Anopheles gambiae

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|158289377|ref|XP_311114.4| AGAP000044-PA [Anopheles gambiae str. PEST]
    MAGMQRTIVGLMVAAALLATLASGHADTASVHLTKDNFQSELEGSSYFVMFYAPWCDYCKKLAPTWATLAKARNGDPDGV
    VKIGRVDCTTDGDLCTQHDVTGYPMLKLFRKDGGADGATKYRGARDLAQFNAFLDEQLAPAAGDGPAKGADRDGEDGAQE
    DGGQADAPPAPVSPLTELTEDTFAKHVSSGKHFVKFYAPW
    CGHCTKLAPTWEELARSLEHERDIRVSKIDCTQYRPICTD
    FEVKGYPTLLWIEDGKKIEKYTGPRTHADLKQYVARMAGGLKEDGAQGAEPKGEGTLEGGAERDDNRSVVVQLSEGDFAH
    AIAKGVTVVKFYAPW
    CGHCMRLAPTWEQLAEKLTARDGVTIAKVDCTVDANKELCGEQEVNGYPTVFLYRDGEKVTEYFG
    HRSLDDLHEFVMQHLQDNGPHDEL

    >gi|158289078|ref|XP_310856.4| AGAP000262-PA [Anopheles gambiae str. PEST]
    MFFLFFFCCTQNYKDKEAGKVVVYSTSMGIVRETYTKCANVKQILRTLLVKFEERDIFMSSEYQQEIRERMQSDTINIPQ
    VFVDGQHIGDAECIERLNESGELRKMLKPYKCLESPYMCKVCGGYRLLPCPSCGGSKKSIHRNHFTAEFVALKCMNCDEV
    GLVKCHNC

    >gi|119113794|ref|XP_310704.3| thioredoxin-dependent peroxidase (AGAP000396-PA) [Anopheles gambiae str. PEST]
    MSFLVRQLAQACTRVGTSAAARGCLQRSALLHTGRTLSVAQVQQPAPSFQGTAVVNSDFREIKLADYRGKYLVLFFYPLD
    FTFV
    CPTEIIAFSDRINEFRELNTEVVGVSVDSHFSHLAWINTPRKAGGLGKLEYPLLADLTKRISADYGVLLPDGISLR
    GLFIIDPAGVVRQITINDLPVGRSVDETLRLIKAFQFVEKHGEVCPANWEPKSNAATIKPNPKDSREYFEKHGK

    >gi|158288678|ref|XP_310527.4| AGAP000556-PA [Anopheles gambiae str. PEST]
    MKALPCFPASSRLPLHSNVCNSKPQCLELAALIREQIPEAEVVCRTGRRGSFEVQINDTLVHSKLGSLAFPRYEEVVQNV
    RNARDGLPVARVAEQPITDCVLQ

    >gi|119113490|ref|XP_001237264.1| AGAP000565-PA [Anopheles gambiae str. PEST]
    MATAVLARPARSLINVVQCVRLIRTQATVMFAKENYEYDLVVIGGGSGGLACAKQAVQLGAKVAVLDFVKPSPRGTKWGL
    GGT
    CVNVGCIPKKLMHQASLLGEAIHDSQPYGWQLPDPAAIRHDWATLTESVQNHIKSVNWVTRVDLRDQKVEYVNGLGY
    FKDDHTVVAVMKNQTERELRAKHVVIAVGGRPRYPDIPGAAEYGITSDDIFSLPQAPGRTLLVGAGYIGLECAGFLKGLG
    YDVSVMVRSILLRGFDQQMATMVGDSMVEKGIRFHHRSRPLAVEKQPDGRLLVRYETVDEAGTATNGEDVFDTVLFAIGR
    QAETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPHIYAVGDVLYRKPELTPVAIHAGRIIARRLFGGSEERMDYADV
    ATTVFTPLEYGCVGLSEEAAEAAHGKDGIEVYHAYYKPTEFFVPQRSVRYCYLKAVALREGNQRVLGLHFLGPAAGEVIQ
    GFAAALKCGLTMQVLRNTVGIHPTVAEEFTRLAITKRSGLDPTPATC
    CS

    >gi|119113492|ref|XP_310514.3| thioredoxin reductase (AGAP000565-PB) [Anopheles gambiae str. PEST]
    MAAATAAEQENYEYDLVVIGGGSGGLACAKQAVQLGAKVAVLDFVKPSPRGTKWGLGGTCVNVGCIPKKLMHQASLLGEA
    IHDSQPYGWQLPDPAAIRHDWATLTESVQNHIKSVNWVTRVDLRDQKVEYVNGLGYFKDDHTVVAVMKNQTERELRAKHV
    VIAVGGRPRYPDIPGAAEYGITSDDIFSLPQAPGRTLLVGAGYIGLECAGFLKGLGYDVSVMVRSILLRGFDQQMATMVG
    DSMVEKGIRFHHRSRPLAVEKQPDGRLLVRYETVDEAGTATNGEDVFDTVLFAIGRQAETGTLKLANAGVVTAEGGKSDK
    LEVDETDHRTNVPHIYAVGDVLYRKPELTPVAIHAGRIIARRLFGGSEERMDYADVATTVFTPLEYGCVGLSEEAAEAAH
    GKDGIEVYHAYYKPTEFFVPQRSVRYCYLKAVALREGNQRVLGLHFLGPAAGEVIQGFAAALKCGLTMQVLRNTVGIHPT
    VAEEFTRLAITKRSGLDPTPATC
    CS

    >gi|158296498|ref|XP_316887.4| AGAP000909-PA [Anopheles gambiae str. PEST]
    LSASFQVVVMFYNPSNSGAVQLNSENIDMTLASNELVLINFYADWCRFSNILQPIFDEAAEKVQAAFPDPGKVVMGKVDC
    DRESSVASRFHITKYPTLKVLRNGQPTKREYRGARTVEAFTEFIKKQLEDPIREFQNIKDLEQLDSKKRIVVGYFDRRDM
    PEYNTFRRVATNLKEDCQFHVGFGDVVQALHPPGHPIIVFRPDVAVSNENDETYMGDLKSFDELNIWVQEKCVPLVREIT
    FENAEELTEEGLPFLILFYAPGDLESIKDYKAIVQMDLISEKQNVNFLTADGKRFAHPLHHLGKTQADLPLIAIDSFRHM
    YLFPNFKDIYVPGKLKQFLNDLYSGKLHREFHYGPEKDTAADSNAIEDSKNPTTPPESTFKKLGPSKNRYTLLRDEL

    >gi|58386840|ref|XP_315090.2| AGAP004986-PA [Anopheles gambiae str. PEST]
    MRLFAITCLLFSIVTVIGAEFSAEDCRELGLIKSQLFCSSCSSLSDYGLIELKEHCLECCQKDTEADSKLKVYPAAVLEV
    CT
    CKFGAYPQIQAFIKSDRPAKFPNLTIKYVRGLDPIVKLMDEQGNVKETLSINKWNTDTVQEFFETRLAKVEDDDYLKT
    NRV

    >gi|158293756|ref|XP_315097.4| AGAP004992-PA [Anopheles gambiae str. PEST]
    MATFRLGAIASIATRIPHQNVAKLQRINLVRRMATGAAPKKPTSTLGLAVKGMAIGALVGTGWSGYSYFKGGPTDHMLHE
    HVGPKVLDKLPDVKIMRKVVNPNDDSGLDLVLFQFQT
    CPFCCKVRAFLDHSGLSYSVVEVDAVLRQDIRWSDSKKVPILL
    AKTKSGKYVQLTDSSMIVSSISSFLRDKKQDIGELAKYYPSISYENDAGRKVFDIMNKYFLMYQEKKVDNRTKEEQEEER
    KWRAWADDHLVHLISPNVYRTKDEAMETFEWFSDVGEWGIHFPKWERDLMVYVGAFAMWGISKRLKRRHQLSDDVRSHIY
    DACDRWISEIEKKKTTFHGGSQPNLADLAVFGVLNSMEGCQAFKDCLENTKIGPWFYAVKERVLKNRGNVL

