Gallus gallus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|118086186|ref|XP_426021.2| PREDICTED: similar to MGC78790 protein [Gallus gallus]
    MAGKKKEIQLQTTVCNQNEWDEMLLTKGVVVIDVYQAWCGPCKAVVNLFRKLKNDFSEDDVLHFAVAEANSIESLQPFRN
    KCEPVFLFCVNGKIIAIVRGANAPLLSKKITELVQEEREILAGQKERPKVDELVFLEEKLSEQSIESVEETVPEVTYSVG
    IIKPDDVSEGRVEEIKRKIRDAGFGIAASEEKMLTEEQIREFYTKRREQPDFDDFVQFMMSGPCHILIITKKKATDAIPL
    WTELHETNESMPDETEAEEKDRLQGTEENKTISNICDVPDSFEDASRQLAFFFPNFDRKNTEQKFEKTLALIRPCVLRER
    RNSIMQSIKDDGFEVAMQKEITLSEEQAREFYKEHENEDYFPALLEQMTSGPTLVLALTRQNAIQHWRDLLGPKTIEEAK
    KVPNSLRAKYAIDNIAINQLHGSSSVNDAQKELEFFFPQEHTLALIKPDAAKNHKDEIMQKVKDAGFTISKVKEEALTRE
    MATQFYKDHEGKPFFEELVSCMTEGPSVIMVLTKENAVQEWRKLMGPTDPEVAKESCPESIRAQFAQNILSNAVHGSSNR
    EHALESIEYVFGEIDID

    >gi|118090268|ref|XP_420609.2| PREDICTED: similar to MOP-4 [Gallus gallus]
    MATDSMEIDDALYSRQRYVLGDTAMQKMAQSHVFLSGVGGLGVEIAKNIILAGVKALTVHDTKQCTKWDLGINFFIHEDD
    IISQRNRAEATLHRIAELNPYVHVAASTVPLDESTDLSFLKQYQCVILTEVNLSLQKKINDFCHAQQPPIKFISADVYGI
    CSRLFCDFGDEFEVLDTTGEEPKEIFISNITQSNPGIVTCLENHPHRLETGQFLTFREVNGMSCLNGSTHQITVVSPYSF
    SIGNTSDMEPYLHGGIAVQVKTPKMFYFERLEKQLTNPMCLVADFIKPEAPLQIHIAMLALNHFEENFGRMPNIGCHQDA
    EEMLKIAISISETLENKPQVNGDVVKWLSRTAQGFLAPLAAAVGGVASQEVLKAVTGKFSPLQQWLYIDMLDIVTPLEKM
    GSEEFLPRGDRYDALRACIGESLCQKLHDLNVFLVGCGAIGCEMLKNFALLGVGTGQDKGLVTITDPDLIEKSNLNRQFL
    FRPHHIQKPKSYTAAEATLNINPCLKIDSYINKVCPATENTYSDEFYTRQDVIVTALDNVEARRYIDSRCVANLRPLIDS
    GTMGTKGHTEVVVPHLTESYNSHRDPPEEEIPF
    CTLKSFPAAIEHTIQWARDKFESLFSHKPSLFNKFWQTYPSAEEVLQ
    RIKSGESLEGCFHVIKTLSRRPRNWTQCVELARVKFEKYFSHKALQLLHSFPLDTRLKDGSLFWQSPKRPPFPVKFDFND
    PLHYDFIVSAAKLFATVYCVPFTEQDLSEETILKIISSVKVPEFRPSNKVVQTDETARKPDHIPVSSEDERNAIFQLEKS
    IQSNEALQNDLQMKPISFEKDDDSNGHIDFITAASNLRAKMYNIEPADRFKTKRIAGKIIPAIATATAAVSGLVALELIK
    VVGGYPVDAYKNCFLNLAIPIMVFTETAKVRRTEIRNGISFTIWDRWTIYGKEDFTLLDFINAVREKYGIEPTMVVQGVK
    MLYVPVMPGHIKRLKLTMQKLVKPSADKKYVDLTVSFAPETDGDEDLPGPPVRYYFVQEDN

    >gi|118097577|ref|XP_414627.2| PREDICTED: similar to 2310047H23Rik protein [Gallus gallus]
    MWWLLLLLAGLGRALPEGVVTETGAGSSAPISGEAVRYRTAEMADAMLGSGPPGQPPVVLSAVPGEAKEGRAAAACEAAA
    GGEECGAGSGPAAPPAPPGEAVVLETVLPAGEEPNGTAESVKAPKVSCEERNVTGISNFTLQILNVSQDLMEFLNPNSSD
    CTLVLFYTPW
    CRFSVSLAPHFNSLPRAFPTLRFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKD
    FIFNQTGIEANNDVTVTEEDWKGPLPSVLTKGVDWLLVFSVLFLASFIMYATIRTESIRWLIPGQEHEHQE

    >gi|118093487|ref|XP_421968.2| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 [Gallus gallus]
    MEFLLSKGDYPTSFRRSLLVVLVCVMVLVCTDQDYYSLLGVSKEASSREIRQAFKKLALKLHPDKNQNDPNAHDNFLKIN
    RAYEVLKDEDLRKKYDKYGEKGLEDQQQGGRYESWHYYRYDFGIYDDDPEIITLDRGEFDAAVNSGELWFVNFYSPR
    CSH
    CHDLAPTWREFAKEMDGVIRIGAVNCGDNRMLCRIKGINSYPSLYVFKTGMQPVKYYGDRSKESLKNFAMQYVTSTVTEL
    WAGNFVNAIETSFASGLGWLITFCAERGDCLSYQTRLKLAGMLEGLANVGWMDCGTQGELCDNLDISSSTTAYFPPGATI
    NNKEKGGVLFLNSLDAREIYQEVMKHLPDFEIISATSLEDHLAHHRWLLFFQFGENDKSSVQEFKKLKFLLKDEHIQVGK
    FDCLSSPTICNKLYVYQPCLAVFKGKGIEDYEIHHGKKILYDIVAFAKESVNSHVITLGPQNFPGKEKEPWLVDFFAPW
    C
    PPCRALLPELRKASKHLYGQLKFGTLDCTVHEGLCNMHNIRAYPTTVVFNQSDVHEYEGHHSAEQILEFIEDLRNPSVIS
    LTPETFVELVERRKREEIWMVDFYAPW
    CGPCQALMPEWKKMARMLNGLISVGSVDCQKFYSFCHQENVRGYPEIRLFPQK
    SSTTHQYYSYNGWHRDSYSLRGWALGYLPRVSIDLTPQSFTEKVLNGKDHWVIDFYAPW
    CGPCQNFAPEFEILARAVKGK
    VKAGKVDCQAYGQTCQSADIRAYPTVKFYPYQGTKKSVLGEYIDSRDAKGIADILNEKLEAIQNKGKRKKSRNKDEL

    >gi|50728788|ref|XP_416283.1| PREDICTED: hypothetical protein [Gallus gallus]
    MSQQLLYRALVSAKWLSEAIKSKQTGQALKVVDASWYLPKMKRDPKQEFEERHIPGAVFFDIDQCSDRTSPYDHMMPKAN
    EFAEYVGKLGVGNDSHVVVYDGSDQGLFSAPRVWWMFRVFGHEAVSLLDGGLKNWLREGFPLSSGKTQVAPSDFHATLDK
    CMVKTYEDILDNLDSHRFQVVDARVEGRFRGIEPEPRDGIEPGHIPGSLNMPFTSFLTESGLEKTPEQIRSLFQEKKVDL
    SKPLVAT
    CGSGVTACHVALGAYLCGKPDVAVYDGAWVEWYMRAQPENIISEGKGKTV

