Kluyveromyces lactis NRRL Y-1140 uid12377

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50302245|ref|XP_451056.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MATGISKTLKYNAQTDKLITFAAGCFWGTQHIFLKHFGDKIIDGKVGYSNGSESLKDKPDTVSYERVKKGDTGFAEVYQI
    SYNPKLVSLKELVDFFFRIHDPTTVNAQGPDQGSQYRSAIFAHSEADLNELKKLKEQWQPKWNNKIVTDISLIDNFYDAE
    EYHQLYLDKNPAGYACPTHYIRDL

    >gi|50302365|ref|XP_451117.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MRNILPKQAIYIGAKAPNFQAMTSLGPMDFYQYTQGKWCVFFSHPADFTPICTTEIGAFGALQDEFTNRDCVLLGLSTNN
    RASHLRWIQDIEAITGVKINFPIICDEEKKVATQFSMIDVNALTNGEPALTPLRAVYIIDPNKIVRLIQLYPLSTGRNTA
    EVLRCLDSLQLVYKTDGKIMTPINWIPGDDIVVVPDLENCSMFPHRRTIRDYLQLSPLDPNSLD

    >gi|50302773|ref|XP_451323.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MLSTKLFKPSLTRGFKTFTPTLFKAGDSIPTGLKGLHESSPGNSVDLGKEVAHGKYIIVGLPAAFSPACSASHVPGYIAH
    LKELKEKGVKQVFVTAVNDSFVTQAWAEDLGVPSDIRIIADTLGEFAKAGDHLFDSKQIFGNDRSIRYAVIVQDGKVVKE
    FAEPDKIGVDVSSAENVLKEL

    >gi|50303285|ref|XP_451584.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MRLWLLAFILGLLCHSTNASSLSIEEVSQYRDQDGIVIVNDDNYERFGKGLREFYSVVFITSDKPNSGGETCDLCKEFEP
    NMRSVSRSILNQLPKDQSDRIVFFKVDLAYNPIFLKEFQVTKIPFCLVYPPQLEVGADGQDFGWKHSVFYQYVIRKENMK
    QPIHFGDFLAKILNVFISIDERFEYDKFIQAFCLFVVVFVVFKKKILPLIENKPRFFLGCASIAIIMISISGYNFTSIKH
    IPFIAQDDKGQIMWFSGGSHYQFGIEVLTISLLYTVLGGLTVALCMVQFSKRLKKVQKCVLVMIIAASLFYIYMYFLSII
    KIKYPGYPYGLL

    >gi|50303323|ref|XP_451603.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MVAQVQKPAPEFKKTAVIDGVFDEVSLEKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEAIGAQVLFASTDSEYSL
    LAWTNVARKDGGLGPVDIPLIADTNHSLSRDYGVLIEEEGVALRGLFLIDPKGVVRHITINDLPVGRNVEEALRLVEGFQ
    WTDKNGTVLPCNWTPGAATIKPEVDASKEYFSSVNKD

    >gi|50303343|ref|XP_451613.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MADFRNIMQVLKECGTSRVVKHMEPERYLQSVGAAKELYQNKDEESLKRQKLVFHTPRPVTTENNGVPHFSFGVPEERPH
    YKFMAHSKKALEDLQLKSDSSLINICQGSDVYIDESREIFPYSLAYAGFQFGEFAGQLGDGRVLNLFDIKDKESKLQTVQ
    LKGSGLTPYSRFADGKAVVRSSIREFLICESLHAIGIPSSRALQISSLPKTRARRSVFEPCAVITRFAPSWIRIGNFDLF
    RWKQDDEGLLKLADFSINHVFEGLKDYRDTVALNSFSANYFEGTSDTVNNKELRSSKVDDGLTNYDKLFRHIVTLNAECV
    AYWQAYGFCNGVLNTDNTSILGLSIDFGPFGFMDKFQPQYTPNHDDYNLRYSFANQPTVIWWNLIKLAEALVIPLGVGPS
    LIDKLPTTNRGEWKDPEIEKISKRATAIINLTGLEYEFRFTTKYADLMAKRLGYDLNIPATLTDDNLKSVAEKVTAFTTD
    IIEPILRILTVSGVDYNSFFLALQNYDGNFLDEGGINGVDDGLYRVFFNEEQTKKINDYYIGQEQDDSGETRKLIEEAEV
    LSNWSKDYKQLISDYPERVKIAKQFNPLFIPRNYILESVANHYTDEQRNELNDPDAKLDNGPLQKLILMATNPYDKSAWD
    SSFLPELEKKWTNVTEDEDLLMTQCS
    CSS