    >gi|31210023|ref|XP_313978.1| AGAP005102-PA [Anopheles gambiae str. PEST]
    MEVASPNNDHLSKRWNHLRKILERSGPLCHPYFVASSETLEFLLNTCKILVIGAGGLGCELLKDLALMGIRDIHVIDMDT
    IELSNLNRQFLFRRTDIGKSKAQCAAAFISARVPGCVVTPHFCKIQDFDSAFYRQFHIIVCGLDSIVARRWINGMMISML
    EYEEDGSVDETSIIPFIDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVNYPL
    CTIANTPRLPEHCIEYVKIIQWPKET
    PFGVDVALDGDDPQHVSWVYEKAQERANSFNITGLSYRLVQGVLKNIIPAVASTNAVIAAACATEVFKIASSCCEPSNNY
    MVFNDVDGIYTYTYEAEKRSDCLACSQVPRPVDIKDPNGMTLQDLIQLLCENPEFQMKSPGLTAVLEGKNKTLYMGTVKS
    IEEATKGNLTMSLSELGLKDGQEIMVADITTPNTILIKLKFQPNEVEMS

    >gi|118786459|ref|XP_315438.3| AGAP005431-PA [Anopheles gambiae str. PEST]
    MYTLCKLLIALCCFTTLAHSSRVLELSDRFLDVRNEGQWFVMFYAPWCAHCKKLEPVWALVAQALYNTNIRVGRVDCTRF
    TAVAQHFKVNAYPTIIFVKGPYDYVYNGERSKEELIHFVNRMSGPPVQLVTRADSIDILKSNNPIFFTYVGKQSGLLWDV
    FYSAAESYQAHGYFYATSVEIAKRHFDVDTVPAALVYKERSHYYFPYSDNFERIEPAHLNDTLFRWVNEERFATFPKVTR
    SNIHHLVQTQKYLVLAVVEENKLSEIAAHEQEFRDMVEIFVHKNKHKYHGRFQFGWVGTPELARSIAMDSLPTPHLLVLN
    ASTNEHHIPEDDPLQLTPEAIEIFLDSIHNQTAPTFGGNSLPVRIYRAWFEAKTSLYEMWIGNPVLTTVLFGLPLGFLSL
    IMYSICCADILDAEEEDDGADQRHEKNE

    >gi|58387309|ref|XP_315465.2| AGAP005462-PA [Anopheles gambiae str. PEST]
    MAVKAINDEGHFQAELSAAGGKLVVVDFTATWCGPCRNIAPLFEQLPTKYPKAVFLKVDVDKCAETAATQGVSAMPTFIF
    YRARTKIDRLQGADINGLEAKIQKHYVASADESGEDYGQGMLDLNTFIQKNQCECLNEADDHPWTNALTASGGHLASDCD
    EQLIISITFNQVVKLHSLKIKAPPTHGPKHVKLFINQPRTLDFDMADSYVSVQDLEIDPKDLETGNPTKLRFVKFQNVQN
    IQLFVKDNQSGGETTIIDHLAFIGQPIATTKMDDFQRVAGKKGESH

    >gi|58387722|ref|XP_315763.2| glutathione transferase, omega Class (AGAP005749-PA) [Anopheles gambiae str. PEST]
    MSNGKHLAKGSSPPSLPDDGKLRLYSMRFCPYAQRVHLMLDAKKIPYHAIYINLSEKPEWYLEKNPLGKVPALEIPGKEG
    VTLYESLVLSDYIEEAYSAQQRKLYPADPFSKAQDRILIERFAGSVIGPYYRILFAADGIPPGAITEFGAGLDIFEKELK
    ARGTPYFGGDKPGMIDYMIWPWCERVDLLKFALGDKYELDKERFGKLLQWRELMEKDDAVKQSFISTEDHTKFLQSRKNG
    ENNYDILA

    >gi|158295898|ref|XP_557147.3| AGAP006470-PA [Anopheles gambiae str. PEST]
    MPAAEQTLPNNHHQNGKEPAAPCRTCMDFKSWSKQQRKSLSTSAGTASVAKAGSEGEVAAHRKADSSDDRSGGSPPNCPI
    DKEQLGRYTWGLLHTIAAYYPTTPTDAEERNVRTFFTSLSKLYP
    CEYCAKDFQQELKEMPPETKSQHALSQWLCRIHNRV
    NVKLGKPEFDCTKVNERWRDGWLDGSCD

    >gi|58376628|ref|XP_308753.2| thioredoxin-dependent peroxidase (AGAP007020-PA) [Anopheles gambiae str. PEST]
    MSLNLGDPFPNFTADTTIGPIDFHQWIGDGWAILFSHPADYTPVCTTELAAVAKLVPEFTKRNVKPIALSCDTVESHRGW
    IEDIKAYGQLAAADPFPFPIIDDSKRELAVKLNMLDRDEIGSAGLPLTCRAVFVIDAGKKLRLSILYPATTGRNFAEILR
    TIDSIQLTDKRRVATPADWMPGDSCMVQPTVPADQLATLFPAGVDSVTLPSGKQYLRKTECPN

    >gi|118778338|ref|XP_308583.2| thioredoxin (AGAP007201-PA) [Anopheles gambiae str. PEST]
    MAAIQKFLNLRAPIGTFVRGISTSVPRFEIFKVQSPEEFNEKVRNSKDPVIVDFFATWCAPCRMLTPRIETVIGENEGKI
    KLAKVDIDEHTDLALDYEVQSVPVLLAIRDGKVEQRLVGLQDTDKLRTWVQNVVGKTK

    >gi|118778070|ref|XP_564835.2| AGAP007393-PB [Anopheles gambiae str. PEST]
    MSCRLLLVCLCALVAVAFAGEADVLDLTDSDFSTRVAETETTLVMFYAPWCGHCKKLKPEYAKAAELLRGEDPPIALAKV
    DCTEGGKDTCNKFSVSGYPTLKVFKNGEVSQEYNGPREATGIAKYMKSIVGPASKDLLTVEAFEAFLKVQETSVVGFFQK
    ESELKGVFLKYADSQRERLRFGHSSAPAVLEKQGETDAVFLFRARQLANKFEPDFVKFEGTTKQELADFVKANFHGLAGV
    RSRDTTSDFKNPLVVVYYAVDYVKNPKGTNYWRNRVLKVAKEFVGRVNFAVSAKDDFQHELNEYGYDYTGDKPLVLARDA
    KNQKFIMKDEFSVENLQAFATELEEGSLEPYVKSEPVPESNDGPVKVAVAKNFDEVVVNNGVDTLVEFYAPW
    CGHCKKLT
    PTLEELGTKLKDEAVSIVKMDATANDVPPQFEVRGFPTLYWLPKDAKSSPARYEGGREVDDFVKYIAKHATSELKGFDRA
    GGAKKTEL

    >gi|158285742|ref|XP_001687942.1| AGAP007393-PA [Anopheles gambiae str. PEST]
    MSCRLLLVCLCALVAVAFAGEADVLDLTDSDFSTRVAETETTLVMFYAPWCGHCKKLKPEYAKAAELLRGEDPPIALAKV
    DCTEGGKDTCNKFSVSGYPTLKVFKNGEVSQEYNGPREATGIAKYMKSIVGPASKDLLTVEAFEAFLKVQETSVVGFFQK
    ESELKGVFLKYADSQRERLRFGHSSAPAVLEKQGETDAVFLFRARQLANKFEPDFVKFEGTTKQELADFVKANFHGLAGV
    RSRDTTSDFKNPLVVVYYAVDYVKNPKGTNYWRNRVLKVAKEFVGRVNFAVSAKDDFQHELNEYGYDYTGDKPLVLARDA
    KNQKFIMKDEFSVENLQAFATELEEGSLEPYVKSEPVPESNDGPVKVAVAKNFDEVVVNNGVDTLVEFYAPW
    CGHCKKLT
    PTLEELGTKLKDEAVSIVKMDATANDVPPQFEVRGFPTLYWLPKDAKSSPARYEGGREVDDFVKYIAKHATSELKGFDRA
    GGAKKTEL