    >gi|118082851|ref|XP_001234510.1| PREDICTED: similar to Thiosulfate sulfurtransferase (Rhodanese) isoform 1 [Gallus gallus]
    MAAQALGRALVSAKWLSEAVRAGRVGAGLRVLDASWYPPQERNARQEFKERHIPGASFFDIEECRDKSSPYDFMLPSEAH
    FADYVGRLGVSNDTHVVVYDGDELGTFYAPRAWWMFRAFGHREVSVLNGGFKNWVKEGHPVTAEPSQPAQAVFKATLDKT
    LLKTFEEMMENVGSKKFQVVDSRPAGRFQGTELDQDCNGLESGHIPGAVNMPFSTFLTESGHEKSIEEIQQMFHEKKVDL
    SKPLTAT
    CRKGVTACHIALAAYLCGKPDVAVYDGSWSEWFHRAPPQYKVTELKRNKG

    >gi|45383856|ref|NP_989456.1| quiescin Q6 [Gallus gallus]
    MWRRRARSGGGGGGGGGGAAPRCRWWPAVLALLAAALPAARSRSLYSPSDPLELLGADTAERRLLGSPSAWAVEFFASWC
    GHCIHFAPTWRALAEDVREWRPAVMIAALDCADEANQQVCADFGITGFPTLKFFRAFSKKAEDGIRIAHPTATVADLRRA
    IITNLEQSGDAWPPACPPLEPASAEEVRSFFHRNTERYLALIFEQSNSFVGREVALDLLQYENVAVRRVLSSEEELVEKF
    GVTTFPSAYLLLRNGSFSRLPVHAEARSFYTYYLQTLSGVTRGSYRLNVTGSAINETRALQPAQADRSKVYVADLESTVH
    YTLRVEAGRPAVLAGAQLAALKCYVATLAKYFPGRPSVQTFLQSLDSWLRNWTEPELPRSALKEAVKNKEDASPAAVLPT
    NVTWVGCRGSEPHFRGYPCGLWTIFHLLTVQAAQGGPDEELPLEVLNTMRCYVKHFFG
    CQECAQHFEAMAAKSMDQVKSR
    REAVLWLWSHHNEVNARLAGGDTEDPQFPKLQWPPPDMCPQCHREERGVHTWDEAAVLSFLKEHFSLGNLYLDHAIPIPM
    AGEEAAASARLSTAGLREKEEEERKEEEEEGEKETEKPHREGETGRPGSSELRRPSIVRRNPRLRALGEDIVDLDSFSEQ
    HFKSKALRAAGRHRRLSKRDTVALHHDAGWERLQVPESREEEEEGGVLRRSPWLRVLGLGFSRLDVSLCIALYFLSSMCL
    LGMYTFFRLRTRARKGRPGFPVA

    >gi|50728790|ref|XP_416284.1| PREDICTED: similar to Thiosulfate sulfurtransferase (Rhodanese) isoform 2 [Gallus gallus]
    MAAQALGRALVSAKWLSEAVRAGRVGAGLRVLDASWYPPQERNARQEFKERHIPGASFFDIEECRDKSSPYDFMLPSEAH
    FADYVGRLGVSNDTHVVVYDGDELGTFYAPRAWWMFRAFGHREVSVLNGGFKNWVKEGHPVTAEPSQPAQAVFKATLDKT
    LLKTFEEMMENVGSKKFQVVDSRPAGRFQGTELDQGLESGHIPGAVNMPFSTFLTESGHEKSIEEIQQMFHEKKVDLSKP
    LTAT
    CRKGVTACHIALAAYLCGKPDVAVYDGSWSEWFHRAPPQYKVTELKRNKG

    >gi|118099423|ref|XP_415413.2| PREDICTED: similar to quiescin Q6-like 1 [Gallus gallus]
    MAAGGGGPLVLLTLLVAGVAARLYRAGEDPLSVLAAGTVRRALLNSSAAWVVQFYSSSCGHCVAFAPTWRALAGDVKDWE
    SAIRVGVLDCGEEENYETCKEYGIHFYPTFRFFKAFTKQFTTGENYKGADRELQTVRQMMIDFLQNHSQESKPPACPPLD
    PVLSSDVTSLFDEKAPHYTAIVVESNNSYIGREVILDLIPYENIVVKRALNFDKPFLEKLGITSVPSCYLMHPNGSHGLV
    NSLKPLRSVFSSYLKSLPGVRKKLLSPLELPVKENKEESTEIKLWKEFDKSKLYMADLESGLHYLFRVELATHKMLEGAE
    LKTFKDFVTISAKLFPGRQPVVKLLETLQEWLVSLPLDKIPYDAILDLVNNKMRISGIFLTKRTEWVGCQGSRPELRGYT
    CSLWKLFHTLTVQAALRPTALISTGLEDNPRIVLEVMRRYIHHFFG
    CKACAQHFEEMAKESMDSVQTLDKAVLWLWEKHN
    VVNNRLAGDLTEDPKFPKVQWPTPDLCPACHEEIKGLHSWNEAQVLQFMKHHYNSENILYRYTESQTDSSDTELKDAREE
    KDKSLLEKPGGNRANVVLNQEHIRDSESKLFNKLIGNHGPVKDGGKSAFESVNHQESRQSVIFLGIGFSNIDMSLCVVLY
    VASSLFLMIMYFFFRMRSKRWKVKYYRSSV

    >gi|50806608|ref|XP_424463.1| PREDICTED: similar to thioredoxin-like protein [Gallus gallus]
    MVGVKLIANDTEFQPELSAAGSRLAVVKFTMRGCGPCLRIAPAFNALSNKYPQATFLEVDVHQCQGTAATNNISATPTFL
    FFRNKVRIDQYQGADAVGLEEKIKQHLENDPGNNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDSTYLESD
    CDEQLLITVAFSQPVKLYSMKLQGPDNGQGPKYIKIFINLPRSMDFEEAERSEPTQALELTPDDIKEDGIIQLRYVKFQN
    VNSVTLFVQSNHGDEETTRITYFTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|118099885|ref|XP_420095.2| PREDICTED: similar to cognin/prolyl-4-hydroxylase/protein disulfide isomerase [Gallus gallus]
    MAVVRLARHPGREADDIVSWLKKRTGPAATTLTDAAAAETLVDSSEVVVIGFFKDVTSDAAKEFLLAAESVDDIPFGISS
    SADVFSKYQLSQDGVVLFKKFDEGRNNFEGDLTKDNLLNFIKSNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDY
    EGKLDNFKTAAGNFKGKILFIFIDSDHSDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDDLTADKIKEFCNKFLE
    GKIKPHLMSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPW
    CGHCKQLAPIWDKLGETYRDHENIVIAKMDST
    ANEVEAVKIHSFPTLKFFPAGSGRNVIDYNGERTLEGFKKFLESGGQDGAAADDDLEDLETDEETDLEEGDDDEQKIQKD
    EL