    >gi|302309985|ref|XP_451806.2| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSSRTETSKTPEFGLSGRKIIYDEDGKPCRSCNTLLDFQFVTGTLKARGSGNSSASPVADSTQSPGSGELAAGAATDISN
    TSADQPLLIPGSKTYSKSGPADVEELGRSSWTLLHTIAAKYPNKPSDTQKQEMKQFMTIFSHVYP
    CGWCAKDFELFIKEN
    APKVDSKDDLGRWICAAHNEVNEKLGKEKFNCDLWKKRWVDGWD

    >gi|50303875|ref|XP_451885.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSKYIAIAREVVSSHKFVQLSAGWCPDCVYSNSIWKKFGVTDKIFNYDIAEVTNSRSEWNEIRDAFQKATGSRNLPTLYV
    DGKVWGTESELARFERNGTLKEELQKIGLVD

    >gi|50304005|ref|XP_451952.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MWPVRLLPYSRTPLTLAPRILNQVPVRAALGVRWQSSSPSSILDTPIRPAKIINEVPDLHFSITNRASKRLAEIYKASKE
    ILRVTVESGG
    CHGFQYNLKLVPESDKKIGNQEQETDDLNDEDDFETVKDIVYVLPDSIGEVVIDEQSLKILNDTTLTYST
    ELIGSTFKITGGSMTSSCGCGSSFGLDQET

    >gi|50304007|ref|XP_451953.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MDVSDVKILILGAGGLGCEIVKTLALYGLPELHIVDMDTIELTNLNRQFLFSTRDIGKPKASVAAEAINRLQIPCKNGVT
    GFVHVVPHNQDLTQFNDDFISQFDIIVSGLDSIEARRWINFKLHDVTVKSNFKTVIPFIDGATEGLMGNCKLIVPGFTSC
    YECSLSTLPQNTETYPL
    CTLASNPRTLAHCIQYASIILWPREFPNRPHDLESPDDLQWLYEKSLHRAEEFNIHHSTLTTR
    YVLGVLKSIIPSVTTTNSIIAGQCCKQAIDLLTDKIDIETCPTFTMYNGEAGATMFSYRHERDASCTVCSVFA

    >gi|50304015|ref|XP_451957.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MFSRFLATKSPLLRPAFRSHLSFQRFISQETKKAIEDAIESAPVVLFMKGTPEFPQCGFSRATINMLGQQGVDPVKFAAY
    NVLEDPELREGIKEISEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLEESDALVPEEED

