Hydra magnipapillata

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|221115584|ref|XP_002165252.1| PREDICTED: similar to Thioredoxin, mitochondrial [Hydra magnipapillata]
    MDGSSSLTEIGPVKLKTMMLSVFRRIVVNSSYKYTPRLQRLLSFDIKTPEDFNDKVVQSKVPVLVDFHASWCGPCKQLAP
    VLASVVDSFEGKLNLAKVDVDQHEDLAMEYEVTAVPAVFAIKNGEVIDKFTGYKDKQQVLLFAKKLTE

    >gi|221123923|ref|XP_002161497.1| PREDICTED: similar to prostaglandin E synthase 2 [Hydra magnipapillata]
    MWKSIIKHPLMLKSISKLSSKKIAEKSISFVSGFAFSAYITSSVVYSKNELPNNVFQPLINKRILYQYSTCPFCCKVRAF
    LDYYDLNYDIIEVNPFSRKEIKFSEYDKVPILKVDNHQLTLRPRHTIGGVHWRNEVKWRKWVDDVFIHTLSPNIYRTMKE
    SFQSLDYITHVGNFGPIERTVAYYSGAVAMYIIGKRIKKRYHLKDDVRASMYEEAQNWTKAVGENKYLGGSHPNLADLNM
    YGVISAIEGLDAFHDLMANTEIQPWYNRMKQQVKSHAGANLIKNQQNKNH

    >gi|221132858|ref|XP_002156829.1| PREDICTED: similar to J1A crystallin [Hydra magnipapillata]
    MAKSIESLIKIIRELPDISQRKVCALIGATVGDAACRPLHWIYNQETLDNILGDEKTPEFWPESKSPFYTIPLGHRSCYN
    EEALTTMAAITKNEGVIDIKKICENFKINFGAGTEYDAALKRRKAQYDPANRNAFPGAVEGPWIHGAVIKFLENYELYAE
    CFSGDSEGNDLDAFCAALPIVVKLSDKDNMWEKSLEVVRLFSTHSDSLKFVEASACLVQAFIQGVNDPIAEAKKNIHADV
    LEHMLEVEANLDKPFIPTVAKFGKA
    CSLPGSFKGAYLCLLSTGSFVDAIRLNITAGGCNCSRGNLIGAAFGAKFGIDGIP
    VEWLNKVDNIENIVQQAIAISS

    >gi|221120954|ref|XP_002163913.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MAMAVRVVILSFMFGSALAVMELNDNNFFEYAKRKEVLLVDFYTPWCSDCKRLAPEFEGAAAQLQDRSADLVKVDCEGAG
    KGLCQMYQIRSWPQLKNFHYGTYTGDYTGPQSAEAIASYINTVEQSSSNFVPGYYPNVGYAMAPKDSLVEPAPPVVGALS
    CARCNIGKGTKCTKVVKKACVELQLREKAKKEEAKQNDDDKKRSVLVKKADNKKKSNN

    >gi|221128777|ref|XP_002159593.1| PREDICTED: similar to ERO1-like protein beta [Hydra magnipapillata]
    MKIIIYMLFIIQIILFTTCHGAKKSKSGIETTEYSWYHSKYKDADSCLCQLTGKLEDCCCTIEDVEAINSNHIYSKLVDI
    ISHNYFRYIKLNLHRGCPFWQDWGK
    CAIKNCKVDTCSDEELPPGLKDVHNICSKENKYGKDSQNSKDTCFKDFSNVASNS
    EELCSVGKEKTLGDIDKTISDQQKEHFKGWSNYDADTSFCVDLEDDVDNSSWIDLTINPERYTGYQGKDANRIWMSIYKE
    NCFLPENSPRNYEEFKAKFLSKTCIEKRVFYRTVSGLHASISIHLSYKYLLQKKSLLENEVWGPNIKEFKKRFDAAHTNG
    NGPHWLKNVFFTYSVVLRAVIKATPYWKEAVFYTGNSTSDLKLKEQILDFINSTRACPSTFDESVMFTGDPEQAAKLKEE
    FRLHYKNITRIMDCVGCERCRLWGKLQTTGIGTALKILFSSSKWDVVPVINGKKFSLTRTETVSLFQVLSKLSASVQIIS
    EFKNHDK

    >gi|221104741|ref|XP_002165809.1| PREDICTED: similar to chloride intracellular channel 1 [Hydra magnipapillata]
    MPSVTIYVKANAKDGKGIGDCPFSHRILMIMKLKAIAGEYVPVHMTPVSPIFKDFCLNAGIPVKVPVFKHDEYVVYNVND
    ITYYIDKEWPEPNLKSTNALANTVADHLFTRFAGYIRNKDPNLDEKLQASLLEELKKINNFLGSSNSPGKYLDGDTLKHP
    DCDILPKLQIVKVALKKYKNFDIPEDLVDLHKYMKDAAEEPAFKSTCPTDEAIIEGWKKHFS

    >gi|221116397|ref|XP_002165708.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    CELLKNLVLSGFTNIHIIDLDTIDVSNLNRQFLFQRKHVGKSKACIAKESVLSLKPNLNIIALHDTIINSEYNVDFFQKF
    DFVLNALDNKVARNHVNRMCLAADVPLIESGSAGYLGQVTLIKKGFTECYECQPKPSNKTYPG
    CTIRNTPSEPVHCIVWA
    KHLFNQLFGEYDEEAEVSPDTADPELSGEAGEQALACDDVTAARVSTREWAKGIDFNPEKLFTKFFFNDIKYLLSMEKLW
    QKRQPPTPLSWSSIEMEEEKTQSYNVLLDKRIWSIYECRKIFQECVEKLRERVIEQGNVSELVWDKDDVVSMDFVAAAAN
    IRSFIFHIPVKSRFDIKAISGNIIPAIASTNAIIAGLMVIEVLKLLSGRLYDCRTIFLNKQVKVKKQLLVPCLLEAPNPK
    CYICAKKPEVTIFLNLQTVTVKQLEDKILKDKLCMVAPDVEIDDGKGTILISSEEGETEENWDKVLLDFKISDGTRLKCD
    DFLQNFEIAITLRDKKDINVDQLFFLEGEIPVPKDEKSEDRTLENGSGAKKRKLSLEDENNSAIKKSKVELEIDSDIVIL


    >gi|221101723|ref|XP_002155792.1| PREDICTED: similar to sulfhydryl oxidase [Hydra magnipapillata]
    MAHIAEEILSCRLLFYFVFTYFCYIGLPPVLTTDTGLYKDTDPMVQFTNDTIKKYLTGNDKVWIVEFYSSWCGHCQAFAP
    TWIRLALQLKNWNSFVNVGVIDCAAERNYKTCKDFEIDSYPTIRFFPVNWQEKPDKNAHGHTYKDTKDVESMRNGLMDYM
    EKQKGGVFRRNELPFRFFNGGDVQNYLYKKDFIPYRYLALLFDSTDSYLGKTLALDTMKSKKVVLKRASNDELKSKYNVV
    TIPSLILITISTGKFKELSPMNRTHSAYLNVLNQLAGGDVINALEDLHPPLVIDEKALQVVANISSEVHMQDITSAISFS
    LLREVGKINIINGDAMVALKDWVNLLAKCLPSGSFLQNFLRKLDKWLHDLGNEISSEKFVKYIEENQESNSYLPSEIKWH
    GCKGSAEKYRGFPCGLWTLFHSLTVSCSDDSGMTGYEILRRIRSFIDHYFG
    CRYCRDHFIEMSKDLQKEVKTQEEAIVWL
    WSRHNRVNARLERDISSDPFHRKVQFPPKSLCASCHNPISTKDTLIFSPTVVENNAKWSRKFVLEFLKDHYNLNKIQIKD
    NKKIIDGETQDSDAVRNRFTYKFYSRTASPPFSLLGMSRVDLSMCVVLYGSIIGAVFGLYVYFIRRKKQKTYKSYV

    >gi|221127402|ref|XP_002157624.1| PREDICTED: similar to AGAP001737-PA, partial [Hydra magnipapillata]
    MATSYIVFSICQVLIKKSKVLIVGVGGLGCPAAQYLVGAGIGTIGLVDYDAVELSNLHRQILHRETNIGMSKVQSAISEL
    KRLNSSTCFNEHIVSLSATNAFSIIDEYDIILDCTDNVATRYLLNDACVLYGKPLISGSALRFEGQLTVYNFQGGPCYRC
    LFPVPPPADAVAN
    CSDSGVLGAVTGVIGSLQALEAVKLICCQSTSYNGSMLLFDGFRGIFRNIKLRGKKDICSVCGKNPT
    ITHLVDQEHFCGSVYTDKALSLSILPDAKRITVE