    >gi|118081979|ref|XP_424246.2| PREDICTED: hypothetical protein [Gallus gallus]
    MSVRETFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|118096738|ref|XP_425145.2| PREDICTED: hypothetical protein [Gallus gallus]
    MTVGCVPQPPFLGRTLLPVLLLAASARCHWPSEPAEVVRDWENQLEASMHSVLSDLRETVPAVVGIPDSSAVVGRFFRVS
    IPTDLIASNGEAVQATSAAAPQFLQGERGVGRNRAEVSQQLLAALNPDVEVSVHPGELSEEFLAAFQVVLLTESPLEEQL
    RIGDICHAKGICFIVADAKGLAGQLFCDFGEHFVVRDPVEGDPLCATVQHVSQGNPGIVTCAGADKNRGHRFSDGDLVVF
    SGVEGMVELNSSEPCPVHVLDAFRLEIGDTSAFSPYRGGGRISEVRPRQERSYEPLRRALAMPRIQTRSSTELLRSRTLH
    AAFWALHAFRQQRGRLPQPRAPEDAERVLELARELGSALGPLDEDVVRAFASVSAGELCPVASFMGALAAQEAMKAITGK
    FLPLEQWFYFDALECLAVEGAAGLMPEDCAPRGSRYDGQIAVFGADFQEELGRQKYFVVGAGAIGCELLKNFAMMGLAAG
    PGGDITVTDMDTIARSNLHRQLLFREADVGKPKAEVAAAAVRLINPDIKVTAHQAQLGPGTEKLFGSTFFRRLDGAVSAL
    DTLTARAYLESCCIRSRTALLDTGTEGAKGNVLAMVPPLSQQLEPGSDPADGSFPL
    CTLRFFPCAIEHTLQWARDEFEGL
    FQLPAESVNRFLGELPEELPRWEGLVVPEQVRRSLQERPRDWGDCVRWARRHWQLRYHNSIAQLLHDVPPSHESSPGVPF
    WSGDRRCPHPLTFDISNDTHLAYVEAAAHLLAHTYRLPSCGDRVATRDVLCHTVLPPFVPKDGRYVPTVEGVEEVEEALE
    PGQLLELVQELARWKQELGGGTEAMDPIHYDKDDDLHLSFITAASNLRAENYSIPPADRLTSQRIAGRIVPAIITTTAAV
    AALACLEVYKLVWRCRDLRCYRNSNLFLSECLLFRIQPLPAPTYRVGPPLLGALQQPHGVPHG

    >gi|71895205|ref|NP_001025983.1| phosducin-like 3 [Gallus gallus]
    MQDPEKDTEWNDILRKKGILPPKENREEQERAKEEEQFEILQKSLVKTYEDMTLEELEENEDEFNEEDEKAIEMYRQQRL
    AEMKAAQMKNKFGEVLEISGKDYVQEVTKAGKGIWVVLHLYKQGIPL
    CALINQHLSGLAKKFRDVKFIKAISTTCIPNYP
    DKNLPTIFVYLDGDIRAQFIGPLVFGGMNLTRDELEWKISESGAIKTDLEENPRKQIQDQLMSSIRACVPTRGESDSEDD


    >gi|50751518|ref|XP_422437.1| PREDICTED: similar to natural killer cell enhancing factor isoform 4 [Gallus gallus]
    MSSGKAFIGKPAPDFTATAVMPDGQFKDIKLSDYRGKYVVFFFYPLDFTFVCPTEIIAYSDRADEFKKINCEIIGASVDS
    HFCHLAWINTPKKQGGLGTMKIPLVSDTKRVIAKDYGVLKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|57530159|ref|NP_001006435.1| similar to implantation-associated protein [Gallus gallus]
    MAALPVLVLVLLLACGGPRAAGQKRKEMVLSEKVSQLMEWTSKRSVIRMNGDKFRRLVKAPPRNYSVIVMFTALQPHRQC
    VVCKQADEEYQVLANSWRYSSAFTNKIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFAAEQLA
    RWVADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRGSNLDFLYNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHK
    NPHTGQVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLHEAATSDMDVGKRKIMCIAGIGLVVFFFSWLLSVFRSKYHG
    YPYSFLMS

    >gi|118094464|ref|XP_001233860.1| PREDICTED: similar to natural killer cell enhancing factor isoform 1 [Gallus gallus]
    MSSGKAFIGKPAPDFTATAVMPDGQFKDIKLSDYRGKYVVFFFYPLDFTFVCPTEIIAYSDRADEFKKINCEIIGASVDS
    HFCHLAWINTPKKQGGLGTMKIPLVSDTKRVIAKDYGVLKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|118099916|ref|XP_420103.2| PREDICTED: similar to Spermatogenesis associated 20 [Gallus gallus]
    MATAGRSSPPRRANRLIYERSPYLQQHAHNPVDWYPWGQEAFDKAKRENKLIFLSVGYSTCHWCHVMEEESFKNQEIGEI
    MSKNFVCIKVDREERPDVDKVYMTFVQATSGGGGWPMSVWLTPDLRPFVGGTYFPPEDSAHHVGFRTVLLRIAEQWRQNQ
    EALLQSSQRILEALRSLSRVGTQDQQAAPPAQEVLTTCFQQLSGSYDEEYGGFSQCPKFPTPVNLNFLFTYWALHRTTPE
    GARALQMSLHTLKMMAHGGIHDHIGQGFHRYSTDRHWHVPHFEKMLYDQGQLAVVYSRAFQISGDEFFADVAADILLYAS
    RDLGSPAGGFYSAEDADSYPTATSSEKREGAFCVWAAEEVRALLPDPVEGAAEGTTLGDVFMHHYGVKEDGNVSPRKDPH
    KELQGKNVLIAHSSPELTAAHFGLEPGQLSAVLQEGRRRLQAARAQRPRPHLDTKMLASWNGLMISGFAQAGAVLAKQEY
    VSRAAQAAGFVRRHLWEPGSGRLLRSCYRGEADVVEQSAAPIHGFLEDYVFVIQGLFDLYEASLDQSWLEWALQLQHTQD
    KLFWDPKGFAYFSSEAGDPSLLLRLKDDQDGAEPAANSVTVTNLLRAASYSGHMEWVEKAGQILAAFSERLQKIPLALPE
    MARATAVFHHTLKQVVICGDPQGEDTKEMLSCVHSTFIPNKKDYSG

    >gi|118094468|ref|XP_001233893.1| PREDICTED: similar to natural killer cell enhancing factor isoform 3 [Gallus gallus]
    MSSGKAFIGKPAPDFTATAVMPDGQFKDIKLSDYRGKYVVFFFYPLDFTFVCPTEIIAYSDRADEFKKINCEIIGASVDS
    HFCHLAWINTPKKQGGLGTMKIPLVSDTKRVIAKDYGVLKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLV
    QAFQFTDKHGEGLHVLVVSVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|118093103|ref|XP_426543.2| PREDICTED: similar to Prdx3 protein [Gallus gallus]
    MTPSFLPRPLRDPPPLVLPPGDGSEPSTALVPPPVPCIPSPPPGPACCAALKMAAALRGLLRRAVPAAGRTLTAQPLLCA
    RRRLTLGASRLAPAVTQHAPFFKGTAVVNGEFKELTLDDFKGKYLVLFFYPLDFTFV
    CPTEIVAFSNKANEFHDVNCEVV
    AVSVDSHFCHLAWINTPRKSGGLGKMNIPVLSDLTKQISRDYGVLLEGPGIALRGLFIIDPNGIIKHLSINDLPVGRSVE
    ETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPEASKEYFEKVHT

    >gi|118084248|ref|XP_001232595.1| PREDICTED: similar to ATP binding protein isoform 1 [Gallus gallus]
    MAADTSVEILQKVLENEILQTAKVVEEHLDAEMQKLDQMDEDELEHLKQRRLEALKKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKNVVCHFYRDTTFR
    CQIMDKHLTVLAKKHVETKFLKLNAEKSPFLCERLRIKVIPTVALIKDGKTQDYIVG
    FTDLGNTDDFTTETLEWRLGCADIINYSGNLMEPPFQSQKKFGTSFTKLDKKTIRGKKYDSDSDDD

    >gi|118084250|ref|XP_416899.2| PREDICTED: similar to ATP binding protein isoform 2 [Gallus gallus]
    MAADTSVEILQKVLENEILQTAKVVEEHLDAEMQKLDQMDEDELEHLKQRRLEALKKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKNVVCHFYRDTTFR
    CQIMDKHLTVLAKKHVETKFLKLNAEKSPFLCERLRIKVIPTVALIKDGKTQDYIVG
    FTDLGNTDDFTTETLEWRLGCADIINYSGNLMEPPFQSQKKFGTSFTKLDKKTIRGKKYDSDSDDD

    >gi|118084914|ref|XP_417073.2| PREDICTED: similar to ATP7B [Gallus gallus]
    MERKLDNKMRRELSCLATLNNKNITLVSIRKRQAAHDVPELLIIGEGSKAGSPLEASSNLQKEEKVLQRNSMGMPEVNTT
    GRQVLSNADSPPSCALQPEMRQNFAFDNMGYEESFEAMPSPSSQERTVAISIVGMTCQSCVQSVEGRMSKVKGVVSIKVS
    LELNNAVVKYLQSEISPEQICQEIEDMGFDASIAEERLTPVSVNLPCSREAVIKLRIEGMT
    CQSCVTSIEGKIKKLHGVA
    KIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTVKNKSAPLKLGVLDVRNLQSADPRETPVSLGKEVLHPLVANKS
    STAAVTVHIEGMHCKSCVRNIEGNISSLPGIQSIEASLEHKCAVVQYSPNLITLSALQQAIESLPPGNFKVCLPNSSEAN
    NQASPSPALVCDLFREPLKDTVCTAVVRIDGMTCNSCVQSIEGTMSQRQGVQHVAVSLADKTGTIHYDPANTNGEELRAA
    IEEMGFDASLLTGNSVLSSVGSTSKGLEVVQVSENTSVGLMPVMPQHSLEPQSLLARVPNQPSGATAKKCFLQITGMT
    CA
    SCVSTIERNLQKEDGIISVLVALMAGKAEIKYKPEFIQPLEIAQLIQNLGFEATVIEDHSEAEGNVELLITGMT
    CASCVH
    NIESKLMRTNGIFYASVALATCKAHIQFDPEITGPRDIIKIIEEMGFHASVSRRVPNTHNLDHKKEIQQWRKSFLCSLVF
    GIPVLILMIYMLIPGGEHHGAMVLEQNLIPGLSILNLLFFVLCTFVQFLGGWYFYIQAYKSLKHKAANMDVLIVLATTIA
    YVYSCVILLVAIIEKAEKSPVTFFDTPPMLFVFIALGRWLEHIAKSKTSEALAKLISLQATEATVVTLGPDHSIIREEQV
    PVELVQRGDIVKVVPGGKFPVDGKVIEGNSMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLVNATHVGNDTTLAQIV
    KLVEEAQMSKAPIQQLADKFSGYFVPFIIIISTVTLIAWITIGFINFDIIQKYFPNQNKHLSKAELILRFAFQTSITVLS
    IACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVV
    GTAEASSEHPLGVAVTKYCKEELGTQSLGYCTNFQAVPGCGISCKVGGVDAVLGTAEEGVDNEAGYICKPSSSSSHIYSV
    LIGNREWMRRNGLHIANDVNDAMTDHETKGQTAILVAIDGALCGMIAIADTVKQEAALAVHTLKNMGIDVVLITGDNRKT
    AKAIATQVGIKKVFAEVLPSHKVAKVQELQNGRRKVAMVGDGVNDSPALAKADIGIAIGTGTDVAIEAADVVLIRNDLLD
    VVASIHLSKRTVRRIRINLILALIYNLLGIPIAAGVFMPAGLVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDTESYEA
    QAQGHMKPLTPSQISVHIGMDDRRRDSFRSAPWDQISQVSLSSLTSDKLPRHNGFFEEEGDKWSLLMNGGDEEQYI

    >gi|118086741|ref|XP_419113.2| PREDICTED: similar to KIAA1830 protein [Gallus gallus]
    MRSEGRSARRRAVSPSGRARSPVNMAAMGGRQQCLWAAAVVALALASEAAFVEDLDESFKENRKDDIWLVDFYAPWCGHC
    KKLEPVWNEVGMEMKNMGSPVKVGKMDATSFSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFANRVAGPLIRP
    LPSQHMFEHVRKRHRVLFVYVGGESPLKEKYIEVASELIVYTYFFSASEDVLPEYLTLPELPAVVVFKDGTYFVYDEYED
    GDLSSWINRERFQGYLTVDGFTLYELGDTGKLVAIAVIDDKNSSVEHTRLKSIIQEVARDYRDHFHRDFQFGHMDGNDYI
    NSLLMDDLTIPTIVVLNTSNQQYFLPDRHIENTEDMVQFINNILDGTAEAQGGDGVLQRIKRIVYDAKSTVVSVFKSSPL
    LGCFLFGLPLGVISIMCYGICTADTDGGVDEHEAVKKENSDRELTDDGSEEEQEEENGKYTELSDGELKQKDLLEKKKD

    >gi|118085842|ref|XP_001234672.1| PREDICTED: similar to GOB-4 isoform 1 [Gallus gallus]
    MEKSYMSMFLLLMAISCVLAKDIGKKETKETSTKPKLPQTLSRGWGDQLIWTQTYEEALFRSKNSNKPLMIIHHLDDCPH
    SQALKKVFAEHKEIQKLAEKFILLNLVYETTDKNLAPDGQYVPRILFIDPSLTVRADITGRYSNRLYAYEPSDISLLYSN
    MQKALKLLKTEL

    >gi|50732569|ref|XP_418698.1| PREDICTED: similar to GOB-4 isoform 2 [Gallus gallus]
    MEKSYMSMFLLLMAISCVLAKDIGKKETKETSTKPKLPQTLSRGWGDQLIWTQTYEEALFRSKNSNKPLMIIHHLDDCPH
    SQALKKVFAEHKEIQKLAEKFILLNLVYETTDKNLAPDGQYVPRILFIDPSLTVRADITGRYSNRLYAYEPSDISLLYSN
    MQKALKLLKTEL

    >gi|45384038|ref|NP_990491.1| glutaredoxin [Gallus gallus]
    MVDSFVQSKLRDNKVTLFVKGSCPYCKNAIVLLKEFNFLPGCLEVVDITGMDDIQDYFQKTTGQRTVPRVFIGTKCIGGF
    SDLQKMEQQLPMMLRQIGALV

    >gi|118094049|ref|XP_422200.2| PREDICTED: hypothetical protein [Gallus gallus]
    MFLKRALQLRGRFRMGNRLPASVTPFNAAAVNQIQEIISDNCVVIFSKTTCFYCRMAKKLFEGLNVNYTAVELDVNKNGS
    QIQDILEQMTGGRTVPRVFVNGSFVGGATDTQRLHEEGKLLPLVHQCQVKTKSGATI