    >gi|50304433|ref|XP_452166.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MTNIKVDGEEIDESLYSRQLYVLGKEAMLKMQHSNVLIIGLKGLGVEIAKNVVLAGVKSLTLYDPSAVALQDLSTQFFLS
    EQDIGQARDKVSQAKLAELNSYVPVKVLEGLEDVSQLSEFQVVVVTDTISLEEKVKLNEYTHSHGIGFISTETRGLFGNV
    FVDLGEEFTVIDTTGEEPKTGIVSDIESDGTVTMLDDNRHGLEDGNYVKFSEVEGLEKLNDGTPYKVEVLGPFAFKIGSV
    KDLGTYKKGGLFTEVKMPQKLTFKSLRESLATPEFLYSDFAKFETTAQLHLGFQALHQFQVRHQGELPRPFYEEDSNELV
    KLVIDLATQQPEVLGSEGKVDEKLITELANQARGDIPGIVAFFGGLVAQEVLKASSGKFTPIKQYMYFDSIESLPDSEDF
    PRNADTTKPINSRYDNQISVFGLEFQKRIANLKVFLVGSGAIGCEMLKNWALLGLASGPEGKIIVTDNDSIEKSNLNRQF
    LFRPKDVGRNKSEVAADAVSAMNPDLKGKIEPKIDKVGAETENIFNDAFWNQLDFVTNALDNVDARTYVDRRCVFYKKPL
    LESGTLGTKGNTQVVIPNLTESYSSSRDPPEKSIPL
    CTLRSFPNKIDHTIAWAKSLFQGYFSDAAENVNLYLTQPNFVEQ
    TLKQAPDAKGILESISDCLNNRPYNFEDCVKWARLEFEKKFSYDIQQFLYNFPKDATTSTGEPFWSGPKRAPEPLVFNIE
    NPDHFHFIVASANLRAFNYGLKGDDGKPDINYYQSVLSKLIVPEFIPKADIKIQTNDDEPDPNANNQLGGDVLENLAASL
    PDASTLAGFQLIPVEFEKDDDTNHHIEFITAASNNRALNYSIEPADRQKTKFIAGRIIPAIATTTALVTGLVNLELYKVV
    AGKTDIEQYKNGFVNLALPFFGFSEPIASQKGKYNDKTFDKIWDRFDIQGDITLRELIDHFNKEEGLEITMVSYDVSLLY
    ASFFPPKKLKDRMDLPITEVVKLVTKKEILSHVKTMILEFCCEDKEGEDVEVPYVTVHL

    >gi|50304577|ref|XP_452244.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MLFKNTVRFGLAALMAASCSAQGDAVAPEDSAVVKLDADTFHEFIKEHPLVLAEFFAPWCGHCKTLAPEYVKAADELESK
    DIPLAQIDCQENQQFCQEQGIPGYPSLKLFKNGNPEAAGEYQGGRDAKAIVNYMLKQSEPAVQVVEDEKAFNEIIAKNLD
    NTYVVDGSVPEFNETFYQVADSLRDDYSFIQHGSDGKLSIYLPGESEPIVYEGEDFDAETISTWIAVEAFPYFGDVNGET
    YQAYMAVKVPLAYFFYTSPEEREEYESHFVDLAKKFRGKVNFAGLDASKFGRHAENLNQKQQFPLFAIHDTIKDLKYGLP
    QLADEEFAALEKPITLATEEITKFVEDFLEGKAEPIVKSEEIPEIQENSVFKIVGKNHEEIVRDPKKDVLVEYYAPW
    CGH
    CKKLAPTYESMAEFAHENDELKDKVLIAKIDATANDVQSVEIPGFPVLYLWPAGEETEPILFEGPRTAEAFLAFIKENGS
    HGVDGLALYEEYLVEVEKKKQEEEEAQKAKEVEEVAEEDSELEQDEL

    >gi|50304595|ref|XP_452253.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MPSAATIARVQGLINSSKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQDALAEITGQKTVPNIFI
    NGKHIGGNSDLQELNNSGDLDKLLASL

    >gi|50304599|ref|XP_452255.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSHAIVKRKQLETRICNHHRIYCSAFIILLIGIILKVLPLHNCFTLLMLSRSCSRILSLNLSKQFYRTMNSTGKWNPSLT
    SEQLRVLRDKGTERPNTGNYLHNKQTGIYSCANCDLPIYKSETKFDSGCGWPAFYDAIPGSLTFTRDESFGMVRIEICCS
    RCGGHMGHVFEGEGWQKILNLPTDQRH
    CVNSCSLNFKEG

    >gi|50305091|ref|XP_452504.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MLRSAFKGSFPAKVGGFRTFSTVPAKIYQFEDIQKLVAKPDPHKVLVDVREPSEVKEFALPTAINLPLKTAPGALSLDNE
    EFQKVFHIPKPSADKELIFF
    CAAGIRAQAAEELARSYGYEKTGVWPGSINEWLQRTQPKK