    >gi|221117850|ref|XP_002154390.1| PREDICTED: similar to MGC81848 protein [Hydra magnipapillata]
    MPPINNFVESLIKDNKIMVFSKSYCPYCNKVKDLFSKLGYEYKAYELDLEANGPEIEQILFQKTNQETVPNIFIREKHIG
    GCSDTEKAYQNGSLQKLWQGDAVKYDFDLFVIGGGSGGLACSKEAADLGAKVAVADFVVPSPAGSTWGLGGT
    CVNVGCIP
    KKLMHQAALLGEAIHDSRHYGWNIEENISHDWAKMVDAIQQHIRSLNWGYKVNLRQKNVKYYNMYATFLDNHTLQLTDKS
    GKVETVTADKFVLATGGRPTYPDIPGAKE
    CAITSDDIFSLPYVPGKVLFCGASYIALECAGFTHGIGMDTTVMMRSIPLR
    GFDQFMANKVVDYMETIGIKFLKKYTPIKMEKVEEGTPGKIKVTYMNHNTNEEESDIFNTVVVAIGRSPCTKGLGLENLG
    VKLNPLNGFLISDEYDRTNIENIYGIGDILDGKPELTPVAIQAGKLLAKRLFNGSKVTCDYTNVATTVFTPLEYGACGLS
    EETAIEKYGEDNIEVYHSNFTPLEATVPHRLDNVCYAKVICNKKDEERILGMHVLGPNAGEIIQGFSIAFKVGAKKQHLD
    DLIGIHPTNAEIFTTLEKTKRSGDDPSVTGC

    >gi|221130433|ref|XP_002155106.1| PREDICTED: similar to thioredoxin domain containing 11 [Hydra magnipapillata]
    MDCVMTCAMKCSYYTVPNFKSIYYTSKVIIMASSCIVCLVSLGWWLWLYSSFLISYKWKVDGLFPLNSSVIDIKDGSMHK
    LFKIVRNKPINMVIFYTPWSGASIASVKELNAASQFLTSPTVGFISINCWEGTCRKIFTSFYFPRIFLYHTSIPPIEYLF
    EIDFFNIIDFIQSAVRPWLYIGNEQQLTRFLNSDNHVISFMDKSFIQNGNRYTTFFRASVRLINRVNKPKIGLITDPELA
    ALAELNFHGQICSSGFLRNRKVVSELTPNATDASHYLDLLKQTPIALLAYSNGNLSAQKHHLKNYNKHIKSWKCGSAAPC
    CNFKNSSSLAKSFRGLACNTNRTLSFYTMNYDKYKFILNNVGIHHTPSLLILDVLLEESFVSTNLSYNVIVDSIMNFTNG
    RLQQDFKSLDPEKEKLLQSGRVTELFSDSFEKFILQSTKNVFVMFYAAW
    CAICKTVNLQFLKLAHTYKRSDIVFARIDGD
    KNPLPWHYTSSRYPSFILFPQHRKADSIHYGDDLDFSSQNFVMFLEKYLN

    >gi|221105335|ref|XP_002170025.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    YTPTNSRYDGQIVVFGSDYMNLLHSKNIFVVGAGAIGCEHIKNFSMMGVNKIIITDMDHIEKSNLNRQFLFRHSDINQPK
    SMTAAKKGKKINCDVDIIAHKNKVCDETNNIYNSDFFKSIDIVANALDNVESRVFVDSLCIKYRKPLLECGTQGTKGSIQ
    TIIPDLTESYGSFSDQPEQTVAT
    CTLKMFPYKYEHVVQYAIDSFEGLFNRVPSNYIKAKNPENLKTLSPSEISEILNDVT
    IIANNSNNFKCCVNFAYKQWHNVFRDPVVQIVKKYPENYVDEDGNRFWSRNKMFPTIHEFDIRNNSHIEFVIAFAHIWAD
    VLNIPKENKLNVSIINFEKDDDHNHHIDFITAFSNIRSQFYNIEPKNRLETKRIAGKIIPAIATTTSVVSGFVALELYKT
    IYGQLNKTYNTIQKYRYGSFNLAVQLFSFGESYPAKLTNIDGKLYSIWTQINVDPDKTLGELLNEWNSVLLIEKNTQTQM
    SIDFIFDGDKIIYSKFDELSDNYDSQSIRDLIIKYNPEAKHDHYLSISLGSDAGIDNDCEYDHDIDNNYYDNPKINSGV

    >gi|221112332|ref|XP_002157176.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MPSTTTTAANSTTTIATTLTTTTTTPTTTTTTSTTTKTTPITTTTTPSTTTTTPTTKTTTPTTTTTTTTTTTTITTTPVV
    DYVDLITPEELLIKLQSSEIPLIDVREPWEIKLEGRIAHSVNIPVSQIDKALKLSPEEFRFAYHYEKPLQND
    CRIVFHCK
    SGVRSAHALSIAKQNGYKCAKSLKGGFTAWKALYP

    >gi|221124728|ref|XP_002159952.1| PREDICTED: similar to thioredoxin domain containing like [Hydra magnipapillata]
    MATVSVSDSNRTRIHHQKISGAGELEIATLSLDEPELENDIGSNVEKIEKKLVLFYMHKEACKPCKKLSDSLESSKEFVE
    LSSKFVLASAVDTELPKDKKYDLDGKYVPKIVFLNNGVVLSDIVNEDAKSNKAKYFYKKAEHVVKSMNKALEKGELHNGF
    GTDYVWYDWESGLKASKEHSKPILAVFHQDW
    CSACQRLKPKFAESEEIKQLAGEFIMINTDSEEVVKAEKYKADGEYYPK
    VIFLDEEGEHYKGEWNHGTKHPHVLHYYDSGVEIAASMSRILANRSELNKIEDHGFGKHLRFVKYEEGKKMAKEQGKPMM
    LIIHKSY
    CGACQALKPKVRSDPEIAELSTHFIMVNCNDDEEPNEDQFDLDGAYIPRIFFLDNLGKVEPSIFNDDKEYIKA
    KYAYGSTAGIVKSMRRALEMNLGKREQPGKKGFGTNINWMGYEEGLIQAKKMHKAIMLVMYNDY
    CEFSSFMMKQFRESNE
    IAEVAKKFVMINVGEEEGKALGEKFDVDGTYTPRIFFMDPDQNLRTDINNTDSPYKLTLFYYGKTEDILNAMNLALEKIN
    LTLGRGFGEYIEWKRFENALEHSKESKMPIMLIIHKSW
    CGACSALKPKIANSRPIWKLSYYFNMVNVEDEEEPLDNQFFI
    DGGYYPRIFFLDYTGKVHHDLHNRDPAFLKYKFSYQEEEQIINSMRFAIAKLSTYALPTEDQKVITEGSSIDTTNLTMGK
    RILVEGGLTSVTIDEALEMSKKTKKPIMFIIHRTT
    CPSCKAVLKMITRDEEFKGKLEHFILADIEDDIDDVKADSYDVDG
    GYVPRIYFLDPQGKIFKDIWNLGTNYMDNKFYYYEMISINRAMDKTLKKMETWEPSLEEAGSQATKNQNEKKDEL

    >gi|221113970|ref|XP_002165192.1| PREDICTED: similar to DEHA2D14190p [Hydra magnipapillata]
    MSNNNCVEKDVEIKEAVCNMYGNVAEANTAGKSYGNVASCCGAPAETDIDYSLQLGYSKEEATSVPTGANMGLGCGNPTA
    IANLKVGDFVLDLGSGGGFDCFLAAKKVGSSGHVIGIDMTPAMISKSRLNAKKGGYSNVEFRLGEIEYLPVANATIDVVI
    SNCVVNLSTDKLRVFQEVARVLKPGGRLVISDTVATNPLPDEIKNDLALYAG
    CIAGAMSIEEIKNALIKTGFENISIQIN
    KSSCTFLEKWTNNECDAENYIASAIIEATKPK

    >gi|221101506|ref|XP_002169239.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    MSNAIIKKRLDSYYKHASFGPIESMVSWCLWPCLALYPIYISFQLSKKFEHHLVDGCLDTGWFSLRRDVTDYEWTDFRDN
    STLIVVVNLLYSILGRFVALNFPKVKKFYYSVAGAFLVLIIVSFQGFLLLSAKSGVVYISVLMTILRIISYGTEKNLETF
    SFTFTDFLSYMFYIPLFFRGPLLTFDLFVKDFNQPLLQSTVVTLKEFVIGFLRCVTIGFVIDIYYHYSLVNALSSHHHVL
    QKLNEIEAVAVGWSLIIMFYVKYKVFYGIAYVFTKIDQIESPSPPRCICTLYTFVDMWRYFDQVNEETPLILSDIKSYNG
    DNEFCNVQTIKLRIQNIC
    CGKEAVVIKEKLINLNGIKSVNVNIVSRLAYVTHDASVIQSSVILKILNDLQLGASLLESGT
    LDHQENKFFKTFLFQWFNLIIMTSLFIAVVVTSFKKPLYTKWISIPLLTIGGLPMLHMLFLNLRRKVFANINLLMLIAII
    GAVVLYEWLDACIIVYVFIIAELIERICKYKVEKSIAALMVKRPNVAVLAENNKTVPIEQVQIGSLIIVCAGEQIPLDGE
    VVSGKAAVDESTITGESVPVKKVVSSKVFSGTILQTGFLKIKTVCDYNSSTLFQISQLTELALAKESHTVKLMNKFAQYY
    IPIILFGSFLCFMIPYIIHKVKLQTVTVAVSLTDIAVVDSPSIISNTGIHLWGVRALTILVAGCPCSLVMATPLAIVSGI
    TTAAKNGLLIK

    >gi|221113972|ref|XP_002165224.1| PREDICTED: similar to DEHA2D14190p [Hydra magnipapillata]
    MSTNNCVEKDVEIKEAVRYIYGNVAEANTAGKSYGNVASCCGAPAETDIDYSLQLGYSKEEATSVPTGANMGLGCGNPTA
    IANLKVGDFVLDLGSGGGFDCFLAAKKVGSSGHVIGIDMTPAMISKSRLNAKKGGYSNVEFRLGEIEYLPVANATIDVVI
    SNCVVNLSTDKLRVFQEVARVLKSGGRIVISDIVAINPIPNEIKNNLALYAG
    CIAGAMSIEELKDALEKTGFENISIQIN
    KLSCTFLEKWIVEGCDAESCIASAVIEASQPK