    >gi|50745031|ref|XP_419952.1| PREDICTED: similar to human P5 isoform 2 [Gallus gallus]
    MGVRGTGGLWWGTVSCTLFLAVNGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGV
    VKVGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSEAIVDAALSALRSLVKDRLSGRSGGYSSGRQSRES
    GGGDKKDVIELTDDSFDKNVINSDDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQMLANRYGI
    RGFPTIKIFQKGEDPVDYDGGRTRSDITARALDLFSDNAPPPELLEIINEDVLKTTCDAHQLCIISVLPHILDTGASGRN
    SYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSVGRGS
    TAPVGGGAFPKIHAVEPWDGKDGELPVEDDIDLSDVDLDDIWDKDEL

    >gi|118089017|ref|XP_001231746.1| PREDICTED: similar to human P5 isoform 1 [Gallus gallus]
    MGVRGTGGLWWGTVSCTLFLAVNGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGV
    VKVGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSEAIVDAALSALRSLVKDRLSGRSGGYSSGRQSRES
    GGGDKKDVIELTDDSFDKNVINSDDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQMLANRYG

    >gi|118100899|ref|XP_001232656.1| PREDICTED: similar to molybdopterin synthase sulfurylase [Gallus gallus]
    MAGGAEAAWLSVEIEQRERELRGLREQLAAVLAEEHGGAAQQGAGAVDADFPAKLPPLPAQAALSPADILRYSRQLVLPE
    LGVRGQLLLARSSVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLHRQVLHGEARRGFPKAASAAAALRQLNST
    VQYVPYCGALTPRSALQLVQQYDVVADCSDNVPTRYLVNDACVLAGKPLVSGSALRLEGQLVVYNYHGGPCYRCLFPKPP
    PPETVTN
    CADGGVLGVVPGIMGCIQALEVLKIISGMGSSFNQFMLMFDAQEGRFRNIKLRPKKSDCAVCGDNPSVTCLQD
    YEAFCGSSATDKCRTLHLLSSKDRISVEEYKKLLDEQVPHVLLDVRPKVEVNICRLEHAVHIPLSKLEEKDEECMEYLEK
    IIFEEKQRTDGQTSFPVYVVCKLGNDSQKAVRILQELPVKEFGPVLAKDIKGGLMTWASRIDPTFPQY

    >gi|118088139|ref|XP_419554.2| PREDICTED: similar to endoplasmic reticulum oxidoreductin 1-Lbeta [Gallus gallus]
    MSGGGSGSRSTAAWARWATRLLAALGSVLAAEAQLTGVLDDCLCDIESIDDFNTFKIFPKIQKLQERDYFRYYKVNLKRP
    CPFWADDGH
    CSIKDCHVEPCPESKIPVGIKAGSSNKYSKAANNSKELEDCEQANKLGAVNSTLSNQSKEAFIDWARYDDS
    QDHFCELDDERSPDAQYVDLLLNPERYTGYKGPSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGGDDGESFYTWLEGLC
    LEKRVFYKLISGLHASINLHLCANYLLEETWGKPRWGPNVKEFTRRFDPIETKGEGPRRLKNLYFLYLIELRALSKVAPY
    FERSVVDLYTGNGHEDAESKALLLEIFRDTKSFHMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWG
    KLQTQGLGTALKILFSEKEIQNLPENSPSKGFQLTRQEIVALVNAFGRLSTSIKELQNFKVLLQQTR

    >gi|118085899|ref|XP_418699.2| PREDICTED: similar to RIKEN cDNA E030025L21 gene [Gallus gallus]
    MLHSTLALSLLLIAVSSNLAMAIKKEKRTPQTLSRGWGDEITWVQTYEEGLYQAKKSNKPLMVIHHLEDCQYCQALKKAF
    AENEEIQEMAQDNFIMLNLMHETTDKNLSPDGQYVPRIMFIDPSLTVRADITGRYSNRLYTYEPQDIPFLIENMKKALRL
    IQTEL

    >gi|118093188|ref|XP_421823.2| PREDICTED: similar to O-6-methylguanine-DNA methyltransferase [Gallus gallus]
    MFTKRPRRALEQLSADAISARPSSVPPPPIPPIPEHAGGARKASRRGEVVLPGGRQASPSTMASRRVPKMTSKEGTSQCQ
    EKHAVLLSPVGKLEISGCETGVHEIKLPRLSVLPNGTEAAMRCELSGSVTSMPEPLQQCAAWLNAYFCEPSRTEQLPLPP
    FHHPMLQQDSFTKEVLWTLLREVKFGEAISYQQLAERAGNSRAARAVGGAMRSNPIPIIIP
    CHRVICSSGQIGNYGGGNV
    MKEWLLSHEKLQKEKLAD

    >gi|118083880|ref|XP_425551.2| PREDICTED: similar to chloride channel form A [Gallus gallus]
    MAESPGQPVGSDEPRGAGEEEGAEAVGKPQTALCPNGAAEPTDESSDGGGGAGGQEAAAVASEVPSEGGSGEPGGATESP
    GKGQQEEGELPAPDRDGAALQGGEPAAAAGVDSAPAEVEPEQAAGKVVPVGTEPEEAAVVLAVAEPEEVTVTAPSGSDPE
    DVVQEVNAVGAEPEEAVRNEGPSGTVPEEAVREEGPLRSSPEETDPEEAMREASQKGPEPEEAMREEAPLGTEPEEAVRE
    EAPSGLRPEEGVREDAPSGMEPEEEMREEARVGTDPEDAVQEEALSAPSPEDEGVTEEAPSGAELEKEEEEAPVGDEEAP
    QRPGVAEDALPAAGETDGGRRSPAGPEGEDGAEVLPGAEREAGTGEAAGAGEESAASGGGGAAAAGRPGGWPDPEGSEWE
    SAGLSLNGVRGRAEDEEDETGSPTALKDEEEKQEYDISLFVKAGSDGESIGN
    CPFSQRLFMILWLKGVIFNVTTVDLKRK
    PADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAPPRYPKLAPKHPESNSAGNDVFAKFSAFIKNPRKDANENLEK
    SLLKALRKLDNYLNSPLPDEIDAYSTEEITVSCRKFLDGDELTLADCNLLPKLHIIKVVAKKYRNFDFPPEMTGISRYLN
    NAYARDEFTNTCPADQEIEYAYLDVAKRMK

    >gi|50749993|ref|XP_421826.1| PREDICTED: similar to thioredoxin-like [Gallus gallus]
    MAAGEVVVAGSAEQFQQLLQQKERALVVVHFWAPWAPQCAQMNEVMATLAKEHVQVTFVQLEAEAVPEVSEKYEISSVPT
    FLFFKNSQKVDRLDGAHAPELTKKVQRHASSTSVSAGSNDNAKEDLNVRLKKLINAAPCMLFMKGSPKEPR
    CGFSKQMVE
    ILNKHGISFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVAGELIGGLDIIKELEASGELDAVCPKAQKLEDRLKSLINKAP
    VMLFMKGNKQTAR
    CGFSKQIIEIINNTGVDYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKELKESGEL
    LPILKGEN