    >gi|50305093|ref|XP_452505.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MGIWEKIHVAWKGENTADSQPVTSGDQTNTEPKETHVNEGKNYDFDDIVSLIKTKPDNVILLDVREPEEFAIVQIPGSVN
    MPYKSAPDALAYGDEEFKGKFGFPKPSKDQELVFF
    CAAGRRALGAQSKAVEEGYTNASIYSGSTNDWVAKGGDKLQL

    >gi|50305367|ref|XP_452643.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MTLYKLLTPKAFAELLSKETKRRIIPVDSTWYLPNLNRSGKQEFLDEERLKGAVYFDIDGVKDMKSEYPHMLPDLSTFNK
    SMSELGLKKDDILVVYDRIGNFSAPRCAWTLAVLGHDPVYLLNNFPALKLSGYPVETSKVTSFTPYEMSEYVSDVDLAEK
    ETVSFEDMQKLVSTGDIKNYQVLDARSLQRFTGEAPEPRPGLSSGHIPGVQPLPFLEVLNSDKTFTSDREEMLKKIQDFV
    SQTGNEFETDKPTIAM
    CGTGVTGVIIKTALEISGVKNVRLYDGSWTEWVMKDGEVAKGS

    >gi|50305721|ref|XP_452821.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MRLSTVFATFLVWYMSLVTAISNKRLLELSQKDGNVIKLNSKNYEKILNSPRKSDIVVFFTATATQFSCTLCLEMSPSFD
    VVANSWFSDHANGISKELENHGLFFAKSDFNAESKQLFSQFQLTSVPAFLVFKAGGKSINDVEKITVATELGANHLNFLA
    DNIKNAVQIPDLFVYEPINWGACITTVVTVAIVTFVLVRYTSALLNVLTLRPLWGIACSFCITTLIAGAMFIKIRGSPFS
    GMSADRKSIVYFLEGQLQNQYAIESQIITVLYSVLASSFIGLICVVPYIQKWYQKKQHYGKAAIVNFSLALFFTAVIYIF
    YSALMAVFALKNTGYPFKLFKNPFK

    >gi|50306071|ref|XP_452997.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MGVIDITSQDQFTELTTTKAGDKLLVLYFYTSWAEPCVAVGKVVEALSEERCNKDVVFLSISAEEQVEISELFEVSSVPY
    FIFIKSGTILREMSGADPKEFVAILNQLNASGTDDNESGAANSSADNGAGSNVASSRTENVSNVGPGSPLGEDNEEQEET
    EEQLGERLKKLTQAAPVMLFMKGTPSEPK
    CGFSRQMVGILREHQIRFGFFDILKDENVRQGLKKFSDWPTFPQLYINGEF
    QGGLDIIKESLEEDPEFFQHTLSA

    >gi|50306411|ref|XP_453179.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MMYTRLLYALFLLVELAFGANFYDRDENIMELTPSNFDKVIHRTNYTTLVMFYAPWCGYCQELKGSMKSAGKILSGMVQV
    AGVNCDESVNKQLCAQNRVSGFPTLMVFRPPKINLDNPKKNSNGAASQHATEVYKGERKLKPIVDFALSRVKNYVKRLNR
    YSKFEELLKSSRTRYAVVLISKKEKIPTLYKSVALDWLGIYDFYSIWDEKLQGVSQLSFENDTKNWPNTVKYLQSLEKSE
    TELQSPRIVVIDRETDTYDELDILKTTDKNDIATFLSKFESKPREGPLSKRQEYLKSILNKSKSKKSKTKKNKQKTKLTK
    DDIVQDEL

    >gi|50306531|ref|XP_453239.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSDDFYSYSCETKDGSEYHMSELRGKVVLIVNVASKCGFRGQYGELQELYKEFHAKGFEILAFPCNQFMNQEPGSDEEIG
    KFCQEHYGVSFKIMKKCKVNGVNALPLYKYLKDQQPRMFGFTFVRWNFEKFLIDRSGRVHGRYSTLTKPKSMKEDIEQLL
    KQKSQLQS