    >gi|158285745|ref|XP_001687943.1| AGAP007393-PC [Anopheles gambiae str. PEST]
    MSCRLLLVCLCALVAVAFAGEADVLDLTDSDFSTRVAETETTLVMFYAPWCGHCKKLKPEYAKAAELLRGEDPPIALAKV
    DCTEGGKDTCNKFSVSGYPTLKVFKNGEVSQEYNGPREATGIAKYMKSIVGPASKDLLTVEAFEAFLKVQETSVVGFFQK
    ESELKGVFLKYADSQRERLRFGHSSAPAVLEKQGETDAVFLFRARQLANKFEPDFVKFEGTTKQELADFVKANFHGLAGV
    RSRDTTSDFKNPLVVVYYAVDYVKNPKGTNYWRNRVLKVAKEFVGRVNFAVSAKDDFQHELNEYGYDYTGDKPLVLARDA
    KNQKFIMKDEFSVENLQAFATELEEGSLEPYVKSEPVPESNDGPVKVAVAKNFDEVVVNNGVDTLVEFYAPW
    CGHCKKLT
    PTLEELGTKLKDEAVSIVKMDATANDVPPQFEVRGFPTLYWLPKDAKSSPARYEGGREVDDFVKYIAKHATSELKGFDRA
    GGAKKTEL

    >gi|158285584|ref|XP_564767.3| AGAP007491-PA [Anopheles gambiae str. PEST]
    MVVVRVATSGSYHRPHIGSSAAWLLLLLLLAVSTVDLGTGGAVGLRERLSIYEQKRYQRQIEESENSGLYDATDSVISLT
    AANLKQRVFNQPHASLVEFYNSY
    CGFCRRFAPIWKQLASDILGWQKLVHVTALDCSRDENNAICREFEVMAYPTIRFFSP
    YYADGEQKIGEPVKEHDEQRIIDRLVEYMQRVENRPTNWPNLTAINRTDDKSALFDVTSLSGATVRPKYVYLINEKDANA
    TVGLQVILDFHDTPDVSVYRVHDPTLPSNGLSVVDGTSLSVINLPIDEFGRDKVRDAIRLHLRQHHIVVTDVSTKSTKKA
    GDGAGAVGGDGGGGGGTTEQNISALMEQKQEAAIRAKVKELGAAVVYQADLEEAVRFALFHEIGRYKTIEGDRLVALRNF
    LNVLVRYFPFNDNGRRFLTEVRQYVLNAGEKRLDGEAFVARVKALETERKPVFSSNHWIGCSGSKEGLRRYPCGLWTLFH
    YLTVQAAESDLSNSPLEVLEAMHGYIKNYFG
    CSECSQHFQQMADRNRIWQVATKDEAVLWLWSSHNEVNKRLSGDATEDP
    DHPKVQFPTASDCAQCRRKILTNHHNHQQYTMEDGNEWNLMEVLSYLKHMYAYERRNLFGLHDSSLAPQGSEGRSEWGGA
    AASGAQTSYHSYGNVLSDIDIRFSALLYITCIVMIVIAIKMVVKRGYRKKMYPHDILGKV

    >gi|118777903|ref|XP_564724.2| AGAP007534-PD [Anopheles gambiae str. PEST]
    MSIATYEEVLDLPNHPEKLLIDVRNPDELADTGKIPTSINIPLPQLEEGLKLDDEAFKAKFGRDKPSTSTEVIFHCKMGG
    RAQKATDLASSLGFTNARNYKGSWTEWAEKQGK

    >gi|158285504|ref|XP_001687900.1| AGAP007534-PB [Anopheles gambiae str. PEST]
    MLPGTSAARCVGSHIRRFSHSGQWPRVMVARTCPQISCSVPKKVFDIRQDALFRMASVNIRGFATTAPNDCGGNRFAPAC
    IEPQLVATTADVDDLPNHPEKLLIDVREPSELAATGQIPTSINIPLKTVRTELSLSPEEFEKKYGRKKPATNDPIIFS
    CR
    SGVRAGQASFEADQLGFKNVKNYVGSWLEYAAKHDLPV

    >gi|158285506|ref|XP_001687901.1| AGAP007534-PA [Anopheles gambiae str. PEST]
    MLPGTSAARCVGSHIRRFSHSGQWPRVMVARTCPQISCSVPKKVFDIRQDALFRMASVNIRGFATTAPNDCGGNRFAPAC
    IEPQLVATTADVDDLPNHPEKLLIDVREPSELAATGQIPTSINIPLKTVRTELSLSPEEFEKKYGRKKPATNDPIIFS
    CR
    SGVRAGQASFEADQLGFKNVKNYVGSWLEYAAKHDLPV

    >gi|158285508|ref|XP_001687902.1| AGAP007534-PC [Anopheles gambiae str. PEST]
    MAPIVWLFSRCTVVLLLVSVTAAAPNDCGGNRFAPACIEPQLVATTADVDDLPNHPEKLLIDVREPSELAATGQIPTSIN
    IPLKTVRTELSLSPEEFEKKYGRKKPATNDPIIFS
    CRSGVRAGQASFEADQLGFKNVKNYVGSWLEYAAKHDLPV

    >gi|158285485|ref|XP_308336.4| thioredoxin-dependent peroxidase (AGAP007543-PA) [Anopheles gambiae str. PEST]
    MRNFDAAIMPGIVACCLLLFSFAIIVQEGDGAVADEPGSCHSFGGGHVYPQEAPRFVDHKLQYTKAVISRPAPAFEATAV
    VDGAFKKIKLSDYRGKYLVFFFYPLDFTFV
    CPTEILAFSDRVNEFKKLNAEVIAASIDSHFTHLAWINTPRKEGGLGKIN
    IPLVSDITHSISKDYGVFLDDLGHTLRGLFIIDDRGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGQ
    DTIVPNPEEKIKYFEKNH

    >gi|158302218|ref|XP_001238545.2| AGAP001325-PA [Anopheles gambiae str. PEST]
    MHSFVRSSCAVVKNFFVLNQCGRPVLLNAAATFHTSKMVQIKEGDKIPSIDLFEDSPANKVNMADLCAGKKVILFAVPGA
    FTPG
    CSKTHLPGYVEKAGDLKSSGATEIVCVSVNDPFVMSAWGKQHNATGKVRMLADPAAAFTKALELGADLPPLGGLRS
    KRYSMVLEDGVVKSLNVEPDGTGLSCSLADKIKL

    >gi|158301857|ref|XP_321485.4| AGAP001613-PA [Anopheles gambiae str. PEST]
    MMFRAALVAAVLCGLGVHLVQSHPGSKSQVIELDESNWDRMLTDEWLVEFYAPWCPACKSLAPIWDDLSTWSDDLNIKTA
    KVDVTSSPGLSGRFFVTALPTIFHVINGEFRQYKGPRDMNSFMSFIEEKKWESLEQVSAWRNPDSIQMSLVSLFFKLSHF
    LKVSRTRWRELNTMLLKEYGLPVWGSYTLFGIGTVLLGAIFGLILVCIIDCLFPPKSGQRQSFSEHKQKVRAEKVPEELR
    GDELVDEDEEKRTADDDGEYDEEEEEEEDVEEDEEVGEAEEKETSEGEKYSGSDDSDDEQQQPPAAAVEKKKPEDKKPAA
    EQPAEPVVEEKKEKTTTSPDVRKRKPRKAD