    >gi|118087730|ref|XP_415026.2| PREDICTED: similar to Txndc13-prov protein [Gallus gallus]
    MQDIRKALAIDCSLNKLTVVSIPIQAERPGSAGWEQPTALGHRRSAVSQRWRLTAFQAALTPNGYRPRSVLITRHLEDGI
    PLRVPSTLINPLEYSGAFARAGLEPAMRQPSFQNGRNCSARCHSSRLHTANGRAARPSRSHGSSAPAAAVGRGPPPPSLP
    GPGGGNMAVSGGVALLLGAVLGPFAASVFSSSPVGRPGEPRSRVQVLSGSNWSLVLQGQWMVEFYAPW
    CPACQQIELIWE
    SFAKESEHLDITVGKVDVTQEPGLSGRFFVTTLPTIYHANDGVFRRYRGSRTLEDLQSYVLEKKWEAVEPVAGWKSPSSI
    VMHGMAGLFHLSGYIRQIHSYLTDTLGIHVWISYAVFILATLLIGLFLGLMLVLISDCLCPSKSNYRNETSEVITKENVE
    NAENAVLEEPEEATELSADDAEEAAEVKDLSEGEDAPNSSVDDSEEDLALGKESV

    >gi|71895547|ref|NP_001025742.1| SUMO-1 activating enzyme subunit 2 [Gallus gallus]
    MSVPVSGPLGSELAEAVAQARLLVVGAGGIGCELLKDLVLTGFSNIDVIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKE
    SVLQFYPEANIIAYHDSIMNPDYNVEFFRQFTLVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTVIKKGVTEC
    YECHPKPTQKTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPAEAEARARASNEDGEIKRV
    STKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQNQEKNVPDQQNESSSVLKDQQVLDVKSYAH
    LFSKSVETLRLHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHVFSMNMKSRFDIKSMAGNIIPAIATTNAIIAGLIVL
    EGLKILSGKIDQCRTIFFEQAAKSQKEAIGSLCFGSTKILTVTYVQVSQK

    >gi|71897149|ref|NP_001026581.1| hypothetical protein LOC426978 [Gallus gallus]
    MAQRLALRRLLALGRRPLPLGPRPLASQGLPGRAFGSSAIRGSAFNVQDGGDFQERVVNSPKPVVVDFHAQWCGPCKILG
    PRLEKMVAKQEGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGFSSVWGF

    >gi|118090474|ref|XP_420692.2| PREDICTED: hypothetical protein [Gallus gallus]
    MASGSRVLRRLLHLSAGNCLLLLLLLLLFLCGQLGGGQKKKENLLAEKVEQLMEWSSRRSVIRMNGDKFRRFVKAPPRNY
    SVIVMFTALQPQRQ
    CSVCRQANEEYQVLANSWRYSSAFSNKLFFTIVDYDEGADVFQQLNMNSAPTFMHFPPKGKPKRAD
    TFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMAALCVVFAMTS
    GQMWNHIRGPPYAHKNPQNGQVSYIHGSSQAQFVAESHIILLLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVF
    FFSFLLSIFRSKYHGYPYSFLIK

    >gi|118096885|ref|XP_414371.2| PREDICTED: similar to MGC81848 protein [Gallus gallus]
    MPPPGQTQLPDWDGLKLRVRTLIATHRVMIFSKSYCPYCHRVKELFSSLGVQYYALELDVTDDGPSIQQVLAELTNQRTV
    PNVFINGKHIGGCDATYKAYENGTLQRILGDVKDAETYDYDLIVIGGGSGGLACSKEAATLGKKVMVLDYVVPTPLGTSW
    GLGGT
    CVNVGCIPKKLMHQAALLGQALKDSRAYGWQYDEQVKHNWEIMVEAVQNYIGSLNWGYRLSLREKSVTYQNSYGE
    FVEPHKIKATNRKGQVTYHTAETFVLATGERPRYLGIPGDKEY
    CITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLG
    LDVTVMVRSILLRGFDQEMAEKIGAHMETHGVTFIRKFVPTQVERLEDGTPGRLKVTAKSTEGPEFFEGEYNTVLIAIGR
    DACTRNIGLQTIGVKINEKNGKVPVNDEERTNVPYVYAIGDILDGKLELTPVAIQAGKLLARRLYGGSSTKCDYINVPTT
    VFTPLEYGSCGLAEEKAIEEYGKQNLEVYHSLFWPLEWTVPGRDNNTCYAKIICNKLDGNRVVGFHVLGPNAGEVTQGFA
    AAIKCGLTKELLDETIGIHPTCAEVFTTMDITKSSGQDITQRGC

    >gi|118091881|ref|XP_001233621.1| PREDICTED: hypothetical protein isoform 1 [Gallus gallus]
    MSSAAVKPILYSYFRSSCSWRVRIALALKGIAYDQVPVNLVKDGGQQFSAEFKAVNPMKQVPALKIDGITITQSLAIIQY
    LEDTRPNPRLLPQDPKKRAQVRMISDHIASGIQPLQNLSVLNKVGERKMEWAQQCITSGFQALEQILQHTAGRYCVGDEV
    SMADLCLVPQAANAERYGVSLDPYPTITRINKALLELEAFKVSHPSRQPDTPAELRS

    >gi|50748528|ref|XP_421288.1| PREDICTED: hypothetical protein isoform 3 [Gallus gallus]
    MASEKPILYSYFRSSCSWRVRIALALKGIAYDQVPVNLVKDGGQQFSAEFKAVNPMKQVPALKIDGITITQSLAIIQYLE
    DTRPNPRLLPQDPKKRAQVRMISDHIASGIQPLQNLSVLNKVGERKMEWAQQCITSGFQALEQILQHTAGRYCVGDEVSM
    ADLCLVPQAANAERYGVSLDPYPTITRINKALLELEAFKVSHPSRQPDTPAELRS

    >gi|50746977|ref|XP_420702.1| PREDICTED: similar to phosducin-like 2 [Gallus gallus]
    MQDPNEDTEWNDVLRKFGILPPKEEPKDEIEEMVLRLQKEAEVKPYERMSLEELKEAEDDFDEADRKAIEMYRQQRLQEW
    KCLQRRQKYGELREISGEQYVKEVTNAPEDVWVIIHLYRSSIPV
    CLLVNEHLSHLARKFPEAKFVKAAVNSCIQRYHDRC
    LPTILVYKSGEIKARFIGVAECGGAYLKVEELEWKLAEVGAIESDLEENPKKDIINMMTLSMQNISVHENMDTKSSDVLK
    PRIT

    >gi|71895359|ref|NP_001026285.1| chloride intracellular channel 2 [Gallus gallus]
    MESRPVKEPEIELFVKAGLDGENIGNCPFCQRLFMVLWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLLFNRELKTDF
    IKIEEFLEQTLCPPTYPHLSPKYKESFDVGSDIFAKFSAYIKNSRKEANSNLEKALLREFQRLDQYLTTPLPEEIDQDSV
    EDITISKRKFLDGDHLTLADCNLLPKLHIIKIAAKKYRDFEIPADMTGVWRYLNNAYACDEFSHTCPADEEIVHTYASVA
    RKMT

    >gi|118092359|ref|XP_421473.2| PREDICTED: similar to ERO1-like (S. cerevisiae) [Gallus gallus]
    MAAGGALLRALGFAALLLPALPRGSPGSAERRCFCQVTGHLDDCTCDVETIDAFNNYKLFPRLNQLLESDYFRYYKVNLK
    KPCPFWNDNSH
    CGIRDCAVKPCPSDEVPDGIRSAGYKYSEEANSHAEECEEANRLGAVDESLSKETQQAVLQWTWHDDSS
    DSFCEADDIHSPDAEYVDLLLNPERYTGYKGPDAWKIWNSIYEENCFKPQNVKRPLTSGRGDDGGQMFYKWLKGVCVEKR
    AFYRLISGLHASINIHLSARYLLQDTWSEKKWGPNVTEFQQRFDEVVTRGEGPRRLKNLYFLYLIELRALSKVLPFFERP
    GFQLYTGNQSHDAEIKNLLLEVLHLAKSFPLHFDENSFFAGNKKEAAKLKEEVRLHFKNISKIMDCVGCFKCRLWGKLQT
    QGLGTALKILFSENLIEKIPESGPSYGFQLTRQEIVALFNAFGRISTSVRELENFRAILRTMR