    >gi|50307077|ref|XP_453517.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MVKVLQLCFLSAISLVQALNSTVDQKDEAKVDINTVFDNDSTNFCRMDKTEAIGATCDVTFHEINEVNNNIRPQLLSLVQ
    SDFFKYFKLDLYKECPFWSDNNGY
    CVNRACAVDVVEDWDSLPEYWQPEILGNIENATTDITDDECSFLDELCDKPRFEAE
    KDIEYCDTNDFNSQHSVLVDLTANPERFTGYGGEQSSQIWSSIYKENCFSLGDENQCLAKDAFYRLISGLHASIGTHLSN
    EHLNTETGKWEPNLELFMTRVGNFPDRVSNIYFNFAVVAKALWKIRPYMNELGFCNAYNEDVKGMIDGVVSQLNSKVFNE
    DLLFHDEVSGQLKDDFRIRFKNVTKIMDCVQCDRCRLWGKVQTTGYATSLKILFEMDNDDDVARQHVVDKLTKYELIALF
    NTFDRLSKSVEAVNRFEEMYNYQLKSPGEKLASFFQLDNFFKVLNDKFNSANHSSQEKESVSNVEKKVNEFNDLKMPEKK
    KETHTEVREQASGVFKEAWDVEWKNFKQALRFIVTSYTDLPSTVSKYTVLKLNKLWNKFIGVPNYLEEGEELEYPSYNYE
    E

    >gi|50307161|ref|XP_453559.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MLRFNSTRSFSSSALLKTVTKKHDLVVIGGGPGGYVAAIKAAQLGYDVACVEKRGRLGGTCLNVGCIPSKALLNNSHLYH
    QMKTDAKQRGIDINGEININVAQFQKAKDTVVKQLTGGIEMLFKKNGVTYYKGLGAFETDKSVKVLPVEGLEGSVTEDHL
    LESDRIIVATGSEVTPFPGITIDEERIVSSTGALSLKEIPKKLAIIGGGIIGLEMGSVYSRLGSKVTVIEFQPQIGATMD
    GEVAQTTQKILKKQGLDFKLSTKVLSASRNGDVVDIEVEGAKNGKKESLQADVLLVAVGRRPYVAGLNAEKIGLEVDKRG
    RLVIDEQLSTKFPHVKVIGDVTFGPMLAHKAEEEGIAAAEYFKVGHGHVNYGNIPAVMYSHPEVAWVGKTEEQLKEAGIQ
    YKIGKFPFIANSRAKTNMDTEGFVKILIDAESERLLGAHIIGPNAGEMIAEAGLALEYGASAEDIARVCHAHPTLSEAFK
    EANLAAYAKPINF

    >gi|50307417|ref|XP_453687.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MVSHLWLLQYLILSIPLVLGAPPRANPNQGNAADPESKLPSPLTEANFDETIAKNLHIIEFFSPYCHHCKQLAPIWEKTY
    NGFYDESLQLNISLHQVDCIESGDLCMKEGINSYPTIRLYGPEGFIKAFPRGLERTETTLLNFARKEALDADNLDITKLS
    SKSKLLNDGELLKILSEPQTEPYFVSFWPTSDFEDIESSYQFKNCEDCSLFQRIWKLVSNKADSIGINTVHFNCVNPTDS
    SKNEAICRELSFDTLTQKRNSRLERAPEFALILPNRKSGSFIKFPFGPKRVDSESLIDFATRTLHNSNVPNIDQDEIEAF
    VKEPKSDILEANAEADKILLVFNYNPETVVPEDMQFLEQLIDPLGYIPNIYLYKNTDDLKKLSHTLYQTLYKDYNTDQRT
    EINEDHFITTSITQSPTFFIFKKSTFTPIIFPGYSTTETRNLDFILDWLTINSLPTVTEITSKNFEALKGFEQDFYDKLV
    IQLVNKKNNKFEEGSKKIVEGLRVAAHSYEILRNEAVYEGLKTAREEKKKLVQKLKNKNAPSVDIVTAMRKEINYSYNHK
    VIFAYLDINESPSLLNNKGLNVYFRKFKTGDIIVVDKQKAIYYEKDASGQYITLETLPEVLSILNFPARHPDLRIERIFL
    RTPLSGLLRLIDYLREFSGINYLFVVVTFLALWKIPRTIHHYKLKRRYAAKRDTHGILGKEAKLMD