    >gi|221113465|ref|XP_002160266.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    MNLLWIFEISLVLCIEINEENIQDHLKKEKFSLVLFFAPWLKSCEKVVGVISEVEVYFRNRDDIFIGKIDTYKSLKLASH
    FRIDDYCSLKYFVKGSKVAESYEDTISKELVIKFVETKSSYQGVTDLYKEPLIELNLDNFDRIVKNENKFVIVYFYTSW
    C
    KK
    CTLLSKTIRQVAQVFQNDKDCVIAQLDGEKWFNITVKEKIGVYPTFVFYSKTEKDGKLYYPGKFDENWTNYNITKFLN
    INCGLRKVIDEAEDEK

    >gi|221120247|ref|XP_002155316.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MFSLVCLIVVIFTFSNTLAEYTLTLTKENFDSHVLDSRKNVLVEFYAPWCGHCKNLAPTYEKVAETFKNEPNCVVAKVDA
    DSEKELGSRFGISGFPTIKFFSKTNKAGEEYSSGRSEQDFIDFLNQKCGTNRVSGGGVDDQAGRINAYDDIAKKFISSTG
    DRNSLIAEIETANADEADSEHKQSGDYYVKVMKTILEKGDDYPKNEIARLTRVLGGNMSAAKMDLMHKRKNILSQFVREK
    EEL

    >gi|221104335|ref|XP_002155733.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MSETIIDGKLKDRSVAELIGFGMTAIICCSGTQQVVLGQWAILFSHPADFTPVCTTELSQAEQLAHEFNKRGVKMIALSC
    DSVESHNNWICDIKKYTNGSFSYPIIADPKREIAVSLGMLDPDEKDKQGMPLTCRAVFVIGPDKKLKLSILYPATTGRNF
    NEILRAIDSLHLTVAKKVATPVNWVFGDEAMVIPTIKPEEVSTYFPNGIRQDEVPSGKGYMRFTTDY

    >gi|221116729|ref|XP_002162000.1| PREDICTED: similar to glutaredoxin 5 [Hydra magnipapillata]
    MFFNVMRPLSAKLMQQAVSLPYFNGCITGVIHQKQIFAHINHNKCFSSGIDWSDNKFKEIVNNNKLVVFMKGTPDAPKCG
    FSKYVIQILNMHGCENFKSFNVLEDETLRSRVKEFSNWPTIPQVYINGEFIGGFDILLQMHQSGELINELDKIGHHSALI
    SNEPKKE

    >gi|221105138|ref|XP_002167454.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    RSSSGSGKSGNAKDVITLTDDNFEKEVIDTKDIVFVEFFAPWCGHCQRLEPEWAKAATELKGKVKLAALDATQYPNTAGR
    FNVQGYPTIKYFPAGAKDFNSAEDYQGGRTASDIIAFALDLHSANVDPPEIQQLTSDSVLKDNCNEKPLCVISFLPDILD
    TQAAGRNAYLDLLRELGEKYKKKLWGWVWTSAGVHPKLEKTLEVGGFGYPAMAVVNIKKKIFVLLRSGFGREGIDELLKG
    IAVGRGRTQKLEDGLPTLSDAPAWDGKDGELPVEEEDIDLSDVVLDDEPEKKTEL

    >gi|221110520|ref|XP_002165519.1| PREDICTED: similar to thioredoxin; wb-Thioredoxin [Hydra magnipapillata]
    MDFLSGVTLFKADGSSGLADNILSEKDFVLYYFSAHWCPPCRQFTPVLKEFYEVVKDSGVEVIFISSDRSHEDMISYMKE
    AHGDWYCLEYGSALVTKLKEKFGIRGIPTLIVCRKDGSLVTSNGRNHVSEKEPSAAVADWRK

    >gi|221117353|ref|XP_002160130.1| PREDICTED: similar to glutaredoxin 2 [Hydra magnipapillata]
    MGNTSSQVSVESIDNKIKNDCVVLFSTTICGYCDKAKELLNTMNIKYKCIELDKMEPPEGGKLTFELMKKTNCRTVPQIF
    INGSFIGGYTELLDLQRVGLLFEKLSKCSKPCF

    >gi|221103963|ref|XP_002158424.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    MAANGNVKIVSNDLSFLSEIQNAGSKLVIIDFHATWCGPCKNIAPVFVQESLKYPNSVFLKVDVDVCTETAHKYGINAMP
    TFVFVLQGKKIDELRGADPKALIAKIKQHSGDSIGTGSNSAGESEVPGHSDLISYITASGCNCLNESDEHTHANIFKKDN
    TYLESDCDDQLLLSITFNQAMKVHSLKIDAPADGRGPKFVKLFVNQPSAIGFDQAE

    >gi|221132956|ref|XP_002162588.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MFFNVMRPLSAKLMQQAVSLPYFNGCITGVIHQKQIFAHINHNKCFSSGIDWSDNKFKEIVNNNKLVVFMKGTPDAPKCG
    FSKYVIQILNMHGCENFKSFNVLEDETLRSRVKEFSNWPTIPQVYINGEFIGGFDILLQMHQSGELINELDKIGHHSALI
    SNEPKKE

    >gi|221115690|ref|XP_002155514.1| PREDICTED: similar to GK25017 [Hydra magnipapillata]
    MALKSAATATVRAVKPGSFKSRKAAITLTSSAVQRVKELLKEKPSSVGLRIGVRERGCNGLSYTLEYATEKNKFDEVVKQ
    DDVQIMIDSKALMSLIGTEMDYSQNLLASEFVFNNPNIKGTCGCGESFHI

    >gi|221121076|ref|XP_002157844.1| PREDICTED: similar to CG13623 CG13623-PA [Hydra magnipapillata]
    MFKLTQRTFKSFEWLLIKKPSQRLCSVLSQVPSLNIDNSCVERLKSIISNDNFLRVLVEGGGCSGFQYKFEIDNKIDPAE
    DMVFEKDNAKVVADKESVKILNGATIEYHTDLIRAGFRVSNIPKAEKSCSCGVSFSIKL

    >gi|221128579|ref|XP_002163359.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MSVLNLIIGLVILNGCNSLFINKKNDELSYANKTTSLIQDADPVEVTLYFESFCPDCRATILDQIYPTYQKLASSGILKL
    NFVPFGNAEEVYSAGKYIFYCQHGQEECTGNLIESCAIHFYPDQAKYVPFIQCLEYYGATDTNAKYCASVSQMDYDTISQ
    CVLSDQGNEIEHEMATKTNALNPPHQYVPWFTMNGQHDDSIQDGLSSNMLAYVCNAYQGTKPEACIQK

    >gi|221133126|ref|XP_002171087.1| PREDICTED: similar to glutathione S-transferase [Hydra magnipapillata]
    MRVLYHYPLCPFSRKVRMCLAEKKLDFSQEMTNFWEKRPEFTSLNPLGHVPVLVDLNGSTLSDSSAIIEYLEEAYPDRKL
    YPNDLLGKAESRRLMFWFDSKFAQEVSMVILWEKVIKRMIAKSTGNAGTGPDSNLIRHTKNTLSHHLDYIAWLVDRRNWL
    AGDHFSVADITAAAHISVIDYFGDINWEKFESVKNWFMRIKSRPTYRGFLSDRVPSMAPATHYAELDF

    >gi|221111160|ref|XP_002165104.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MATIVSRFISKSITNGLKCQVKSFKPILSFALAQKFSSSSIELNKAYIQKPAPHFESQAVSTSGEFVKIKLSDYQGKYLV
    FFFYPLDFTYV
    CPTEIIAFSDRIEEFKKINCELLACSVDSVFSHLAWNNQPRNKGGLGKMSIPILSDLTKQISRDYGVLL
    EDAGISLRGLFIIDHKGILRQITVNDLPVGRSVDETLRLVQAFQFVDKHGEVCPAGWKPGSDTIKPGVKESQEYFSKH

    >gi|221111162|ref|XP_002165222.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MAKAFIQKPAPHFEGTAVSPSGDFIEVKLSDYKGKYLIFFFYPLDFTFVCPTEIIAFSDRVKEFNAINCEVLACSVDSQY
    SHLAWTKQPRNKGGLGNMNIPILSDLTKQISRDYGVLLEDAGISLRGLFIIDDKGILRQITVNDLPVGRNVDETLRLVQA
    FQFVEKHGENCPINWTPGAKAIKPGVKDSEEYFSSIQ

    >gi|221112671|ref|XP_002158252.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MIPVLYSYFRSSCSWRVRIALALKGVEYEYKAINLLKGEQKSDDYRSINSQGFVPLLVIDDQKLCQSLAIMEYLDEVYPE
    IHPLLPCKDPVKRSEVRAMALLIAADIQPVQNLSVLNFVGDEKKMDLAHWVIEKGFKGLY

    >gi|221116485|ref|XP_002157838.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MLPRCLVVFLCIGKQNFKHCRRRLFAYSVMSRKVVKVSPSDIKSGKASIQIISPLGASCIGHCSSSLNEDFPVKLTTEQL
    KAKLTPEQYAVTQKSGTERAFTGKYWDNHRKGIYKCVVCDENLFNSDTKFDSGTGWPSFYDVLEKGKVKLITDNTMFMTR
    VEVLCAQCGAHLGHVFDDGPAPTGKRY
    CMNSASLNFQENKEL