    >gi|158301689|ref|XP_321349.4| AGAP001737-PA [Anopheles gambiae str. PEST]
    MGEMNGEGQIEVLENDIRTLRKQLQEKVQQLKTLKKHFQKNCITKLNNDEIARYSRQIILSEIGVQGQLKLKKASVLVVG
    AGGLGCPAALYLAGAGIGRIGVLDYDEVELTNLHRQLLHTEATVGLTKVTSVQSYLEQLNSQIEIETHHAQLTSENALAL
    LEPYDVVVDATDNVATRYLLNDACVLLRKPLVSGSALQLEGQLTVYNYRGGPCYRCLFPTPPPPESVTN
    CGDGGVLGAIT
    GVIGALQALETIKIILSNEGVLAGRLLLFDGQQSAFRNLKLRPKKPTCAVCSEAPTLTKLIDYEQFCGMRATDKDAALTL
    LEPCERISVRDYHDGWLAAGRDHLLVDVRNANQYEMCQLPGAPVNVPIEDILSNRRTEELLARAQQAQLPVYVVCRRGND
    SQLAVRHLAPLFRERNLPAPRDLIGGLHAWTKTIDPNFPIY

    >gi|158301638|ref|XP_001238461.2| AGAP001768-PA [Anopheles gambiae str. PEST]
    MRPNTANSFLELLFITLLIGSLLLLCPVRVAATNNVNVQSSNTLNKTDQLPVTIYYETLCSDSMVFITHQLYPSWLRHQK
    EMKLRLVPFGKAWIEEHPNEEPKYHCQHGPRECQLNILHGCILKKLPPKKAFSVVACLMKNFRTSFEQCMEGHESFQTSV
    VNCSQGQQGAKLFKEFANETDNVHRPLPFVPTIVADEPYDYYEQDDWLQHFDRKFMERYEAKFGVKL

    >gi|118793903|ref|XP_321144.3| AGAP001919-PA [Anopheles gambiae str. PEST]
    MIPRAAERLLVLVGLLLFVTGSSQALYSSSDDVVALTTANFDRTVVKSDEVWVVEFYAPFCGHCRNLVPEYKKAATALKG
    VIKVGGVNCEEEQGLCGQHGVRGYPTIKIFGANKRSPVDYNGQRTAKDIAEAALAEAKKKIKNVLGGGGGSSSSGGSGSN
    SGSGSKDDVIELTDANFDKLVLQSEEPWLVEFYAPW
    CGHCKNLAPHWARAATELKGKVKLGALDATVHQQKMSEYGVQGF
    PTIKYFPAGTKDRNSAEDYNGGRTSSDIVNWAQDKYTEDIPSPEIVQLTSEQVARDTCEKKPLCVVSVLPHILDCNADCR
    NGYLKILQEMGDKYKKKEWGWLWTEGGAQLDLESTLDIGGFGYPAMAVVNLKKMKYSLLRGSFSKDGINEFLRDLSFGRG
    HTAPVKGAELPKIHTVEPWDGKDGQLPVEEDIDLSDVDLDEKDEL

    >gi|158291086|ref|XP_312592.3| AGAP002363-PA [Anopheles gambiae str. PEST]
    VTIMLKVLVFALLALTGICRASSPLETVSEDDLVKKFHSHNNFIVLFSKPNCADCDKFEAILSKLKQEIEDNLQAHAVKA
    VSSSMARLYSPSKEPAVVYFRHGVPLLYDGAIEEDALIGKLIQNKDPNVKELSDETFEHLTQASSGATTGDWFIMFYTTN
    CVDCQRLTAVWEAVAADLKTRMNVARVQKDGKGSETAARFQVKKVPDFVFLRQGKYYRYEISKYDIKSFVTFAQDWYKNA
    KAERVPVPLSPFDNLVELAVQYLKDAPNMYAKLYSEYPMVVYAFGAGLLFIVLGFALAIILAIVTRCKAASRAKKETIKK
    AK

    >gi|118782693|ref|XP_312440.3| AGAP002500-PA [Anopheles gambiae str. PEST]
    MNVLTRNLAQTLFKYNGAGLIQAAARSFSAPALDGKEIEKLVSNNKVVVFMKGNPDAPRCGFSNAVVQILRMHSVKYDSH
    DVLQNEALRQGIKDFSNWPTIPQVFINGEFVGGCDILLQMHQNGELIDELKKAGIESALAKESEK

    >gi|31206473|ref|XP_312196.1| AGAP002730-PA [Anopheles gambiae str. PEST]
    MASKIVATATVRAVKHRKLLPMRAALSLTPAAVNRIKQLLEGKNEFIGLKVGVRQRGCNGLSYTLDYAATKDKMDEEVVQ
    DGVKVLIDKKAQLSLLGTEMDYVETDLSAEFVFNNPNIKGTCGCGESFSI

    >gi|158290499|ref|XP_312095.4| AGAP002816-PA [Anopheles gambiae str. PEST]
    FSVSMAPWRRLSVGRMTRLHYFQWIVVCFGVLLGLANHSSGYFYTDSSAEVSDERFCFCQLQGTIDDCSCNIDTVDYYNN
    VKIYPRLQSLLVKDFFRYYKVHLNKECPFWVDDSK
    CAMRFCHVEHCEEKDIPPGLKGDASSYHKYIKEVQTLTNCNEDLD
    VELGYLNTSISDKAHKEFQRWADYDEAQDNFCILDDHEPGAQYVDLLLNPERYTGYRGESARRIWSSIYLENCFQAHSVK
    KKNAYSAMIPYQDMARNEVCLEHRVFYRMISGLHSSINIHLCANYLLSEKGSFGFVAPTGVWGPNMEEFERRFSPHMTDN
    EGSHWLRNLYFAYLVELRALAKAAPYLRNEEYFTGLEKDDREVKTAVKDLLTVIEGFPAHFNETAMFSGGTSAIKLKHEF
    REKFMNISKIMDCVGCDKCRLWGKLQVQGMGTALKILFSGKFDDKIDTGLGTRVKQQPPSLRLKRGEIVALFNAFGRLST
    SIHELEEFRQRMR

    >gi|118781858|ref|XP_311902.3| AGAP002985-PA [Anopheles gambiae str. PEST]
    MGHVFEDGPPPTRKRYCINSASIEFMPAGSERKDVCKTGYEPTFFLRTFDLNNGFRFIASAAIVIECQAVPSSQDPDGLS
    LFRNGKVLKIVLKNFMCHRHMVVEFNKRANLLVGKNGSGKSAILAAMTIGLGCNAGQTNRCSSLKDLIKHGETQAVIEIH
    LENTAFNAYDPERYGGRIICERTLNASGGGSYKLKNEHGQTVSTSRAELQKILLAFNIQVDNPICVLNQDLARSLLKDSD
    ESKQYTFFSKATQIDTIKQKLNECAVIAKKARDVLVVKEKSLEYLSNEIVVLEEKQSNLESAGRMGELLSELQAKLAWRN
    VIDQEEQLAAVDDELKKLRTSIEEQEHRIRNREALVAKTDSTIDTYRADIESKKQEYVALKEAYGTVRRTLQDVQAKQAA
    IERGMRNASERVTRIQKDARQIEQDLQERNRDGLSQVEQRKQAVETEKAQLKERNDELASMIASAQREVDLMYNTMAHVK
    DAREEKHHERCAKQSETTRIEKQLEQFESAPRSKLAVYGTNMPALVARIRQLHQQGQFSEMPRGPLGQYIEVRNKKWSGI
    VETALGGCLSAFFVSTQEDWRTLDALLKREFPDLQNRTIFTGRFVKELYDVRSGCVQEQDGTHLLMNLIKVNDPVVMNRL
    IDSAAIDTILVTEHQSVAIQLTSEIENVPQNLSKVIVAEPCAEFFPQPKYRSYGLQQKPPRYLQVSMDELKRHTQQRREQ
    LQRELNELNSAYAKEDERLQEMTRKLHQRQQHMKKLQQELLTNEQQLQQLAGVVFEGETEETTLREELEHSRTILAKLQK
    GIEEEQAKLDQVRRTVQQEEQTAQAKKDAMGAVEAEIARIQASIDKEQQARHDLQTNHKVKQQALKRSTESMEERKRTRV
    ALSAALEQARQEASEKGERPDESEQIPSVEQLKGKIHTTEKRIRLVSATQDKLEDVVEELEGKNRERDELIRYSTALRDL
    TQMMRDIRKSRFSHLHKLTTHMALRVKHKFTNIMQIRNYLGKLRVNQEECRLSLSVVPRDANVQNAVSTTKSLSGGERSY
    ATVAFLIALWSCVSTPFFFLDEYDVFTDQVNRHTITRLLLNEAMKKPDRQFCFLTPQDMSEVQATAELTIHRYVPARCGA
    GCQDRVCILLKKN