    >gi|118094652|ref|XP_001235373.1| PREDICTED: hypothetical protein [Gallus gallus]
    MRAQPAAASVLCLCLLMAASAAAAAEGLGKGFGDHIHWRTLEDGKKEAAASGLPLMIIIHKSWCGACKALKPKFAESKEI
    SELAHNFVMVNLEDDEEPKDEAFSPDGGYIPRILFMDPSGKVHPEIINEKGNPSYKYFYTNADQVIQGMKEAQEKLTGDA
    FKQKHLGDEL

    >gi|118089608|ref|XP_420307.2| PREDICTED: similar to ATPase, Cu++ transporting, alpha polypeptide (Menkes syndrome) [Gallus gallus]
    MEARSIVIGVEGMTCHSCVQTIEQHVGKMNGIHNVKVSLEDKNAVIIYDSKLHTPATLQEAIYDMGFDATSAGSNPQPVL
    PDTIFLTIPTQSALTSKELRSTLLKNKGILDVKVSSDQKSAVVTFLSSIINGKQIVQMVPGVDLSISAPEVTPGTCEDPS
    WSQTSSVLLRLKVEGMT
    CHSCTSTIEGRIGKLQGIQRIKVSLDNQEAAVVYQPHLITAEEIKCQIEAAGFTASFKKQPRP
    LKLNAVDLERLKNTQTKSSDTAPLKENTRNVNDTKTVVFRIDGMH
    CSSCVLNIQSTISTLPSVTSIVVSLENKSAIVKYN
    PNLITVDVLRSAIEAVSPQTFKVSLLDKYENVALFPALASPLKSVKDAGQPLTQVVVINIEGMTCSSCVQSIEGVISQKA
    GVKSINVSLANHNGTIEYDPLQTCPEDLRSSIENMGFDASLPEKTELPVGITQPTSKEQLESAEPTSKMLRSFVAEQESK
    SLSKCYIQVTGMT
    CASCVANIERNLRREDGIHSVLVALMAGKAEVRYNPAVIHPSAIAELIRELGFGATVMENSGEGDGI
    LDLVVRGMTSAACVHKIESTLMKTNGVLYCSVALATNKAHIKYDPEIIGPRDIIQVIKDLDFTTALVKKDRSASHLDHRQ
    EIRQWRRSFFVSLVFCIPVMAMMIYMMVVDSQLSDAHQHLNMSNEEMEAIHSSMFLEHQLLPGLSVMNFLSFLLCVPVQI
    FGGWHFYIQAYKALKHRTANMDVLIVLATSVAFVYSFVILLVAMAEKAKVNPVTFFDTPPMLLAFISLGRWLEHVAKGKT
    SEALARLISLQATEATIVTLGPDNILLSEEQVDVELVQRGDIVKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVTKKP
    GNTVIAGSINQNGLLLISATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKISGYFVPFIVVVSVVTLFAWIIIGFVDFE
    IVEKYFLGYNKSISAAEVIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVNVVVFDK
    TGTITHGTPEVMRVKYLVENNRLPHNKMLAIVGTAESNSEHPLGAAITKYCKKELGSEILGTCTDFQVVPGCGISCKVTN
    IEPLLYRKNKMVEENNIKNVTLVKVEEHMEESVQPALIIDADLPTAVTSQKYSVLIGNREWMNRNGLLVKNDVDKAMIEH
    ERRGRTAVLVAVDGVLCGLIAIADTVKPEAELAVYTLKNMGLEVVLMTGDNSKTARSIASQVGISKVFAEVLPSHKVAKV
    KQLQDEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIKDDLMDVVASIDLSRKTVKRIRINFVFALIYN
    LVGVPIAAGVFLPIGLVLQPWMGSAAMAASSVSVVLSSLLLKMYQKPSSEKLEFRARGQMKQKSPSEISVHIGIDETGTG
    TRKLSLMDRIINYSRASINSLFSDKRSVNSIVLNEPDKHSLLVGDFGEDDDTTL

    >gi|118094662|ref|XP_422477.2| PREDICTED: hypothetical protein [Gallus gallus]
    MLDPEGSVEHKPSSSFPKVFLIPLAMLLAITALLLLAFSATQQKETDFYTFKVVNIRGKLVSLEKYRGSVSLVVNVASEC
    GFTDSHYKALQQLQKDLGPYHFNVLAFPCNQFGQQEPDTNKEIESFARKTYGASFPMFSKVAVSGAGAIPAFKYLIDSTG
    EEPTWNFWKYLVDPNGKVVKAWDSTVSVEEIRPHVTELVRKIILKKKDEL

    >gi|118098316|ref|XP_428969.2| PREDICTED: hypothetical protein [Gallus gallus]
    MEPTQDILSNLLFYSKSSQASQNVSKEFAEAARLLKKEAPRIQFGKIDVTDQHDLRKEFNIQEFPTVKFFVDGIREAPID
    CKGVRRASAFITWLKRQTGPSTVLINSTDQVEAIINADDLAVIGFFKELHNDSVEVFRETAKDVPEMPFGMTSSEDICAH
    YGIQTNALVVFKKGKPVHNEVLEDGRRNKLDLTRIIKTFTLDLVTEYNLETSVKIFDVPVENHILLFIPTNSETFNTTYE
    NYKSAAAEFRGKIMFVLVNTNETRNGRIFEYFRIREVDVPAVRILNLTSQAKYKMPADEVTVENVRHFCQSYLDGKAKLH
    LSSEEIAEDWDKMPVKVLVGQNFNRIVFNRTMTVFVMFYAPWSYD
    CRKLLPIWDELGEKYQSHKDVIIAKIDITANDVLS
    VAMDRYPFFRLFPAGPDIQEVPYVGEHNLEAFSEFLEEQIKMKAETREKYLEPMFGVCP

    >gi|86129578|ref|NP_001034418.1| peroxiredoxin 6 [Gallus gallus]
    MPGLLLGDEAPNFEADTTQGGIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFSKRNVKMIALSIDSVPDHLA
    WSKDINAYNGDQPVEKLPFPIIADKDRELAVKLGMLDPDERDKDGMPLTARVVFIFGPDKKLKLSILYPATTGRNFDEIL
    RVVDSLQLTAYKKVATPVDWKCGDSVMVVPTLPDEEAKKLFPKGVFTKDLPSGKKYLRYTPQPE

    >gi|118089172|ref|XP_420035.2| PREDICTED: similar to cytosolic methionine-S-sulfoxide reductase [Gallus gallus]
    MAASISILNDIGPSTSPWDKHHVNGNRMVEPFPEGTQMAIFVFHCLWGCERECWILENIYSHRESFSGSYKRSPQMTEIL
    HSRTGHTEVVRVVYQPENISFEKLLKVFWENHDPTQGMRQGNDFGTQYRSAIYTFSQEQMEAALKSKEEYQKVLTESGFG
    AITTEIREAPEFYYAEDYHQQYLSKNPNGYCGLGGTGISCPIGIKK