    >gi|221129097|ref|XP_002158677.1| PREDICTED: similar to Thioredoxin domain containing 5 [Hydra magnipapillata]
    MFYAPWCGHCKRMQPLWDKYADDKVYSKGIKVAKVDCTLNTPLCASEGIKAYPTLLLFVNQERYTFRGNRNIGEFKQFVE
    KNVKTTVEAPSETFENQLEEDNSDVEAEQLFFRNFKTKINEHYTFVDFYAPW
    CSHCIALQPVWNQLATRFKHNKIVKIAK
    VDCTTEKVICKEQNIQAYPSLHLYKDGVLLIAYMAIDFALQDTKAMLLSLDDFINNFEQIVKEAQKATIKQYNKERTLKS
    LVSFIEETIKFDAEVDEKTPHLLKKSVSELSLHEKYKELVMNEYTLVFHMKSGFVIVFFYIPSLIDGLEIFVEFSKELSG
    VVPGIIFHIINKAMFTISGIPELKDFIKSDKLRSNKSKIEGLHFLEDQECPRLYHLGPLDTKYTKKIIKGKKLKCERLAV
    LVNINGEPHVLGVPSLPFYSEDNQYKGIMQLLDEYVIKSNVGRLCFDTTATNTGITKEAVNRIIHDLGKYILQLACRHYV
    TALRISHFQKHVTHEEKADTVVEKAATDVLEYCKKYIKKKNIAREDRKELAELVIIYLSKSGIVKIKKTGAVHHARFLSS
    ALYYTKLHLLSKQLKLHLLSKQLKLHLLSKQRDLFIKEEDVKAQVKQIVKFICCFYSPWYLQSYNPIKAPYLDITALHQM
    TLYKDVCQVKQAVDKVIDSILKHSWYLDSTLIPLSLLDYKVPDEEKNTNRQFNFILQNAIFKAYAKTLIILNNHAERNAE
    RNVGMMQEFIHRYIIEEEKQMRTIDKVRYTMKKPEKSSSKMTKVRTYPKIIFFENLNDYFPYFGDRTKVGLHAFVKSFKN
    KNSKDSKEEL

    >gi|221132327|ref|XP_002164029.1| PREDICTED: similar to predicted protein isoform 1 [Hydra magnipapillata]
    MKIFILFAFVSVIATELTEEKDVIVLTTDNWSEAVREDNNILVEFYAPWCGHCQTLEPEYAKAAKKLKDLKSTITLGKVD
    ATVETKLAEKYGVKGFPTLKFFKSGKEQEYNGGRTEAEIISWLNKKTGPPAAVVASAEELKVFVDAREVAVVGFFANQDS
    DLAKVFLNVADSTDDIEFAITTPSNSGEYAVTEDKIVVFKKFDDLRADYTGNADEASLKSFVRGESIALVTEFTDEVASK
    IFGGDIKSHILLFVSKKAENFKETINQFTEAAKQFKGKVLFIYIDSDFDENSRIMEFFGLKVEDIPTLRIIKLEGDMTKY
    VPETKEINKDTISSFVLAFVEGKLKPFLMSADIPEDWDKNPVKVLVGKNFAEVVYAEKNVLVEFYAPW
    CGHCKQLAPIWE
    KLGEKYAENPDIIIAKMDSTTNEVEDVKISSFPTIKYFPKEGGVIDYNGGRTLEDFVKFIESGGKDGASAPDDDSTDEPI
    EAGEEGEEVSEEGEEVDASNVKTEL

    >gi|221132329|ref|XP_002164048.1| PREDICTED: similar to predicted protein isoform 2 [Hydra magnipapillata]
    MKIFILFAFVSVIATELTEEKDVIVLTTDNWSEAVREDNNILVEFYAPWCGHCQTLEPEYAKAAKKLKDLKSTITLGKVD
    ATVETKLAEKYGVKGFPTLKFFKSGKEQEYNGGRTEAEIISWLNKKTGPPAAVVASAEELKVFVDAREVAVVGFFANQDS
    DLAKSFVRGESIALVTEFTDEVASKIFGGDIKSHILLFVSKKAENFKETINQFTEAAKQFKGKVLFIYIDSDFDENSRIM
    EFFGLKVEDIPTLRIIKLEGDMTKYVPETKEINKDTISSFVLAFVEGKLKPFLMSADIPEDWDKNPVKVLVGKNFAEVVY
    AEKNVLVEFYAPW
    CGHCKQLAPIWEKLGEKYAENPDIIIAKMDSTTNEVEDVKISSFPTIKYFPKEGGVIDYNGGRTLED
    FVKFIESGGKDGASAPDDDSTDEPIEAGEEGEEVSEEGEEVDASNVKTEL

    >gi|221108063|ref|XP_002160150.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MAVGLILVLISISSVFCSDVLELTDSTFKAGIENEEIILVEFYAPWCGHCKRLAPEYEIAATALLKNDPPVKLAKVDCVG
    EGKESCSKYGVSGYPTLKIFRNGGFSQEYDGPRESAGIISYMKKNSGPSSVLLRDFEHLQLKLSDAADVTIVGFFASEDH
    KFKSFMKAADQKRTDFNFAHSLSNEINKQAGHIDELVLYRPKHLHANFEKAEETLNTDLDTSNIIKFITEKANGIVGQIK
    PETEDKFPRPLVVVYYDVDWKKNPKGSKYWRNRVARVAKKFVNEINFAIGARADYTKQLTDLGFDTVESNLDPNAVAFDV
    KGSKFKMTTDFSVENLEKFTNEFKNEELKPYIKSEPLPVDNNGPVKIVVGENFNEIVNDPTKDVLIEFYAPW
    CGHCKSLE
    PKYKELGEKLAGVKDIVIAKMDATANDVPPPYEVSGFPTIYWAPAGNKQSPKKYNSAREVDSFIEFIKTEATKPFKLPDS
    KSKKKTKKEL

    >gi|221132333|ref|XP_002164304.1| PREDICTED: similar to thioredoxin, putative [Hydra magnipapillata]
    MKFIFSFLALLFCIFKIDGVFAIEILENKTAFDNFLKTSKLAVVEFSATYCEACKYLEPQLENLAKSHGKIKFAKIDVPS
    NQQLANEQGANSMPTVICYTNGKKWHTHVGADIVPLQQKVEMMNKIA

    >gi|221124990|ref|XP_002161717.1| PREDICTED: similar to Mgmt protein [Hydra magnipapillata]
    MPMKFKTLKCATLNLWKINTPIGHIEITCCESGLHSIIQTTVASPPDLSVKVSLVQGCIMDLSALVKEVLNWFTVYFKHP
    KATSSLCIPIICSVVLKSDFRKKAWLHLASEIQAGETVSYKKLAELIGNQGAVRAVGSAMSNNPISIIIP
    CHRVIKSNGD
    IGKYAGGFKNDVKKWLLEFERNS

    >gi|221104341|ref|XP_002155688.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MEKRNLNLFLSLFIVVLQIDTILTDALQLTQDNYQDVLSKNKLVFINFYADWCMFSQQLAPIFHQTADIIHEEYPDVKFG
    RVDCENQQQIALENMISKYPTMKLFKNGKAMRKEYRGARSVDAFTTFIKQNLKASVVDVNNKNDLHINEKKNTIVAYLEG
    KNDAYQNFNKIADEMNEIADFIAVLGDASAQERHMGETIIFKPKKTSGESEAALTVALNNYEQLKQWVSDKANPLVREIT
    FENGEELTEEGLPFLILFHKPDDIISIQRFKNAVARELLSERGRVNFLTADGTTFAHPLHHLGKSIHDLPLIAIDSFRHM
    YMFKRFDNIDVSGKLKQFINDLHSGKLHQDFHNPPPDTVVETPNEAVEVHQEVPKEATQEGGDIQTKYDPASQEKKTEGG
    SGSGQAPPPETVFNKLAPSENRYTLLHWRDYSGEWRDEL

    >gi|221124992|ref|XP_002161768.1| PREDICTED: similar to Mgmt protein [Hydra magnipapillata]
    MDLSALVKEVLNWFTVYFKHPKATSSLCIPIICSVVLKSDFRKKAWLHLASEIQAGETVSYKKLAELIGNQGAVRAVGSA
    MSNNPISIIIP
    CHRVIKSNGDIGKYAGGFKNDVKKWLLEFERNS

    >gi|221107617|ref|XP_002162593.1| PREDICTED: similar to mercaptopyruvate sulfurtransferase [Hydra magnipapillata]
    MFLKKSLLLNIKFTLKSCKLFASTESLISCSQLFDFMKKPLWYESYRILDAQWDLKNEDYRAKHLSKRIFGSKYFSFDEC
    CDKKSAYPRMLPSENYFEEYVSNLGITNNHHVIIYDNHEVFALYSAPRVWWMFKAFGHEKVSVLNGGLRKWVEVGFPTVT
    GPYANEELEASKKHYKASLNYSWVKDFEWIQKNSNSTLPVQVVDARNRNRFLGIKNDGSIDKEGGHIPSSLSIPFDGLFD
    KDNNSLLGKDLINKYFADNYIDTSKDVVAS
    CGSGVSACILSFALHHSCDRKVPVYDGSWSEWKVRATPDSLVRIVN