    >gi|50307441|ref|XP_453699.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MVELRRSNRISAKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEV
    ASKNKLVVFFAYPKASTPG
    CTRQACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKK
    TAVSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL

    >gi|50307753|ref|XP_453870.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MAVPKENITTAHPLTAEITTKDEDDKSLDSLLEQLDEEESEFLSQYRDQRLEELSEHMKKIEKNVESGDYGSVQTFLDEQ
    RLIQVTASAERCVVHFFVDSFRK
    CQVMDSKLQVMAESHLSTRFFRISVADCPFLVEKLSLKVLPVVIAYQNGKEQDRLIG
    FAKLGNNANDFSIDHLEKWLQRSGVVPMRDTKLTIISNRSKQIRSKNKTNSDQEDSGSDWD

    >gi|50308053|ref|XP_454027.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSHLLVYDFMEHDLANVLIVVKPSTKSLVFVSLSGTKPKLLGDAKKFVSKVNSLSKNKGSIYTLKNKSILKSDDVAWLEQ
    LSFDFLQILAGGIDSQTNIKCEYLLGTEFQKKVWETTKTIKAGATISYQQLAVLLGNPKAVRAIGSALAKNNIAVVIP
    CH
    RIIGSKGKLTGFRWGIELKESLLRQEQAI

    >gi|50308169|ref|XP_454085.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MARETNLVKCIGKESFEKLRDMKVLLVGAGGIGCELLKDLILLEIGEIHIVDLDTIDLSNLNRQFLFRKRDIKQPKSNTA
    MKAVQRFSNSKLVSYQNNIMDTEKFPLSWFDQFSIIYNALDNLAARRYVNKMCQFTNKPLIESGTSGFDGYIQPIFPSVT
    ECFDCTTKETPTTFPV
    CTIRSTPSQPIHCVVWAKNFLFGQLFAESSEETVNDQDLGTDDKEEIARIKEETNELHALQQLV
    KSGDETKITDILKKLFVDDINKLLKIENLWKTRVKPTPLGALLPSDNIPTDLAQVWTLQENVDKFIEVTKTLMLRLRQEP
    FIEFDKDDDDTLLFVACAANIRSYIFHIAPKSVFDIKQMAGNIIPAIATTNAIIAGLSSLVSLRVLNLLSNVSNNPLEIP
    MAFTARASNITTNRYLSNPTLAPKNPHCSVSSNIQRAVLKIPKAIVEHMSLYDLNQKIISKYEFTGEYSVLDTNTNSLLY
    DFDFDDLECRKLSRFNFRTGTFLLYKDEEMEDGAQLRQSIEFYLEFVPENSGEDLQLPNLPRDTYTYHSPYENAEDEQTA
    VDADQDRTEDHIQAIETLIVDDEPAEDERNNLKRHLSNSIPSPPTKTPKLNASQSDEDDLILLD

    >gi|50308445|ref|XP_454224.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSIKLKVGLHKQRIVTITTLLMIGLLWFTFSNSQLPIEGSPSLGGTKSDLFGGLSANAKNDDASGTIMPKMPDQEAKKAL
    GRASWKYFHTLLARFPDEPTEQEKTKLREFLYLYAELYP
    CGECSYHFVKMLKKYPPQVASRTTAALWGCHIHNLVNDHLE
    KPRYDCNTILEDYDCGCTDENGNIDPSLKMNKVTLNKEEKQLG

    >gi|50309357|ref|XP_454686.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MVAQLTSASEFEKALTDDKLVVVDFFATWCGPCKMIAPMLEKFAKEYEGKATFLKVDVDELPDVAKNNDVSAMPTLVFFK
    SGKEISRVLGANLAAIKQTIAANV