    >gi|118781850|ref|XP_311899.3| AGAP002989-PA [Anopheles gambiae str. PEST]
    MKRSLAAVLIFAAFAANVQAVTVDVYYAHLCPDSVRWVQNQLLTLNPTLLNAITLDFIPFGKAQSVNNGQSFICQHGPAE
    CEGNRVQSCVLSLLPTQQAQVNYVGCQMSFTADPRGWECAFRSGVNLNAAEQCVEGTQGTTLQLEAERRTQLITPAFIPT
    IVFNGQFDQGLQDRSLNDFAGIICELAGLTGVGC

    >gi|58385827|ref|XP_314234.2| thioredoxin (AGAP003338-PA) [Anopheles gambiae str. PEST]
    MLRIFRNAILDKRITRKTFSFSAIAAKRYVIKDHYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKMTELLEPSEEIDLA
    IVDVDDNAELVQTFEVKAVPAILAFRNGVVVDKFIGLVDANMIENLIGKLTKKKAT

    >gi|58382128|ref|XP_311699.2| AGAP003415-PA [Anopheles gambiae str. PEST]
    MSITKVTSEDQYKQLIGASKVSVVLFSAEWAEQCKQISDVMTELAKQAEFKSLQFLDVPAEDLSELSMRHQIDSVPTVLF
    LRAGTAVDRIDGVDVGMLTQKAKKYAGMPTTPSPAGDGASNLEERLKALINRSKVMIFMKGDRNTPR
    CGFSKQLIAIVND
    TGVEYDTFDILTDEAVRQGLKTFSNWPTYPQVYVSGELIGGLDIIKELLEGGELKETLNP

    >gi|58377512|ref|XP_309682.2| AGAP003485-PA [Anopheles gambiae str. PEST]
    MEQLIQNQMISAAVQLEKHLDSELDRLETLNADDLDKLREQRIQQMKKQAQQRQEWKNNGHGEYAELADEKEFFAISKKS
    PNIVCHFYRDSTPR
    CRIVDMHLKVLATKHLEARFCKVNAERCPFLTERLRIKVIPSIALIKDSKTKDYIVGFTDLGNCDD
    FSTEMLEWRIAQSGAIEYSGDLLTPPDVKKQKKPTNMKTIRGGYDSDDSDIDFDD

    >gi|118783687|ref|XP_313167.3| glutathione-dependent peroxidase (AGAP004247-PB) [Anopheles gambiae str. PEST]
    MEDYKNAKSVYDFTVKDSQGADVSLEKYRGKVLLIVNIASQCGLTKGNYAELTELSQKYADKDFKILSFPCNQFGGQMPE
    GDGEEMVCHLRSAKAEVGDVFAKIKVNGDDADPLYKYLKHKQGGILGDSIKWNFSKFLVNKDGQPVDRYAPTTSPKSIVK
    DIDKLLEA

    >gi|118783685|ref|XP_313166.3| glutathione-dependent peroxidase (AGAP004247-PA) [Anopheles gambiae str. PEST]
    MEDYKNAKSVYDFTVKDSQGADVSLEKYRGKVLLIVNIASQCGLTKGNYAELTELSQKYADKDFKILSFPCNQFGGQMPE
    GDGEEMVCHLRSAKAEVGDVFAKIDVNGDGAHPLYKYLKHKQGGTLGDSIKWNFAKFLVNKDGQPVDRYAPTTSPSSIVK
    DIDKLLG

    >gi|158292212|ref|XP_313766.4| AGAP004468-PA [Anopheles gambiae str. PEST]
    MATLDDKLLGEKIHNYCSSSEDEAGDDECDSSEASGTGKGSGKQGTSSKSGFRREADIEPSSLSQNKTHWTGTAGNTGPK
    GVIQDWQRFKQLEAERREQDEMEKVRLLKKLSITARTKEEDKAAEAMNELDAEFQELMDEDFLLEYQRKRMAEMLAMMDK
    KGCFGELIHLKDGGEFLQAVDKEDKNATVVIHIYREKYDP
    CIKMNEALSKLAKEYTNVKFCKFISSDAGLSNLFKTSGVP
    ALLIYKGGQMIGNFVKLVDDLSDEFDFADVESFLVENGIINDKSCKPTIFEQK

    >gi|58385309|ref|XP_313849.2| AGAP004551-PA [Anopheles gambiae str. PEST]
    MLFKSLLLLSVYAVTCYGQSKVPVYVYYESLCPDSARFINEQLYPVAKELKKNLELHLVPFGKSSYTTQGSDVMFTCHHG
    ENECYGNKVHACAIQHIQGNSYQPNISKEDLTLDYVNCLMHRAQLKDGAFPTKRCADEVKIDQWQAIMDCANSTEGSQLL
    KQHGDVTNKLQSPLKSVPTVAFKQTYDDELQKLSVSSFRHALCKNLSPQPVECLDLPSTGSAISSLGMIVTVVAVLISRL
    L

    >gi|118781436|ref|XP_311467.3| AGAP010477-PA [Anopheles gambiae str. PEST]
    MQDPNEDTEWNDILRAKGIIPQKPKEKEITEDEIIGMIESTIAEKQNGKDLSKLDLDELDELEDSEDEAVLQQYRQKRIA
    EMQAAASRARFGTVREISGQDYVEEVTKAGEGIYVVLHLYSRGVPF
    CALINQHLTQLAAVFPMTKFVRAIATTCIANYPE
    RNVPTIFVYYEGQLKKQFIGAVELGGPNLTCDELEYMLGQAKAIESNIKEDPRESKKIKDKLFAELSDNNDW