    >gi|221108824|ref|XP_002168115.1| PREDICTED: similar to ubiquitin-like modifier activating enzyme 1, partial [Hydra magnipapillata]
    IDAIAGSICAQEVIKAVTNKFTPTKQFLHFESLNVLPDNYIEDRRTNKHLYTPTNSRYDGQIVVFGSDYMNLLHSKNIFV
    VGAGAIGCEHIKNFSMMGVNKIIITDMDHIEKSNLNRQFLFRHSDINQPKSMTAAKKGKKINCDVDIIAHKNKVCDETNN
    IYNSDFFKSIDIVANALDNVESRVFVDSLCIKYRKPLLECGTQGTKGSIQTIIPDLTESYGSFSDQPEQTVAT
    CTLKMFP
    YKYEHVVQYAIDSFEGLFNRVPSNYIKIVKKYPENYVDEDGNRFWSGNKMFPTIHEFDIRNNSHIEFVIAFAHIWADVLN
    IPKEKQIGNINAILSKKVPPNIPKNAECNVSIINFEKDDDHNHHIDFITAFSNIRSQFYNIEPKNRLETKRIAGKIIPAI
    ATTTSVVSGFVALELYKTIYGQL

    >gi|221113756|ref|XP_002163122.1| PREDICTED: similar to growth factor, augmenter of liver regeneration (ERV1 homolog, S. cerevisiae) [Hydra magnipapillata]
    MKEEQKQASQEKSQVIENLEKIFFDKPETVPKKPCRTCTEFKNWTRKMTGTATKSNNNIVEAEHEKNISELKRVDCPLDS
    IELGRSTWSFLHTMAAYYPEQPTSKQQSEMKDFIHIFSKFYP
    CSWCAKHLQERLKTDVPDTRSSVTLSQWFCELHNEVNQ
    RLGKPVFDCSKVLERWKDGWIDGSCN

    >gi|221120303|ref|XP_002159905.1| PREDICTED: hypothetical protein [Hydra magnipapillata]
    MKKEIVFYYDIICPYAYLASKLIENVAKRTDATLVWKPVLLGAIYKHTKPDNIDIPENKLIKTYSSQKLKVMRRDLAMQF
    SRHSVPISTNQVPDVKTLNALRLIAFTPDESMDLRSRLSHKLFDAIWQHKKDVSDLNILQNIADSFNLPIKVTDFDDKTH
    PARQKLLDNTEEAISRGVFGVPSMWVNNRLFFGGDRLFLVEREFGLKSEPHRVLHKPVCDVTKKAKLTFYLDFGSPWTFL
    GFKQPRKWCENVFQHFLKANVTISNLCKWKKF

    >gi|221103261|ref|XP_002165916.1| PREDICTED: similar to ubiquitin-like modifier activating enzyme 1, partial [Hydra magnipapillata]
    MFCDFGDKHVVADIDGEPINSGIVESIIKNKFRTFDLHNIYSGDVIYFEGNVDGLISKTDREPNLYIVNIINAHEFELRE
    FLEIHKQMSHGERQIVILRTDPIAFPDSKPVNLIFKQIKLPVTFIFRSLEESLKTPEFAMIDNVDYDMPKILNVFMKALG
    IWRSDCKHIDVLAFPNVFELLAKTCYGSICGIDAIAGSICAQEVIKAVTNKFTPTKQFLHFESLNVLPDNYIEDRRTNKH
    LYTPTNSRYDGQIVVFGSDYMNLLHSKNIFVVGAGAIGCEHIKNFSMMGVNKIIITDMDHIEKSNLNRQFLFRHSDINQP
    KSMTAAKKGKKINCDVDIIAHKNKVCDETNNIYNSDFFKSIDIVANALDNVESRVFVDSLCIKYRKPLLECGTQGTKGSI
    QTIIPDLTESYGSFSDQPEQTVAT
    CTLKMFPYKYEHVVQYAIDSFEG

    >gi|221108376|ref|XP_002159164.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MVLKVENKSMFDAIIKDNQRVAVDFTASWCGPCQYIGPKFEDFADKFKSIKFIKVDVDENEETASANEIRAMPTFKFFKD
    GKEFGKGFAGADEEELENQLNALASA

    >gi|221113583|ref|XP_002170111.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MSTVDQSSPPSKRIRLNPSFEQLNGSSFETYNDQKSFSKDITMMADNEQEIDEGLYSRQLYVLGHDAMKKMGVSNILICG
    LKGLGVEIAKNVILAGVKSVTLYDPEPCHLEDLSSQFYLTELDVGKNRAEATVTKLAELNSYVPVSVYDGELTNDFLSKF
    QCVVLTNSSLSEQFQISDFIHRNNQKLIIADTKGLFGVLFCDFGNNFIVTDNNGEQVISNMIASITKDSEGVVTCLEETR
    HGFEDGDYVTFTEVEGMTELNGCVPLKIKILGPYTFSIGDTTHLSPYERGGIVSQVKMPVTVNFKSLRESIKNPEYLVTD
    YAKFDRSSQLHLAFQALHEYKELTGLLPKPRNKVEQIDEQLLSEFASQAAGDICPMQAVIGGMAAQEVMKACSGKFMPIK
    QWLYFDSLESLPEDKSLLTEENCSPANARYDAQVAVFGKDFQQKLKSSKYFVVGAGAIGCEMLKNFSMMGVGCGSEGLVY
    VTDMDLIEKSNLNRQFLFRSHDVQKMKSEIAALAVKEMNRDINIIAHQNRVGPDTENIYNDDFFEALDGVCNALDNIDAR
    MYMDRRCVFYKKPLLESGTLGTKGNTQVVLPDITESYSSSQDPPEKSIPI
    CTLKNFPNAIEHTLQWARDSFEGLFAQPAE
    TVNQYINDPKFMERTLKLQGMQLLETLETLIKSIKKKPNGFEDCVCSARILFEEYFHNQIVQLLFNFPPDQTTSSGAPFW
    SGPKRCPSPIKFDFSVDLHLDFVIAAANLFAYNYGIKGSVDRSYIQSLVKNVIVPEFVPKSGVKISVTEAEAANAGVDVD
    EQKVESIKLALPPPNDLRGHLKMYPAEFEKDDDTNFHIDFIVACSNLRATNYKISTADRHKSKLIAGKIIPAIATTTSVV
    TGLVCLELYKVINGNKKIESYKNGFVNLALPFFAFSEPMAAPKMKYNDQVFTLWDSFLIDGTMEDGSEMNLQQLMDYFMR
    NKKLGLEITMISQGVSMIYSFFLAADKRKERLTSPISHTVEKISKKKIKPHVKILVLELCCNDAEGEDVEVPYVKYKLPQ
    RK

    >gi|221108258|ref|XP_002164312.1| PREDICTED: similar to IAP-associated factor Viaf1 isoform 1 [Hydra magnipapillata]
    MQDPNADTEWNDALRRHGIIPEKKEVEVTEDQIVQLLDATIKEKTGQKDAKDYTLEELGENEDDFDDDELLESIRRQRIA
    ELMERQKKEKYGEIREISAVDYVDQVNNAGEGVWVVLHLYKSGIPL
    CELIDKHMVQLAKKFPATKFLRSISTTCIPNYPD
    KNLPTIFIYFEGDMKGQIAGPILFGGMNLTQDDLEWMLSKYGCVKSTLKSDPRGTKIDNKNGFTILSRSSRQKNSESEDD
    D

    >gi|221108260|ref|XP_002164341.1| PREDICTED: similar to IAP-associated factor Viaf1 isoform 2 [Hydra magnipapillata]
    MQDPNADTEWNDALRRHGIIPEKKEVEVTEDQIVQLLDATIKEKTGQKDAKDYTLEELGENEDDFDDDDTNSVCYFLFRR
    QRIAELMERQKKEKYGEIREISAVDYVDQVNNAGEGVWVVLHLYKSGIPL
    CELIDKHMVQLAKKFPATKFLRSISTTCIP
    NYPDKNLPTIFIYFEGDMKGQIAGPILFGGMNLTQDDLEWMLSKYGCVKSTLKSDPRGTKIDNKNGFTILSRSSRQKNSE
    SEDDD

    >gi|221124468|ref|XP_002165559.1| PREDICTED: similar to CG7430 CG7430-PA [Hydra magnipapillata]
    MSKQFDVIVIGGGPGGYIAAIRAAQLGFNVACIDEWKNAAGGPAPGGTCTNVGCIPSKALLQSSEHFNHANHHFAEHGIE
    VKGVSMDVAKMIARKNTVVKQNNDGILYLFKKNKIAFFHGRGSFVKAAEGGYEIKVAGAAEETITGKQIIIATGSNARAL
    PGTPFDEVNILSNDGALNIGAVPKKLGLIGSGVIGLEMGSVWKRLGSEVTILEGLPVFLGAVDEGVAKEAHKAFTKQGLK
    IELGVKVGEIKNGKKGVSVAYTNAKGEAQTLDVDKLIISIGRVPNTIGLNTEAVGLALDERGAIVVDGDCKTNLPGVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTIPWVIYTSPEIAWVGRTEQQLKADGVAYKAGQFPFLANGRARALG
    DTTGFVKFLADATTDEILGVHIVGPQASELISEAVVAMEFKASAEDIARICHAHPSLSEATKEAALAVDKRTLNF