    >gi|50309483|ref|XP_454750.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAG
    PNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSY
    CPFSTRLKNLLKEYEFDPIYTIVELDKHENGAELQKYIGSKT
    GRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKKAAAAT

    >gi|50309715|ref|XP_454869.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MMFQRALLQTKSSVLRQQPLRTSVRFIRTFKQEDQPRLRINSVAPNFTADTTAGKVNFHEYIGNSWAVLFSHPADFTPVC
    TTELGAFAKLKPEFDQRNVKLIGLSAEGIESHQKWIKDIEEVSQLDKFTFPIIADVDREVSFLYDMVDEEGFKNLNNGIV
    ATIRSVYIIDPSKKIRLIITYPASVGRNSSEVLRVIDALQKGDSKGVVTPIDWQPGQDVIIPPTVSDADASKKFGDFKTI
    KPYLRFTKA

    >gi|50309807|ref|XP_454917.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MTETERSNESLLEEIENLRVENAKLKNDLCLERSLNNASDLPMSLDEFKRYGRQMIVDETEGLMGQLKLKNASVLVIGAG
    GLGCPSLPYLAGAGIGKIGIVDNDTVDTSNLHRQVLHDTIKVGMLKSESAKQVLNKLNPHVSVTSYPVRLSNENAFDIFK
    DYDVILDCTDTPMARYLISDVAVNLGKPVVSASALRTEGQLSIFNFDNVGPCYRCFYPTPPAPTSVSS
    CQEGGVLGPCVG
    LVGVAMVVEALKLLLGVYTRENFKPFLLQYSGFPDQTLRKFKMRGRRVDCPACGTGRTVTRESIESGKINYQSFCGSRNY
    SVLTEDERIDVHKFERDYWNSSKTKPYVLLDVRPSLHYSISHLPNSHNITVNELRDLPADLNNLQSKIPHLSADSEVLVL
    CRYGNDSQLATRLLKDKFNLKDVKDVKGGFFKYIDEINPSLPKY

    >gi|50309829|ref|XP_454928.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MLLVRNSTLGRLSSLRGFFRNINESNIFYRMVHHKVTIIGSGPAAHTAAIYLARAEIKPTLYEGFMANGIAAGGQLTTTT
    EIENFPGFPDGLTGSELMDRMKAQSIKFGTDVITETVSKVDLSSRPFKFWTEFNEDQEPETTDAIILSTGASAKRLHLPG
    EETYWQQGISA
    CAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVYMLVRKDHLRASQIMQRRAEQNEKIEILYN
    HVTLEAKGDGKYLNALKVKNVKTNEEYDLPVNGLFYAIGHTPATNIVAGQVDLDEAGYVKTVPGSTLTNVPGVFAAGDVQ
    DARYRQAITSAGSGCMAALDAEKYITELE

    >gi|50310045|ref|XP_455036.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSIRNTINRIIIRRNMSDSIRHYDYLVIGGGSGGVASSRRAASYGAKTLLIEAKAMGGTCVNKGCVPKKVMWYASDLATR
    IGHAHSYNLFEDLPLTKENLTFNWPEFKKKRDAYIHRLNGIYERNLTKEGVDYVYGWASFTVDGKVQVKKADNCTETYTA
    DHILVATGGKPIYPAKIPGYDYGVSSDEFFELEDQPKKVVVVGAGYIGVEIAGVFNGLGSDSHLVIRGETVLRKFDDCIQ
    ETVTDTYIKEGVNIHKSSNVTKVEKDESTGKLNIQLDTGKNIDNVDSLIWTIGRRSLLGLGLENIGVKLDAKEQIVVDEY
    QNSSVKNVYSLGDVVGKVELTPVAIAAGRKLSNRLFGPEKFKNQKQDYENVPSVVFSHPEAGSIGLSEREAIEKFGKDNV
    KVYNSKFNAMYYAMMEEKDKTPTRYKLVCTGEEEKVVGLHIIGDSSAEILQGFGVAIKMGATKADFDSCVAIHPTSAEEL
    VTLT