    >gi|158293254|ref|XP_314572.4| AGAP010610-PA [Anopheles gambiae str. PEST]
    AVKIGTRMSSSPEGQDAMEVLACNSNQLAEDLYAAGSNAGRRQKLVHDYLKVADRDGKSVTAEFPDGLDWFNVTEPLTLQ
    GSLRGKVVVLDFFTYC
    CINCMHILPNLKRLEHLYPIEEGLAVVGVHSAKFRNEKDSANIRAAVERYEISHPVVNDNVSAM
    WRKLRVQCWPTLMILGPRANPLFVIMGEGNYEDLKLYVGSAIRFYREKGEIKRHSLPINLVSSGAIASNMKYPGKVACSV
    PTGAGGSEEQLFAVSDSGNHRVLIVDSAGTVLHKVGGKQSGFVDGNFTKARFNAPQGVAFQGTDVVFVADNENHAVRRID
    LKARLVSTIAGNGTQGNDRTGGKVGREQLLSSPWDVAVYSTRDLDMSFHADEASAPPSKDVLLIAMAGIHQIWALFLQDT
    IWWKFKKYGAGTCWAIAGNGHEQNRNTSYPQSAAFAQPSGLAINRTAKEVYLADSESSAIRKISLADGKVMAVAGGDRNP
    LDLFAFGDVDGKQYGAKFQHPLGVAYNPQDGFIYFADTYNHKIKKIDAATNCATTCEFREANGAVRRFNEPAGLCLDRSG
    QLLYIADTNNHELLVANLTDCTIRPLKLNFRVPEELDSVAGEAEQGGRRSGTLTLKPARPITMHPNAGQSSLRLTFNFTF
    PEQTTKLTEGAPQQWSLELPAGGWSCDSTKGTIDTKTLQLLIALPPGNDATNGNEPSNPVALTFKLNLCEGDICFPKEFV
    VLLEVQYSAS

    >gi|58377838|ref|XP_308081.2| thioredoxin-dependent peroxidase (AGAP011054-PA) [Anopheles gambiae str. PEST]
    MPVPELQKPAPAFSGTAVVNGEFKEIRLSDYLGKYVVLFFYPLDFTFVCPTEIVAFSDRADEFHEKKCQVIACSTDSHFT
    HLAWINTPRKQGGLGELKIPLLADKSMKIARDYGVLQEESGVPFRGLFIIDDKGNLRQVTVNDLPVGRSVDETLRLVEAF
    RYTDEFGEVCPANWKPGSKTMVADPHKSKDYFNAVN

    >gi|58377313|ref|XP_309539.2| glutaredoxin (AGAP011107-PA) [Anopheles gambiae str. PEST]
    MGSLVSRSVPANMSGPVAEFVKSAIAKDKVVIFSKTYCPYCTMAKEPFKKLNQEYACYELDKRNDGDEIQSVLGELTGAR
    TVPRVFIGGNFVGGGTDIKKMYDDGRLQKMLA

    >gi|158288082|ref|XP_309959.3| AGAP011549-PA [Anopheles gambiae str. PEST]
    METHKNQSIFVAFLLVVNSAAAFRFKGLEFYMQLWNGEFLESNSFGGDNDAKVAEKAEAVVEKKAPVVYVYKSGLYDYLT
    YWDKGMCSLDQGNDQDDSDGGRKSPLRVNCTPLEGNGTLYIITSLQDIVKGLSPHAAATNATNRNEVNNCFLMLFYTKT
    C
    IHSAMVAPHFNALARHFPDLMVTAIDAHNFHFLNAEFGIVGLPTIMLFHQGRPLVRYNGTEMTLLSLAKFVTRHTGIEPR
    LANQKSGTATVLHYISDDFKGPLSNKVEHRTDYWLYVAWAFILVCLSYYFSKSTLYAQIVEMIKRNWRESAAQHG

    >gi|158301129|ref|XP_320877.4| AGAP011629-PA [Anopheles gambiae str. PEST]
    LGGTCLNVGCIPSKALLNNSHYYHMAHSGDLAARGIHVENVRLDLDVLMGQKTKAVKSLTGGIAQLFKKNKITHINGFGT
    ITGPNTVVAKKADGSEETVNTKNILIATGSEVTPFPGIEVDEETIVSSTGALKLKAVPRRLGLIGAGVIGLELGSVWGRL
    GADVTAIEFLSTIGGVGIDQEVSKNFQKILTKQGMKFMLGTKVMSAAKTGSGVSVTVESVKDGSQQNLEFDVLLVCVGRR
    PYTEGLGLENVGIVKDDRGRVPVNSQFQTIVPSVYAIGDCIHGPMLAHKAEDEGIVCVEGMLGGHVHIDYNCVPSVVYTH
    PEVAWVGKNEEELKAEGVAYNVGKFPFAANSRAKTNNDTDGFVKVLADKQTDRVLGVHIIGPAAGELINESVLAMEYGAS
    AEDVARVCHAHPTCAEALREAHTAASFGKPINF

    >gi|158300962|ref|XP_552490.3| AGAP011754-PA [Anopheles gambiae str. PEST]
    MTCQSCVRNIEGTIGSKLGVIKINVVLAENAGYIDYDPSLTDPAQLAADIDDMGFECTDSETTNQKSDVRTTRISIEGMT
    CQSCVRNIEGNIKDRPGVISIRVLLDERLGIVEYDGRQTTAEAIAEQIDDMGFEARVAGEPNQPEQQRARSSPQTNGKKH
    ATNGSLTPKKKADESAQLRRCFLHVQGMT
    CASCVSAIEKHCRKIYGVESILIALLAAKAEVKYDERLTTPADVAKSITEL
    GFPTEVLEEPGTGETDVEIEILGMT
    CGSCVAKIEQTALKIPGVLQASVALTLKRGRFKFNNERTGARTICEAIEGLGFAT
    RVLSGKDKMAHNYLEHKEEIRKWRNAFLVSLVFGGPCMIAMVYFMVLMHERSHEEMCCVLPGLSLENLIMFTLSTPVQFV
    GGWHFYIQAYRAVKHGASNMDVLITMATTVSYLYSVGVLVAAMVLEQHTSPLTFFDTPPMLFIFISLGRWMEHIAKGKTS
    EALSKLLSLKATEATLVTLGPDYAVLSEKVISVDLVQRGDILKVVPGSKVPVDGKILCGNSTCDESLITGESMPVPKKKG
    AVVIGGSINQNGLLLMQATHTGEHTTLAQIVKLVEEAQTSKAPIQQLADRIAGYFVPFVVAVSVITLVGWIVSGYIDIGH
    IPASDRDKEGLTPSEIIVSYAFRCALSVLAIACPCALGLATPTAVMVSTGVGALHGILVKGAGPLENAHKVKTIVFDKTG
    TITHGMPMTSRICMLVKPAVCSLARALTIVGSAEVNSEHPIATAIVKYVKETLEIDGFGRCSNFSAVPGCGIRCVISNVG
    DTLKRVQQSEKMRNYQNSYRSEQQQQPLFMNAFADVNEYNVLIGNREWMARNAIVVPPEVNIRMSEEEQMGHTAILCAMN
    GQLVCMLSVSDMVKPEAHLAVYTLKRMGIEVILLTGDNKNTAASIARQVGINRVFAEVLPSHKVAKIQRIQEMGMRVAMV
    GDGVNDSPALAQADVGIAIASGTDVAAEAADVVLMRNDLLDVVACLDLSRKTVRKIHLNFLFASMYNLLGIPLAAGIFTP
    FGFTLEPWMASAAMAASSVSVVCSSLMIKLYKKPTQASLQTPEYVELMEAGAFLDPDTISVHRGLDDIPRPNLARSTSST
    LAKLFGRGKDTKEDGLLATLDDDEFSVGIVKTSNASIYKDATELQKL

    >gi|118793114|ref|XP_320690.3| thioredoxin-dependent peroxidase (AGAP011824-PA) [Anopheles gambiae str. PEST]
    MRIGATIPNFQADSTKGPIDFYEWIGDSWCVLFSHPADFTPVCTTELGRIAVHQEHFEKRNVKVLAHSVDDLKCHVDWVN
    DIKSYCPDIIGNFPYPIIADPSRDLAVRFGMLDEKDKDNVELAQTVRALFIISPDKRVRLTMHYPTSTGRNVDEILRVID
    SLQLTDRLKVIATPANWTPGTKVMILPSVSEEDADKLFPNGIERVSMPSGNVYVRTTTDYE