    >gi|221127033|ref|XP_002158551.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MISLLVFCSLVVLNIAFPHENRCDSGEKYWCKSYETALECGVLAFCQNKNPDFRAKKITFSPLGQLENPTKKLVSVENVA
    PPVKIELYYESL
    CPGCRAFILGQLFPVFQKLFSTGIIDIGLYPYGNAVESQEGDKWVFQCQHGEAECQNNLIEACVLHML
    SHPSQFMPFIYCLEQNPSLSNAMTCASKLKIEWAPISNCYNGTQGNHLMHELALETNALNPPHQFVPWIVANGQHTEEIQ
    SSAQSDLLQFVCQTYTGVKPDVCQSTSQKRCYKN

    >gi|221117438|ref|XP_002164058.1| PREDICTED: similar to apoptosis-inducing factor, mitochondrion-associated, 3 [Hydra magnipapillata]
    MATKESHVPYDRTKLSKALNTKPSDLYLRDNNFLNEKGIIMAFDKLAVSVDIIQRKVTFADHSVQSYTKLFIATGSQPRR
    LDIPGNDLENIFYLRTPENANDIDSA
    CINKDIVILGSGFIGMELACYFVNKAKSVSVVGLTNVPFEKLLGERVGKSLKML
    HIAKGVKFFESSIKELIGTQGKVVGVVLTDGTLIKTDVVISAIGVSPSTEFLENSSVVRDERGFIKVDQFMKCYTDVYAG
    GDIVSFPYVYDSGKYINIGHWQVASAHGRNAALNMLEKNVPLITVPFFWTSLYGNSLRYAGHCSSFDQILYEGNVEELKF
    VAYYCRDGQVRAVASMNCGAKASEMAFKIESGDIKPPDNI

    >gi|221130867|ref|XP_002159276.1| PREDICTED: similar to protein disulfide isomerase [Hydra magnipapillata]
    MYLHFLLTTICVGVVASKINTKYIMSVDDIKEYKKILKTHKNLLTVYSSDDKSAVKTLKWLDNVSKEIKGKGSIIHINCG
    ENKETKKLCKKYEVNPQPIKLRHYKDGNFNKDYDRQENEKSMVSFMMDPTGDAPWEEDQSAQNVVHINNEKDLNKLRKKE
    KGQLLIMFYAPW
    CGFCKKLKPEYAGAADEMKNKAVLAAMDVDKPDVYNVRYQFNITGYPTIIYFEDGNEKFRYSGKMDKE
    GIVTWLADPKPVSKEEQGDDWEAPEITHLNNDNFDSTLKTSVSTMVMFYAPW
    CGYCKKMKPEYVNAAITLQAENVIATLA
    AVDCTQSQATCNKFEVKSYPTIKYFINGTLMYGLNTYKADDIVAFMKDPKEPPPPPPADLPWAETSGSEILHLSNENFKD
    EMKTRKHTLVMFYAPW
    CGHCKKAKPEIEAAAEYFKDDRKITFAGVDCTVHDALCKSYEVSGYPTFRYFLYGKKDFVYKGG
    NTKENFIAFMKNPEEPIIEKSRPVEPEWSETNTNVVHLNFNTFDNFISKNPSALVMFYAPW
    CGHCKALKPAYTEAAEELL
    YKNHKLCAVDCTKNQDLCNEHNVTGYPTIKHFYNGKVSHYNGGRSKEDIITFLSSIKTEKKVPTTKNEFWDSNDVIHLDD
    VTFPDFIKETKIVLIMFYAPW
    CGHCNKMKSDYQNVANIFHSQKILKERIAAIDCVVNRATCIKYDVHGYPTLKLFKDGEK
    YADYEGGRTSSQIVEFVKNSRHSTPPVQSWSNENTAVIHLNDDTFDSFIAEYSSVLVMFYAPW
    CGHCKSMKPAYEKAAEY
    VNLKEEVPGKLAAFDCTVNKVVPKALALQGYPTLMYFKNGHQLEKYEGDRSFESIVDYMKKASEKKEGPSAVKEWKDEPS
    AVHHITQNSFEEFILEKDVLIMFYAPW
    CSHCNGMKPAFMQAANTLKKENFPGVLAAVDATKAVELANKEGVKAYPTLRYY
    SKGEFIEQFTDDRSVENIIRFMKKQKESPHRRQASIDNFDWSDMPSQVTHLSADGFQSFLNGKTHALVMFYVKW
    CNGCFE
    MRGSVMQAASRLSTQPLYAFAAINCDENDVFCSSIGVVVFPSIKYYSKGEFVENYEGIVKPETIVNYLKSKVKDEL

    >gi|221106368|ref|XP_002162567.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    CGHCKNLAPDWKKAATALKGIVKVGAVDMDVHGSVGGPYNVRGFPTIKIFSGDKSKPQDYNGARSAQAIVDEALKVASAL
    ARERLNGGSKRSSSGSGKSGNAKDVITLTDDNFEKEVIDTKDIVFVEFFAPW
    CGHCQRLEPEWAKAATELKGKVN

    >gi|221120864|ref|XP_002158620.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    MFNKISLKSIDYLGAVNANPDDFEKLTQVFLEDIELCNIKVPEFDFGFQWLNVKEKLQFNKDLKGKLCVLDFFTYCCINC
    MHILPDLHDLEESFSVQDGLVVLGIHSAKFQNEKILSNILSAVIRYDISHPVVNDPNAVLWNEMNIQCWPTLVVVSPIGQ
    VLLYLVGEGHRNFLFNFVEFALKKYRNKGLLSSHALPIQLEKSSLKFKNLRYPGKLTASPCGKMLAVSDSGHHQVLIIER
    NGYVVKRIGTGFPGFKDGEAHVSQFSSPQGLSWIENVIFVADTENHSIREINVANWITKTIVGNGKQGKDKEGGKLGIEQ
    EISSPWDVVVGASPGSDTTDCVNNCLYIAVAGTHQIWCYFLKDGLWLKKGHQKKEVALRFAGSGEEENRNNSYPTKASFA
    QPSGLAIIKNQLFVADSESSSIRSVDLKTGAVKGVVGADRDPTNLFSYGDVDGIGLNAKLQHPLDVAAVNGHLYVADSYN
    HKIKVVNMSNLSCTTLAGNGVVGIKNGDFLSAEFNEPGGIICLDDTIYIADTNNHLIRVLNLTTRLVSTVSVINLLEILE
    TDNFDGFSVA

    >gi|221121204|ref|XP_002163969.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MMAKSATCLALCLLFITIQCEDVPSDKPLDESSENIKQVVDEPVEEDHVIVLSDKNFDGFINSKKFVLVEFYAPWCGHCK
    QLAPEYSKAAQKLKNNDPPVSLAKVDCTKETELANRFNIQGYPTIKLFKDGEPSDYDGERDENGIVKYMRQHADPNYVPP
    KDFVIVLGKDNFTEITEKEAIMLVEFYAPW
    CGHCKKIAPQLEKAASALQSKQPSILIGKVDATIEKELAEQYGVTGYPTM
    KIFRNGKATEYKGPREEPGIADYMLNQAGDPTKLYETMTDVKKFLKSNLDEPVILGVFDSKDDPLYKLYIDSNNAVRDDY
    VFGHTFAADAKHYFGLKVSSIIIAHPEYLLTQYEPKYRAFDDASGNDIQVQAFYKEYCVPLVGHYQQHIESRFSKRPLVL
    VFYDVNFQPEFRSMTQFWRNKVVPVARKYKNALFAVADETMFEHKLKELGLSDSGETVNVGIYNDKGQRFAMKDEEFNEE
    TLEEFLEDFYKGIADYMLNQAGDPTKLYETMTDVKKFLKSNLDEPVILGVFDSKDDPLYKLYIDSNNAVRDDYVFGHTFA
    ADAKHYFGLKVSSIIIAHPEYLLTQYEPKYRAFDDASGNDIQVQAFYKEYCVPLVGHYQQHIESRFSKRPLVLVFYDVNF
    QPEFRSMTQFWRNKVVPVARKYKNALFAVADETMFEHKLKELGLSDSGETVNVGIYNDKGQRFAMKDEEFNEETLEEFLE
    DFYKGKLKPVIKSQAVPKKVNPGNVQVVVGKTFDSVVMDESKEVFIEFYAPW
    CGHCKKLEPVIVKLAKKFKNEKNIVIAK
    IDATENEAHAAYEVSGYPTIYYALPGKKDKPIKMDGGRELSDLVKFIEENSVILKSKNVKQEL

    >gi|221122080|ref|XP_002154896.1| PREDICTED: similar to thioredoxin domain containing 5, partial [Hydra magnipapillata]
    MRHEIFLFYVWVSQYFVKAVNIGAESYSTQSFELVHHSSYPHFVMFYAPWCGHCKRMQPLWDKYADDKVYSKGIKVAKVD
    CTLNTPLCASEGIKAYPTLLLFVNQERYTFRGNRNIGEFKQFVEKN

    >gi|221118180|ref|XP_002154935.1| PREDICTED: similar to glutaredoxin, CPYC type [Hydra magnipapillata]
    MGRAEAEIFVKEQIDSNFIVVFSKTYCPYCTMAKKALDDVNATYTVLELENRDDCQDIQDVLMDMTGARTVPRVFINRKF
    IGGGTDLKMLQENGELKELVKS