    >gi|50310727|ref|XP_455385.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSKFYELAPKDKKGEPFPFTQLEGKVVLIVNVASKCGFTPQYKELEALYKKYEDKGFIVLGFPCNQFGHQEPGTDEEISQ
    FCQLNYGVSFPILKKVDVNGSEADPVYDFLKNEKSGLLGFKGIKWNFEKFLVDKKGTVVERYSSLTKPSSLEEPIEKLLN
    E

    >gi|50310791|ref|XP_455418.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MADTQALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDECGFDGSLISEEPLDYD
    VTTTEQISGILLVSGMT
    CGACVKTVTGQVLKLSGVLECDVSLVTEECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSS
    SVPSNEKRLCLKIFGMLSESDRADIESKVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNTLDN
    STQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPFVQTPIIGLFYRDIIGIIITTYVQIYVGSYF
    YKAAWISLKHGSGTMDTLIGLSTVCAYIFSCYSIISSIYHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSK
    LISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQVIGGSVNG
    PGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGK
    FFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNS
    DVSDLHWKMISLCESIGEHPVAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDE
    SLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTP
    EQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFY
    RVKLNFFWAVCYNTFMIPIAMGLLAPWGITLHPMLSSAAMALSSVSVVCSSLMLKRWTPPSLNIKSMEASGGLSWLRFGR
    NSNRGDDIELQERLM

    >gi|50311055|ref|XP_455551.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MISRTALRTATASRATFVRPLAFSQVRFQSTAGGNTIKHLTNLHEFEVAMKADNLSLVDFFATWCGPCKAVAPHVQKLSE
    KYNNVKFYKVDVDESPDIAGALGISSMPTFVLFKNGKGLGKVVGADPRGVEEAIKHFNK

    >gi|50311463|ref|XP_455756.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSKEINDLVIIGGSYAGMSAALQLVRARRKVVIIDEGIRRNRFAKESHGFLGSDGASPNEIAATARGQLLKYPTLQWIDG
    RAISVEGTKDNFVITTADKQEYRASRILLATGIQDCLSDIEGLEERWGKSVFH
    CPYCHGYELNQGNIAVIATSPMSIHQG
    LLLPEWGTITFYTNGTKFGDDMLNALESKSMNVVHGIVQKIENEADVILEDGSKESFTGIFVSTTVKPTADELINHLGCD
    MLTNPLGSIVKTDEKKQSSKPGVYACGDVGVFPSTVALAVGDGTLAGFNIHRCLLGM

    >gi|50311733|ref|XP_455894.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MQRHILSRSNQCLLRGNVLAVRHLSQRPLARTKRFLQTSQNGDKVNAPVWPFNFEIPVKNGKSSAPGTQEEASGSGTAGA
    KKTWLTYSLPKNVAKKGEPLQTQPPKVDENIQPKKRAKRKLRPRKALISLTPNALSHLKGLLDQPEPKLIRIGVKNRG
    CS
    GLTYDLQYITSPGKFDEVVEQDGVKVIIDSKALFSIVGSEMDWVDDKLSSRFVFKNPNSKGTCGCGESFMV

    >gi|50311895|ref|XP_455979.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MSSDTLPNTRFQYIRIIPSQEGTEACSAPVETSFTEYKGTVVITGAPAAFSPTCSVSHIPGYVQKLNQLVDAGASQVFVV
    TADNPFANQQWAKTLGVKDTDKIKFITDAGAKFSQSLGFALPIESGVFWASRYLVIAKDGKIVYQAVEENPATDVTVSSV
    DNALEQLNKIK

    >gi|50306697|ref|XP_453322.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
    MPFPKVSIVFCTKCKWNLRSAWYVQELLQTFGSELKEISLIPGEPGEFKVLGYQTEGSQPIVIWDRVVDDGFPDSKYLKQ
    RVKALIFNDEVAIGAHIDRKSKSSSAKETLVSEKINQCSTDDQNTSCKDCET