    >gi|158300307|ref|XP_320264.4| AGAP012275-PA [Anopheles gambiae str. PEST]
    MAKKGGVQQLQTEINTDDEFEKFLERDGLLVLDVYTEWCGPCVGMIGSLKKIKLELGGDNLQLAICKSDEIGALKRFRNK
    SEPTWLFASHGKIVNLMFGTNVPKLINLITEELDIELKCRAGELERTYYELWELTPEEQEREDVRQEREEEVARIEKEAA
    AKKRLDYITHVTDEIMGNIPDMGITLFMPHVHKDVFKKLHDHAEKHDLHMKEKRLVHLNPKMLEVLHFECENRLADDVFE
    QIYYKDIQAYVWKLTEGETRSPEEVIGAFVKIITEPVEVLDADGNVEKVIPRMIEPLEMLYSANDGTWKMVSKLPPQKSA
    SSIATTNSSDSSQNVSKETFDEEACPRLIIPGVWTPTNRRANAALFYLLFRHVSNRKGFGLFNFTVHNVPVIFSIPSTRS
    TEHFLPPDPVPEPPHICMVFDAYKKRDVLEVAMNEKYKTQVMAFGYFSTGDPKTAELIAKTTERYTTKRPNVNDKLIMKV
    SKATSHAMLALTAMGPCYVSQNAVEGQEECAALFPPNYNFVEEENETGEVEKKKHKKKRRGKKSDTSVSSATDSAVSTTP
    SAEPGADGQGELGTIGEGSTGEEGETTSSSQNSPEKTGGDPEEGAPS

    >gi|118792116|ref|XP_320164.3| AGAP012394-PA [Anopheles gambiae str. PEST]
    MVATEHAHDQAGRLENIPQQPLHQIDTPFEKATFGMGCFWGCDSLFGATKGVLRTRVGYAGGSTESPAYKKMGDHTEVIE
    IDYDPQTISYNDLLDLFWNNHEYGLTTRMKRQYMSLILYHNEQQRQIAEASRAEEQVKRAPEQIITEIAPAGPFYPAENY
    HQKYRLQGHTDLAKGIGLTPDLLHTSHVAARLNGYLIGVSGLKQFEDEADLLGLSKDQVQYVREYVIQNEGGGIFC

    >gi|118792114|ref|XP_320163.3| AGAP012395-PA [Anopheles gambiae str. PEST]
    MVATEHAHDQAGRLENIPQQPLHQIDTPFEKATFGMGCFWGCDSLFGATKGVLRTRVGYAGGSTESPAYKKMGDHTEVIE
    IDYDPQTISYIDLLDLFWNNHEYGLTTRMKRQYMSLILYHNEQQRQIAEASRAEEQVKRAPEQIITEIAPAGPFYPAENY
    HQKYRLQGHTDLAKGIGLTPDLLHTSHVAARLNGYLIGVSGLKQFEDEADLLGLSKDQVQYVREYVIQNEGGGIFC

    >gi|158300147|ref|XP_551775.3| AGAP012407-PA [Anopheles gambiae str. PEST]
    MRLLSAFGLVLAFATVALAAEEVKTEDGVLVLTKDNFDSVIANNEFVLVEFYAPWCGHCKALAPEYAKAAKVLADKESNI
    KLAKVDATVEPELAEKYGIRGYPTLKFFRSGSQVDYTGGREQDTIVSWLEKKTGPAAKELETVEAAEEFLKENNVAVVGF
    FKDRDSKEAKAFMSTAVAVDDYPFGVTSSEEVYAKYEAK
    CGSVILFKHFDEGKAVFEGEATEEALKKFVTAQALPLIVDF
    SHETAQKIFGGEIKSHLLFFISKEAGHLKEFVEPAKEVAKKFREQILFVTIDADQEDHTRILEFFGMKKDEVPSLRIIRL
    EEDMAKYKPETNDLSADKILEFVQSFLDGKVKQHLLSQDLPEDWDKEPVKVLVATKFDEVAFDKTKDVLVEFYAPW
    CGHC
    KQLVPIYDKLGEKYKDSDSVVIAKIDATANELEHTKISSFPTIYLYRKGDNEKVEFKGERTLEGFVKFLEGE

    >gi|158296880|ref|XP_317217.4| AGAP008252-PA [Anopheles gambiae str. PEST]
    FFLSYPPSSRDRTETNQHTHSYETMTKMGHYLMALCNAPLHSHRRHSSCSNHSKAPPQSGQTTMAANSNGTEPKFTNRLK
    QEKSPYLLQHAHNPVEWYPWGEEAIQRARAENKLIFLSVGYST
    CHWCHVMEKESFENEEVAKIMNEHFINIKVDREERPD
    IDKLYMMFILLINGSGGWPMSVWLTPDLAPVTGGTYFPPNDRWGMPGFTTVLTKLASKWSTDKDDLVTTGRSVIEAIRRN
    VDHKRADEVEDATNMETLEAKFKQAVNMYQRNYDMVWGGSLGAPKFPEASKLNLMFHLHVQEPKHKVLGVVLNTLDKMAA
    GGIHDHVFGGFARYSVDKKWHVPHFEKMLYDQGQLLSLYANGYRLTKKPSYLAVADAIYRYLCKDLRHPAGGFYSGEDAD
    SLPTAESEEKIEGAFYAWTYDEVKELLGANGEKFGELGGVDPVAVYAAHYDVKEEGNVKPSSDPHGHLLGKNILIVYGSV
    RETAEKFNTTVEIVERILKTGNELLHEVRDKRPRPHLDTKILCAWNGLVLSGLSQLACVKDAPGRSEYLATAEELVKFIR
    ANLYDVQARKLLRSCYGGAEESLASERPIYGFIDDYAFLIKGLIDYYVASLDEHALHWAKELQDIQDELFWDTKHGAYFY
    SEANSPNVAVRLKEDHDGAEPCGNSVAAHNLLLLSDYFEEERLKEKARTLFDYFAHTAHFGYVLPEMMSAALLEEQGRNT
    LIVVGPESPEATALVDGVREFYIPGMIIVQLKIDQPAHIVRRRKSLDNFKMVKNMPTAYICHNKVCHLPVTEPERLTEEF
    QPRYTFDYQEYEN

    >gi|158296716|ref|XP_317062.4| AGAP008389-PA [Anopheles gambiae str. PEST]
    LALILTTYATIQNSPPKVSKAPPAVPFFAKGSLVSDWPTGALGTTQTRVSVSELSLVLYYAPWCAESQYARHAYEQVAQL
    YYREAHFAAINCWQPGGECRQRYTKVQSWPVLMAYQPSGLAVQYHEAWTTAALSRFVQSLMLPLHRFASPGDLMDHMTGK
    DAVVVAFLDVSLDSKIYQRYYQASLKWLEKDPFQEVSFGVVTGESAQLFGVEMVPSIRLYLWNETIEYEGNSPRWTPQDL
    NAWIQKQLHVVSLWVSPPGNIKSFTLDPYLRQGPALILFTPRPLYEDSSDAYMMLRQLSMQYYNCPGDAWILEMAREYIA
    EQRAANVARFEQKREHCARVLGRHPSQDGEDDDESSPGNRRNRCKDGFKSTVSVSFVNVLNTSKFVDGKPVGGGKPSSAG
    EYCDIAPAMDCAKHEECGAFGPEGPRKPSLMWQSRDACTGRRHNEAETVYEQEQSSATSMIDAEHDYRGPKLLTRQSVRR
    QCELLQLAEAEKTNVFFTEPERQNESMDYYAAIGGLSCKGNKTLTFLSMDSNLYHALGERLGVDVLNEPNRTVAFIVDHT
    DESAYALRDQINLHTLSKFVHDYYNRSVQRFLRSKATTYAHTHAFNADRYVEQERGYLETHRKALAEARAKAEAESKQRK
    QSVEATNKQTKAGSQPEPTPTSPPPERAQTTAPTYRRVREITSSNFQRTVLESNRTVVVSFYSAQ
    CAFCYILAHHLLTVS
    HMLRHQPGLWFVRIDGELNDLPWEYTMDVFPSLIIFPRGRKADSRIFPETLQINVPNLIGFILSNLTPAERLHAYFLLCS
    DVVSNGASRTGCLVMLKRELSDGIRLSLLDWRRATDNACERDRIVRRLQLLKQAYLGTLRCLSHSCDLTQLANERKRIFQ
    LWTEPSCSRLL