    >gi|221116579|ref|XP_002166880.1| PREDICTED: similar to chloride intracellular channel 5 [Hydra magnipapillata]
    MSDDVGYELELFIKSSKDGKGLGDCIHCHRFMMVLALKGVTANVTTIDLRRKPEFFVKYYAGVKLPCLVHNGKVIDDIIE
    IESHIEKHFPDPPLVLLDDHGASKAGEKIFQKFSALIRNRDPAGEERLRDSLNEELQKLDAFLASSKKIPGPYLAGNEMT
    MSDCVLLPKLHQMQITLKFFNDFSIPKNLVYLQNYLKVANENEVFVKTCCETSEILEGWSAHVGDPKKVQKLRSIKH

    >gi|221103397|ref|XP_002166306.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MYSSISSLPSKKELVKKVIISINGMSCSSCVATIENHMNKVDGIEQCLVALLTQKAEITYLIDKISVQEIISNIESIGFK
    AMLLKDTDDVHKVLELHVDGMTCASCVHTIESQLVKHNGIVSASVALTTSMARVTFDSRNIGARDIIEIISNLGFVATIP
    ANDHSKAEALSHSKSIKKWRLSFLVSLIFGIPVLIVVIAYSFIGEQNGPYVTRGLSLQNLLLFLLCTPVQLNVVVLQVIA
    QC

    >gi|221090500|ref|XP_002168046.1| PREDICTED: similar to Ubiquitin-like modifier-activating enzyme 6 [Hydra magnipapillata]
    METVVVKDEIDDSLYSRQRYVLGDNAMQKLAKSNVLIIGLGGLGVEVAKNVILAGVNSLTLLDEKICQEIDLGTQFFLTQ
    QDVNNKLSRASACRSRLAELNPHVSVQIIKDDILSNLPSLKSYHCVVITEMPFSDQVVLNNFCREQTPPIYFISGDVRGL
    FSYAFCDFGNEFEVTDIDGEEYREVFIGSITKSNPAVVGTLESRLHGLQTGDKVLLKGINGMLQLNFKTFIVQYLTPYTF
    SIDCDTSTDDYQIYEHGGVFCKIKTPTIMNFQSLEMQLTNPSILLCDLSKLEYPLQTLLAFQSLYKYISQKQTLNNLHTA
    FNELYDISISINSKVTNSEILTILSRTGSGVFAPLCAVIGGIISQEVLKCLTSKFTPLYQFYILDAMELSSSNNRSEVAN
    NRYFSLNVCLSPDLVKKMSELSLFMVGCGAIGCELLKNFALVGLATKGDSILTITDNDLIEKSNLNRQFLFRPWHIQQSK
    SLVASKEVCVINPVSVDTENIYNDHFFQKMGIIINALDNIETRRYIDGRCVSNTRPLIETGTMGTKGHVQVIVPHLTETY
    SSQRDPVDEDIPY
    CTLKSFPQQIEHTIQWARDKFDSLFTYEPEVYNKFWDKNEDMNEIIKNFEENHQIPDGFVVSASLLK
    KKPANFECCVKEAYLKFYSYFHNKALQLLNSFPLDTKMADGTWFWQSPKKPPSPIHFDPQNPLHIQFVTSYAMLLAKTYG
    IWSEDCKSVKIPDVIKLFQLPEFNPSQKKVIIEENQDKENKNVNLDKVGGLIQYLSSLKELDAISLSVEHFEKDNDSNGH
    LNFIYATANLRATMYGIENVDRYKIKRIAGRIIPAIATTTSVVAGLATLELLKVVAGCSRESLKNCFLNLAIPLMVLSEP
    APAPKIKIINDVQFTCWDRWDIHGHKDYRLKDFVDYLKKKCGLTVNMVCQGLKMIYIPFMPGHPKRLNNLMTDLLKPSKD
    TAYIDLIVAFQDPELSSESDLPSPPVRYYFL

    >gi|221132776|ref|XP_002166026.1| PREDICTED: similar to Thioredoxin domain-containing protein 9 [Hydra magnipapillata]
    MNVVEQQVIQAAHVVESVVDAELNRLENLDDDDLKRIRQDRVNAMKKLALRKEEWKQIGHGEYQELKDEKEFFDEQKKSE
    RFVCHFYRESTFR
    CKIMDKHLDIIARKHIETRFVKIDAEKCLWLAQRLKIKVLPTLACIKDSKTKDYIVGFDDLGGIDDF
    PTEMLEWRLSLSEMVDYNGDKPSGKPKTQSRILGYPDEKKNVRGNNGESDDDDY

    >gi|221132784|ref|XP_002165185.1| PREDICTED: hypothetical protein [Hydra magnipapillata]
    MTALSHKVKFNVEVTIDVICPWCYIGRRYLEAAINALENEATFLITWKPFLIDAQCPSEGIPYNTYLISKFGEKIAKQEM
    KGQGPLGKAGKSVGIKFDPDRYVVNSIKSNLLLQFVLEQYGQEKQSKMHELLCKQYFEESVNLNSDTVLKQLSEEVGVDS
    VSAAQYFTSPSNVKRLFNDLKKLKKRGIVGVPYFQFSIDGAADIQPVGFSGAQSKAGFIDTITKLLKEYQKEVCIITFDQ
    PLYAKAREILSAAPDGSELSKTIIRFGGFHLLMSFFVSIGYIMQGSGIQEALSLIYAPKLLEKMLKGYARTIRAHTLLQL
    PLAIIISKDLAIDEEMVANLDISIKGVISYKVSYCDIESGVDNEMCALLYKFNKKIKEFEKRGPTSKL

    >gi|221125820|ref|XP_002163718.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    MVENLHICYDDSSLKSLLKSANSQVVVIHFEAEWAAECKQMNDVFIQLAKDFQHALFIRIEAEELPEITQQYEVESVPTF
    ILLKNSKVIDKIEGADAASLTKKVKHHVTSFVSPVVASEVSAASDKNNLEDRLKNLINQSFCMLFMKGEPDAPE
    C

    >gi|221101576|ref|XP_002155862.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    MAANGNVKIVSNDLSFLSEIQNAGSKLVIIDFHATWCGPCKNIAPVFVQESLKYPNSVFLKVDVDVCTETAHKYGINAMP
    TFVFVLQGKKIDELRGADPKALIAKIKQHSGDSIGTGSNSAGESEVPGHSDLISYITASGCNCLNESDEHTHANIFKKDN
    TYLESDCDEQLLLSITFNQAMKVHSLKIDAPTDGRGPKFVKLFVNQPSAIGFDQAESMEGVQHIDLTEEDITGEKLIPLR
    FVKFQNVTNLVIFFAS

    >gi|221107318|ref|XP_002169657.1| PREDICTED: similar to SCO1-like, putative [Hydra magnipapillata]
    MNGKRYLILAIFGFGIGLAVLFAMYQFQKPNSALLHNEESGIANIGGDFELTDQNGKLRSTKEFRGKLLMVYFGYTYCPD
    VCPMALEHITAALKGLGKDRDKVAVIFVSVDPERDTLETLKLYSSNFDPNIVMLTGSPAQLKKAMQQYRVYVKKENKPGM
    SDYLLNHTSVVYLMGADGKYRQGFAHSTNPEVIKSILLKALQP

    >gi|221128743|ref|XP_002157934.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MAANGNVKIVSNDLSFLSEIQNAGSKLVIIDFHATWCGPCKNIAPVFVQESLKYPNSVFLKVDVDVCTETAHKYGINAMP
    TFVFVLQGKKIDELRGADPKALIAKIKQHSGDSIGTGSNSAGESEVPGHSDLISYITASGCNCLNESDEHTHANIFKKDN
    TYLESDCDEQLLLSITFNQAMKVHSLKIDAPTDGRGPKFVKLFVNQPSAIGFDQAESMEGVQHIDLTEEDITGEKLIPLR
    FVKFQNVTNLVIFFASNQGSEETTVIKYLKIIGSPVESTNMNDFKRIAGKAGESH

    >gi|221105977|ref|XP_002164578.1| PREDICTED: similar to GK14696 [Hydra magnipapillata]
    MENTYMSDLENEGEKNLTRSSYSSTAPQTGPKGVIADYRRHSAVVEHEKEVSKLKYIEEIKKKSFIADPNKFANVEEEPN
    KLDIKNDNFDDDDEDFLKSYHKKRLHLLEKESKTNGTKYSKLFDMSGEGLLEKLENPCKDEILVVHLYDPKVSA
    CVTMNK
    CFEYLAVQYPYIQFSKVLAKETGLSLNFQMKALPTIQVYKDGNLIGNFFSMQDKLDTDFHPSDVENFLLDSNMLTEFQA

