISHLPNTFNLTVKELRDMEGDMSLLQNEIPEIHNGSEVLVMCRYGNDSQ
    LATRILKDKFNIMKVKDIRGGFFKYIDDINPSLPKY

    >gi|255717248|ref|XP_002554905.1| KLTH0F16566p [Lachancea thermotolerans]
    MLLKPLTRSFRSSPLFQSPKRMVHHRVTIIGSGPAAHTAAIYLARAEIKPTMYEGMFANGVAAGGQLTTTTDIENFPGFP
    EGMSGSELMDRMKKQSERFGTDIITETVAKVDVTSRPFKFWTEFNEDAEPNTTDALILATGASAKRMNLPGEETYWQQGI
    SA
    CAVCDGAVPIFRNKPLAVIGGGDSACEEACFLTKYGSKIYMLVRKDHLRASTIMQRRAEKNEKIEILYNTVALEAKGD
    GKFLNALRIKNVQTNEESDLPVNGLFYAIGHTPATSLLAGQVDLHENGYVKTVPGSALTSVPGVFAAGDVQDSRYRQAVT
    SAGSGCMAALDAEKFLAEQE

    >gi|255717276|ref|XP_002554919.1| KLTH0F16874p [Lachancea thermotolerans]
    MGKGKVAVYHVEGMTCGACAVAIETELKRVKGVKDVTVSLATNECRVEFDGQQVEQPALKGAIMDCGFDATLAKQQQEVP
    SLQEQSSAVFSVQHMT
    CGACVATITQNISAERGVLEVDVSLATEECHVVFVPEMITPAQIKEIIDDSGFEAELINGAVAT
    KSQSSQVRQASLKVLGMT
    CGSCVSTVESTLAEMPGVLSVQVSLATEEAEMQYDSSIIGIRDMARKIEELGFESTAVNSYD
    NTAQVKQLAKVREIFFWKHTCVRACLSMVFMLLLYKFIPRLSPKVRSWALYQQSPIPGLFYRDIVGFMVTCYVQFWVGRH
    FYKAGFKSIKHGSGSMDTIVLLSTLCSFAFSLYSIANNIIKKSDKLPNVVFDASTMLIGFISVGKLLENKAKSRTNTSLS
    KLISLAPSTCTIIENGEPREIPVEYLQVGDVVEIKPGARLPTDGVIIQGESEIDESLITGESLMVPRYKGSPVIAGSING
    PNHFLFTATSVGDDTKLSHIIQTMKQAQLNKAPIQHYADYLASKFVPTILMLALITFATWLVLSHVLSQPPAIFNDPNGK
    FFVCLEMTISVIVVACPCALGLAAPTAIMVGTGLGARHGVLIKGGDILEKCNTLGTFLFDKTGTLTTGHMTVHEYCAMGG
    SSSLSTEQLLCINAAEAVSEHPVAKALVDYTSQQLAGCSKTAIVTKSQVVLSGGLICDCELDGKSYHVVIGNKNVLQRES
    LPSASNNTVAYVEIDGEVIGRFEITDLIKKDAAEVVKYLQEKGHRVCMVTGDNRDSALKAAGELGIESSNVFSELTPTGK
    NQLVRDLQEGSGQNVAFVGDGINDSPALVTSDLGVSISTGTDIAMEAADLIILSRSDHENATLRELVYALDIAQKTFRRV
    KINFFWALCYNLFMLPIAMGVLVPWNITLDPIVAVACMAASSVSVVGSSLLLNGWKPPALEVSANTGNRSMWSSLAKVFR
    GRHDAQPDDIELQAGLIPHAASSNSLEE

    >gi|255717631|ref|XP_002555096.1| KLTH0G01276p [Lachancea thermotolerans]
    MVSAVSKSIKFSPQSEKLLTVAAGCFWGTEHIYRKYFGNRIKDYKVGYANGDETKKDSSDSVSYKRVCSGETQFAEVLQI
    SFDPKTVSLKELVDFFFRIHDPTTVNSQGPDVGTQYRSAILTHTQEDLEECRRLKEQWQPKWGNKIVTEVTMCTNFYDAE
    EYHQLYLDNNPQGYACPTHYVRDL

    >gi|255717889|ref|XP_002555225.1| KLTH0G04334p [Lachancea thermotolerans]
    MRISGLIWLFTLIGLGNCLEWDDVSDLRDADGIIEVTESNYRKLSQGSRNFYSILYVTTSQVTSGGVYCELCDIFEGNVR
    KASNAMQQQLPEDVNREAVFFKLDVSQCSSFVKEIGLQTIPHMLIYPPPKDEDSFAWSKSVFYQFQITPESAKDPVLFAD
    FLAKILNVYFGVARDFDKEEFFQYFIASLACFFVLKKKILPLIPNKAWFFSLLFSLGVVLASVTGLKFTQINNIPLLAKD
    EKGNIMFFSGGMGWQFGIEIFSVSTMYIAMGSSVIALIFIPRVKQLNPFLSNAVSLALLALGFYVFAYFTSCFKVKDPGY
    PFAIL