    >gi|158293387|ref|XP_314735.3| AGAP008637-PA [Anopheles gambiae str. PEST]
    MAAQLDGVFEAELQKKITESKVLVVGAGGIGCEILKNLVLTGFTDIEIIDLDTIDVSNLNRQFLFHKEHVGKSKANVARE
    SALAFNPNAKIKAYHDSITTNNYGVNFFQQFSIVLNALDNRAARSHVNRLCLTADVPLIESGTAGYNGQVELIKRGLTSC
    YECVPQPAQKSYPG
    CTIRNTPSEPIHCIVWAKHLFNQLFGESNEDEDVSPDTADPEAGADVGSAALEKEANEKGNVDRVN
    TRTWAKQCEYDPEKIFNKLFYDDINYLLSMSNLWKNRTPPKPAKWDAVQEGDGEEGSIVEDSVTRDQKVLSLAQTAKVFG
    ESIKALKEAVGKLPEGDHLVWDKDDKDGMDFVAACANIRAQIFGIPRKSRFEIKSMAGNIIPAIATTNAITAGIVVMRAF
    RVLQQEYEACKTVYVRLRVNGRNQFIVPETLIIPPKPKCYVCAAKPEVVLKVDTKKLTVREFRDDILIKALNMVSPDVLL
    DGTGTIVISSEEDEKDCNNDKTLEELKIVNGCILKADDFLQNYELSITVLHKEAGREEAPFEIVADPDSLKPKEEEEKKE
    AGKQPAAAPVDDAQPSTSKGLNGSSSNGKQSTTVNEVEDDDDDMCIIEDDEDEKPSTSKAAADAVTTPGKSVEKRKHAPE
    DDEPANKKAKVSSSHPMDDDDDDLVILD

    >gi|158299972|ref|XP_319979.4| AGAP009202-PA [Anopheles gambiae str. PEST]
    LLAAVLLAGLAVSMVEAEKEIPLTKFSQDVGNYGATMTFLYCYSCGYRKAFDDYHNLILEKYPEITIRGSNYDPSGVNML
    LSKVLLVTKLLLIAALMSNYDIGRYIGNPFAGWWQWCFNNKLYASMMIFFLGNTLEAQLISSGAFEITLNDVPVWSKLET
    GRFPAPQEMFQIIDNHLQFANKIEPNPDFVK

    >gi|118790467|ref|XP_318603.3| thioredoxin (AGAP009584-PA) [Anopheles gambiae str. PEST]
    MVYMVKDSEDFNNKLEAAGDQLVVVDFFATWCGPCKVIAPKLEEFQNKYADKIVVVKVDVDECEELAAQYNIASMPTFLF
    IKRKEVVGQFSGANAEKLENFIQQHSA

    >gi|158298637|ref|XP_318831.4| AGAP009747-PA [Anopheles gambiae str. PEST]
    MFQKRQLRIIYLVILIIVLVLVYKSFTQHGPPAAEGDVEQTSGGNEAMLKPSAPVLVVVYYETLCPDSKNFVLHQLQPAF
    DRAPELMDIEFVPFGKASWTTKSDGSLEFDCQHGPIECEGNTIHACVVEAVREPRTRLAMVACMIQNNIMPRDIFYRCAK
    EHGVEIESIKKCYDSPHGAELLKVHGEATHALRPAVSFIPTVTLDGAQYVQKSILKDLFGNVCQVVAGRGPKPDVCK

    >gi|119114234|ref|XP_319140.3| AGAP009997-PA [Anopheles gambiae str. PEST]
    MSFKKDLVLLLKPYYWVNILMSISYIAAKRAPFICNYLWTYLFQQEDQCELDGRETEILFFLLIVVMIRTRKTGSVTMIN
    YLTSSFMYTKIANLGLWFYNDIRLGMIYFVFFILVALLLPEPTYTGPENVLYFRTENGLEEELEKDKRVTWLVTFYTVWN
    PA
    CVNFAPIFSELSNEYALSNLKFGKLDIGRFPKIGEKYHVSDSSFSRQLPTVILFRQGKEVARRPYADSKGKLVKFFFS
    ADNVKAAFDLNNLYKECKDNPIKAIKSVAEKKKD

    >gi|158299035|ref|XP_319154.4| AGAP010010-PA [Anopheles gambiae str. PEST]
    LRMQRSAELCVLTLMFTCSSYLIGSRSVPLQQGQQSLSEKVQQLLDMNTKRPVLRFNGNKFRDFVKSAPRNYSIIVMFTA
    MAPARQ
    CVICRHAHDEYTIVANSYRYSQTYSNKLFFAMVDFDEGSDVFQMLRLNTAPVFIHFPPKGKPKPADTMDIQRVG
    VSAEVIGKWIQERTDIQIRIFRPPNYSATVAILMLSLFVGGFLYLRRNNLDFLYNKQMWALIAVVFCFAMVSGQMWNHIR
    SPPFVHKSQNGGIAYIHGSSQGQLVIETYIVMFLNAMIVLGMVLLTEAGWQNDHRKSKVTAIVGLFLVVVFFSLILSIFR
    SKAQGYPYSFLFK

    >gi|158299119|ref|XP_319229.4| AGAP010072-PA [Anopheles gambiae str. PEST]
    MNAIVQRRIGLCFSSLLQRRLLSSAAPNAADASSVQLSNTCINRLKEICKQNSFLRVAVEGGGCSGFQYKFSVEKQLGED
    DIIVSRDGVQVAIDSASIEYLSGATIDYHTELIRSGFRVINNPKADQGCSCGASFTVKLD

    >gi|158299286|ref|XP_319403.3| AGAP010217-PA [Anopheles gambiae str. PEST]
    KAHQIIAIFFRLPALGIASAYAKTQKSPVIDNITDMKELKKLFRTKTNVLILFVAGMKDNNALLASFRDAAHAVKGQGTM
    VLLDCNNSEVKKICKKLKATPAPFALKHFKDGDFHKDYDRQLTTTSMVNFMRDPTGDLPWEEDPIGADVVHVPDAVTLGK
    FLKKEVKPTLVMFYAPW
    CGFCKTLKPEFSAAATELKGRYVLAAIDVNRPENSIIRKQYNITGFPTLLYYENGRMKYTFEG
    ENNKAGIVAFMKNPAAPPPTKPKEADWASESSSEIVHLTAGSFEPALKDEKSVLVMFYAPW
    CGHCKKMKPEYEKAAEIMK
    AKNIPGVLAALDATKEASVGQQYGVKGYPTVKYFSNGEFKFDVNVREADKIVKFMENPTEPPPPPAPETPWEDEPSEVVH
    LNEETFKPFLKKKKHVLVMFYAPW
    CGHCKRAKPEFARAAEHFKEDPKTELAAVDCTRHSAVCSSYEVRGYPTIKYFSYLK
    TVRDYNGGRTETDFIAYLKDPSATPLKTDKVAEPFGDFPGSDKILILTDANFEEVSKREPNLLVMFYAPW
    CGHCKHMKPD
    FAKVAQLLTTEKVSAKVAALDCTVHMKTAEKFQIRGYPTLKLFANGQFRRNYEGKRTAQDMLQFLRTDGAVAKDEL