    >gi|221130349|ref|XP_002163778.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MSLSKHVQDIENLLQLNPKINPYANYVSTVKTKKNRKYWKRNDDHNCSSCADLTKNFEDIKHTTLSERAALKEAARCLKC
    ADAPCQKSCPTQLDIKSFITSISNKNYYGASKAIFSDNPLGLTCGMVCPTSDLCVGGCNLYASEEGPINIGGLQQFATEI
    FKKMRIPQIRDPKLTPIEQLPESYKSKIALLGCGPASISCATFLGRLGYSNITIFEKEAFKGGLSSSEIPQYRLPYDVVN
    FEIEQMKDLGIKIEHGKCLSKNAGLTIRSLQNDGYKAIFVGIGLPEPKIIPEFEGLTVKNGFYSSKHFLPLVSKASKPGM
    CSCKSELPQLHGNVIVLGAGDTAFDCCTSAIRCGARRVYVVFRKGFTNIRAVPEEMELARKEKCEFLPFMSPKQVILKGD
    HITAMEFYRTEQQEDGTWIEDIEQTMTIKANFVISAFGSTLAEKDVIDALEPLTFNRWGLPEVNPDTMETNERGVFCGGD
    IVGIAQTTVESVNDGKQASWTMHKYIQSLSNLEVPAQPNLPLFCTPIDEVDISIELCGLKFPNPFGLASAPPTTSSAMMR
    RAFEAGWGFQLTKTFVLDKDYVINVSPRIVRGSTSGHQYGPGQSSFLNIELISEKSAAYWCKSISELVKDFPNQILIASI
    MCGYNQEDWTELAKMSEVAGAPALELNLSCPHGMGEKGMGLACGQNAELVYNICKWVRAAVKIPFFAKLTPNVTDIVEIA
    LAAKNGGADGVTATNTVSGLMHLKSNAVPWPAVGQEKRTTYGGVSGNSIRPIALRAVSAIASALPGFPILATGGIDSAEV
    GLQFIHAGASVVQICSAVQNQDYTVIDDYVSGLKCLLYMSSCDEFASWNGQSEPTVRQQKGKPIAKVADVVGKSLPHFGE
    YKRKREIAIANSIKESNILREELFPMKVRPAIAPKNKIASVKDMVGLALNYIGKYNDLSNKQQVVAVVDDEMCINCGKCY
    MACNDSGYQAITFDPYTHLPHVTNDCTGCTLCVSVCPIIDCITMVERQTPYIPSRGIPLSIKV

    >gi|221127582|ref|XP_002157709.1| PREDICTED: similar to glutaredoxin 3, partial [Hydra magnipapillata]
    MIGKEGLNNFKQKAYEEDHQVVVIHFEAEWAAECKQMNDVFIQLAKDFQHALFIRIEAEELPEITQQYEVESVPTFILLK
    NSKVIDKIEGADAASLSKKVKHHVTSFVSPVVASEVSAASDKNNLEDRLKNLINQSFCMLFMKGEPDAPQ
    CGFSREIVTI
    LKNNGIQFSFFDILTDDTVREGLKKFSNWPTYPQLYINGELVGGLDIVR

    >gi|221116615|ref|XP_002166709.1| PREDICTED: similar to Dihydrolipoyl dehydrogenase, mitochondrial [Hydra magnipapillata]
    MQKTYSAAQVFLKSSSNKSALKTALKSTTVLGKNYATSTQADADLVVIGSGPGGYVAAIKAAQLGLKTYCVEKNPTLGGT
    CLNVGCIPSKSLLNNSHYYHVAKKEFADRGIKCDKVELDLTKMMKAKSDSVTGLTNGIATLFKANKVNRVDGFGSISGPN
    QVTVSKSDGSKEVITTKNIMIATGSEVTPFPGIEIDEKTIVSSTGALSLKEVPKRMVVIGAGVIGVELGSVWQRLGSKVT
    AVEFLDHIGGMGIDLEVSKQFQKSLTKQGMEFKLGHKVTGAAKQPDGSLKVTVVNNKTEKKEVIECDVLLVCVGRRPFTN
    GIGLEQLGIKRDEKNRIIVNSRFQTGIPSIYAIGDVIHGPMLAHKAEDEGIFAVEGICGSAVHIDYNCVPSVIYTHPEVG
    WVGKSEEQLKQEGIPYKIGKFPMMANSRAKTNNDTDGFVKVLSHKETDRLLGVYIVASCAGELINEAALAMEYGAAAEDV
    ARVCHAHPTVSEALREACLAAYCGKAINSI

    >gi|221124220|ref|XP_002157684.1| PREDICTED: similar to predicted protein isoform 2 [Hydra magnipapillata]
    MVHKVAKKEEFDSIIKSHERVAVDFTATWCGPCQMIGPKFEKLAEKYSSIKFIKVDVDENSETSEAHGISAMPTFKFFKN
    GLEVDKLVGANEGELDKRLLNLASL

    >gi|221124222|ref|XP_002157650.1| PREDICTED: similar to predicted protein isoform 1 [Hydra magnipapillata]
    MVHKVAKKEEFDSIIKSHERVAVDFTATWCGPCQMIGPKFEKLAEKYSSIKFIKVDVDENSETSEAHGISAMPTFKFFKN
    GLEVDKLVGANEGELDKRLLNLASL

    >gi|221102999|ref|XP_002163759.1| PREDICTED: similar to Heat shock protein 67B2 [Hydra magnipapillata]
    MLASKCLLNRSFSYFNQRCLWKKSSCCNKIFVCPNRCMTVRSATTLSISKLCLSNAKKSCNFNVFKQCSSNLCSSSTSSD
    LYEIDVDLLNEGLKNNNIYIVDVRERQEIKDSGELPNAINIPLDELEAALQLNENHFKVRYGTSPPNDDGNNLVFS
    CRSG
    RRSYHALMIAHSMGYLKAKHLKGGFLAWSSPDT

    >gi|221117534|ref|XP_002158667.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MVFEKNVISNNVVELKRDEDSDLKRDEDSEIKRNGGSDMQHDGGSDLNHDKKSGQNLDERNFKVEGDVVSNKTNETLMDG
    KMIIESINKIEFEIIKRYMELEDIEGDVTNKQKLEEDIIKNKTDIEDLISTKERLEKVFDERNNGKSEINDMHLRLFEML
    GKLRHNPSFEEIEREFIKLLGSDGYNALKSDIKNVPYDDFMKAKAVFDKYRFVDFKTLNEEISLSAPHFLTLKYKIDKML
    VEMTSAPKNSGDSHRYPCKPFNLTSTDNSSVIMINSDAAMTDILTQMNETKGCSLVLFYSPY
    CEFSARIAPLYNAVGRSY
    PLMPVIALDAQSTIGMSARYGIVGIPTIILFYSGKAMGKFNGSRTAQHMHYFVKDNTGFDPISIINITEEDFKGPLSSIV
    KESPDYFLIFSTVFLFLIVFWIICGSYIVEMCLAIYDRWNAATVHHQKVE

    >gi|221114197|ref|XP_002168197.1| PREDICTED: similar to UbiE/COQ5 family methyltransferase, putative [Hydra magnipapillata]
    MIGTRIMFHGNHGKSIKFQGRLKVREREGGHVIGIDMTPAMISKSRLNAKKGGYSNVEFRLGEIEYLPVTNATIDVVISN
    CVVNLSTDKLRVFQEVARVLKPGGRIVISDIVAINPIPNEIKNNLALYAG
    CIARAMSIEELKDALEKTGFENISIQINKL
    SCTFLXXXXXXX

    >gi|221091669|ref|XP_002169764.1| PREDICTED: similar to thioredoxin reductase [Hydra magnipapillata]
    MTHAKVIVIGAGPAGYTAAIYAARANLKPIQLLGPQPGGQLTITTDVENFPGFKETIQGPWLMEQMHAQAEHVGTDMRFE
    SVVNVDFSKKPFVIETDNPTTYTCDTVIIATGAQAKWLGLESEEFFRGYGVSG
    CATCDGFFFKNKQVAVIGGGNSAVEEA
    IYLTNHCAHVTLIHRRDSLRAEKIAQDRLFNNPKISVIWDSAIEEVLGDRQPVKNVTGLKLRNLKTNEIQTLNVDGVFVA
    IGHTPMSTPFKDALKLDSEGYILTTPGSTVTSVPGVYAAGDVQDKIFRQAVTAAGQGCMAALEAEKFLQH

    >gi|221128767|ref|XP_002160789.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]
    HVIKITMAAVRVVILSFMFGSALAVMELNDNNFFEYAKRKEVLLVDFYTPWCSDCKRLAPEFEGAAAQLQDRSADLVKVD
    CEGAGKGLCQMYQIRSWPQLKNFHYGTYTGDYTGPQSAEAIASYINTVEQSSSNFVPGYYPNVGYAMAPKDSLVEPAPPV
    VGALSCARCNIGKGTKCTKVVKKACVELQLREKAKKEEAKQNDDDKKRSVLVKKADNKKKSNN

    >gi|221136156|ref|XP_002169718.1| PREDICTED: similar to Thioredoxin domain-containing protein 14, partial [Hydra magnipapillata]
    MSYQEYLNGHYILNFVASFMFVLTRSFEPLCWILYDPNDDGQCTYDWRDTEILMFTGIVLMMKNRRWKPLSNKEYISNFF
    IFAKTTNILLFMRHDIRYGILYILFCLVLFIGFPEPSYKGPDKIKFFRGQALDEELYHNPEKIMLVEFYAAWSPP
    CTRFS
    GTFANLSLKYSNDFFEFGKLDVTRYEKIAEKYCVNHSVTSKALPTLILFVNGKESMRRPQINAKGT

    >gi|221107158|ref|XP_002168935.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
    MSYQEYLNGHYILNFVASFMFVLTRSFEPLCWILYDPNDDGQCTYDWRDTEILMFTGIVLMMKNRRWKPLSNKEYISNFF
    IFAKTTNILLFMRHDIRYGILYILFCLVLFIGFPEPSYKGPDKIKFFRGQALDEELYHNPEKIMLVEFYAAWSPP
    CTRFS
    GTFANLSLKYSNDFFEFGKLDVTRYEKIAEKYCVNHSVTSKALPTLILFVNGKESMRRPQINAKGTAIPYIFNEENIIRD
    FELNEIYNKTKLKLSKVETKKSS