    >gi|255717925|ref|XP_002555243.1| KLTH0G04730p [Lachancea thermotolerans]
    MVAQVQKPAPAFNKTAVVDGVFDEVSLDKYKGKYVVLAFVPLAFTFVCPTEIVAFSDAAKRFEDLGAQVLFASTDSEYSL
    LAWTNVARKDGGLGPIDIPLVADTNHSLSRDYGVLIEEAGVALRGLFLIDPKGIVRHITINDLPVGRNVEEALRLVEAFQ
    WTDKNGSVLPCNWTPGAATIKPDVEGSKEYFNAHGK

    >gi|255718241|ref|XP_002555401.1| KLTH0G08404p [Lachancea thermotolerans]
    MRFTQLAVFFAAFFLPFISAISNEKLSKEASRYKGIIQLTNNNFKRILDSKREAYIVVLLTATNAQVGCTLCMELDPEFS
    MMADSWYKDHPEGLSESGTGMFFARADFDPKKNSDVFMHFKVNNVPRLLFLTPQGDPSSFSQINLPGEGGMTRVLAIVNT
    LRDATGISDFKIYQPINWGSVFVTAFATAAVTLLVKKYKPVAAKLITSKYVWGLATVFVIILWNAGYMFNSIRGSQFAGM
    TQDGSAVIYFMEGQQQNQFGIETQIVGVIYGVLASCVAGLVLFVPYAKQFYATDKSGRPTLSKACFVEFSLTLSFLVTLY
    LVYGALTGVFKLKSPGYPFKLIKFPFH

    >gi|255718739|ref|XP_002555650.1| KLTH0G14234p [Lachancea thermotolerans]
    MVVIEITSQDQFTDLTTVNAEGKLIALYFHTTWAEPCKTMNTVYTALSEEPVNKEVQFLAINADDNAEIAELFEVSSVPY
    FVLVRNNTILKELSGADPKEFVKALNQFNGSLAEGAGAPPQPAQNEGVEEEEPVETEEELMERLKKLTQAAPVMLFMKGT
    PSEPK
    CGFSRQMVGILREYQVRFGFFDILKDDSIRQGLKKFSDWPTFPQLYISGEFQGGLDIIKESLEEDPEFFQHAMNA


    >gi|255718903|ref|XP_002555732.1| KLTH0G16060p [Lachancea thermotolerans]
    MLSKRNLRVFVFTGVLLVLIYFIIQNAHTTVTSGNSSLSGQTASGAVIHSKGNHKSSGEVDPSVDKEIQEIKNEVGIKGD
    DGASSGTDFTQEKEFDPAKEYQYILANRPMIVFSKSR
    CPFSKKLKDLLAKEFEFSPSYMVVELDKHEHGAELQKHIGSLT
    GRSTVPNVIINGVSRGGCDDFEKLQEKGELLSSLKTWCDKALTVSKKEKPSNN

    >gi|255719003|ref|XP_002555782.1| KLTH0G17314p [Lachancea thermotolerans]
    MTSHIQPQICLGATAPNFTANTSQGQLDFYSYAKGSWCLFFSHPADFTPICTTEIGAFAQLADEFEQRNCKMLCMSTNSA
    ETHLQWILDIEDVTGAKVTFPMICDEDGRISTMFGMVDSRNFDERGLPIPIRCVLIIDPQFEVRLLHAYLLSTGRNTAEI
    LRCLDSLQVVDQMHGKVMTPINWIPGDDVVLSPQVDQEDIERNFPEAREIRPYLRLTPLDMD

    >gi|255719055|ref|XP_002555808.1| KLTH0G17908p [Lachancea thermotolerans]
    MTGQRDDDSTKPKVGFSGRKIIYDEDGKPCRSCNSLLDFQLATGRISIPSPGKVPAAKMAAPAKQTTPASYPKVEPPDVE
    ELGRSSWTLLHSIAAKYPQKPNEIQKGEMKQFMTIFSHVYP
    CWWCAKDFEKFIRENSPKVDSREELGRWMCEAHNSVNEK
    LGKKAFDCNLWEKRWKDGWD

    >gi|255719684|ref|XP_002556122.1| KLTH0H05588p [Lachancea thermotolerans]
    MSKFYDLAPLDRTGKPFPFKQLEGKVVLIVNVASKCGFTPQYEELQELYKRYHDKGFEIIGFPCNQFGHQESGTDEEIGQ
    FCKLNYGVTFPVMKKVHVNGDNADPVYEYLKNEKAGMLGFKGIKWNFEKFLIDKHGNVYERYSSLTKPANLDAKVQKLLG
    A

    >gi|255716846|ref|XP_002554704.1| KLTH0F11638p [Lachancea thermotolerans]
    MGSVFLPHLHSGWHVDQAIVTEQERLVVVRFGRDWDKDCMLMDEVLYSIAEKVRRFAVIYLCDIDEVPDFNDMYELYDPM
    TVMFFYRNKHMMCDFGTGNNNKMNFVVEDKQEMIDILETIFRGARKNKGLVVSPYDYNSKRV