    >gi|118084001|ref|XP_416800.2| PREDICTED: similar to MGC82793 protein isoform 2 [Gallus gallus]
    MEAARRGPRAGVGSRALLLALLLHGAMGAEAEEPRPPRQRGDEQCHYYAGGQVYPGEAARVPVTDHSLHLSQAKISKPAP
    YWEGTAVINGEFKELKLTDYEGKYLVFFFYPLDFTFV
    CPTEIIAFSDRIEEFRAINTEVVACSVDSKFTHLAWINTPRKQ
    GGLGPMKIPLLSDLTHQISKDYGVYLEDQGHALRGLFIIDDKRILRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCP
    AGWKPGSETIIPDPAGKLKYFDKLN

    >gi|118084003|ref|XP_001234000.1| PREDICTED: similar to MGC82793 protein isoform 1 [Gallus gallus]
    MEAARRGPRAGVGSRALLLALLLHGAMGAEAEEPRPPRQRGDEQCHYYAGGQVYPGEAARVPVTDHSLHLSQAKISKPAP
    YWEGTAVINGEFKELKLTDYEGKYLVFFFYPLDFTFV
    CPTEIIAFSDRIEEFRAINTEVVACSVDSKFTHLAWINTPRKQ
    GGLGPMKIPLLSDLTHQISKDYGVYLEDQGHALRGLFIIDDKRILRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCP
    AGWKPGSETIRPEEAMRVWWPREEL

    >gi|71897021|ref|NP_001025898.1| dihydrolipoamide dehydrogenase [Gallus gallus]
    MQRWGRVSCALARRSHFDRVHHGLQGGCAVPQRTYADQVDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTCL
    NVGCIPSKALLNNSHLYHLAHGKDFASRGIEITGIRLNLEKMMEQKSSAVKALTGGIAHLFKQNKVVHVSGFGRITGKNQ
    VTATKDDGSTQVINTKNILIATGSEVAPFPGITIDEDNIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTA
    VEFMGHVGGMGIDMEISKNFQRILQKQGLKFKLNTKVTGATKKPDGKIDVAVEAAAGGKAEVITCDMLLVCIGRRPFTAN
    LGLEDIGIELDKRGRIPVNNRFQTKIPNIYAIGDVVAGPMLAHKAEDEGILCVEGMAGGAVHIDYNCVPSVIYTHPEVAW
    VGKSEEQLKEEGVEYKIGKFPFAANSRAKTNADTDGMVKILSQKSTDRMLGAHILGAGAGEMVNEAALAMEYGASCEDVA
    RVCHAHPTVSEAFREANLAASFGKAINF

    >gi|118104133|ref|XP_001231752.1| PREDICTED: hypothetical protein [Gallus gallus]
    MASSVVRATVRAVSKRKIQATRAALTLTPSAVQKIKQLLKDQPEHVGVKVGVRTRGCNGLSYTLEYTKSKGDSDEEVVQD
    GVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

    >gi|118089191|ref|XP_420060.2| PREDICTED: similar to Chloride intracellular channel 4 [Gallus gallus]
    MEDQTATYINQNVNNDNIYEMPDSEEDKGDHLYDRVLEDPASPSSTTTMPEMMDLSQESNEDSRSSSVASQHGPDEESSS
    SSEHSAADEHLYQDVGHMSPAQEDKPMTFESSEFCPPGFHLRRSQSTSTSPTSLKFPHGSNIGENNNSEEEYEIFMFVKA
    GIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEETLAPPKYP
    KLAAKHRESNTAGIDIFSKFSAYIKNTKQQDNAALERGLVKALKKLDDYLRTPLPEEIDANSTEEEKVSKRKFLDGDDLT
    LADCNLLPKLHVVKIVAKKYRNFEFPTEMTGLWRYLKNAYARDEFTNTCAADKEIEQAYADVAKRLSKS

    >gi|118091946|ref|XP_421267.2| PREDICTED: hypothetical protein [Gallus gallus]
    MAALRRCWWLAWGSRVSSWCSAPSRRGRAPLGPPPAAACALGRSLRWASSSSQPGPTESDSSEGQVYLSESCVKRLLEIA
    EGSEFLRLQVEGGG
    CSGFQYKFSLDTVINPDDRVFEQGGARVVVDVDSLAFVKGSMVDFSQELIRSSFQVMFPGSLQRVL
    FDLSPAEPSHLSNPVTQQFQMTPAVCV

    >gi|118098801|ref|XP_415290.2| PREDICTED: similar to Nfrl [Gallus gallus]
    MPRCGGAEPGAAQVSAGLRLREEHPAGKTGGCRYRAVSGSWYRLCGSTAGVEVKIEVVIPEKERSKEEMSPNGKASPLVY
    KVNGTARHYHLEEHPIASNPYHNPKDVVEASVCHVKDLENGQMREVDLGCGKALLIKEGGEFYAMGHKCPHYGAPLVKGV
    LSKGRVRCPWHGACFNIGTGDIEDFPGLDSLPRFQVKIEKEKVYIRASKQALQTQRRTKMMAKCISLSNYNLSSTNVLII
    GAGAAGLVCAETLRQEGFSDRIVM
    CTMDRHLPYDRPKLSKSMDSHPEQIALRPKEFFRTYDIEVLTEMQAAAVDIKNKTA
    VFKDGFKMEYNKLLIATGNTPKALSCKGKEVENVFNIRTPEDANRVVKLATSKNVVIVGASFLGMEVAAYLTERAHSVSV
    VELEEVPFKKFFGERVGRAVMKMFESHRVKFYMQTEVSELREQESKLKEVVLKSGKVLRADVCVVGIGAVPATGFLKQSG
    INIDSKGFIVVNKMMQTNIPGVFAAGDAVTFPLALRNNKKVNVPHWQMAHMHGRIAALNMLAHGTEISTVPYLWTAMFGK
    SIRYAGHGEGFDDVVIQGDLDELKFVAFYTK

    >gi|50750688|ref|XP_422097.1| PREDICTED: hypothetical protein [Gallus gallus]
    MAVPGQRAGAARCRGRFPLLLLGLTAFLLAFGYSLKLSPLIEKISDHKDFKKLLRTRNNVLVLYSKSAAAAESSLRLLSN
    VAQEVKGRGTISWIDCGDTESRKLCKKMKVDPNSKEKGVELLHYKDGAFHTEYNRAVTLKSMVAFLKDPEGAPLWEEDPE
    AKDIVHVDSEKELRRLLKKEDKPLLMMFYAPW
    CGVCKRMMPSFQQAATELKGKYVLAGMNVYSAEFERIKEEYNVRGYPT
    ICYFEKGKFLFHFENYGATAADIAEWLKNPQAPQPQAPEIPWADEENVVYHLTDEDFDKFIKDHSSVLVMFHAPW
    CGHCK
    KMKPEYEKAAEFLHAGSDSPGVLAAVDATVNKALAERYHISGFPTVKYFKDGEEKYTLPHLRTKKKIIDWLQNPEAPPPP
    EPAWEEKQSSVVHLAGEDFRESLKKKKHTLVMFYAPW
    CPHCKNAIPHFTTAAEVFKEDRKIAYAAVDCAKDQNHDLCKQE
    GVDGYPTFNYYNYGKFVEKYTGERGEAGFTTFMRTLRERDHERVGKKKDEL

    >gi|118100161|ref|XP_425400.2| PREDICTED: similar to Nfrl [Gallus gallus]
    MDCNDTVTAEVCREDDIGDGELCEVMVAGYPVLLVRDKMEFSALGSRCPHYGAPLSKGVLRGHRLRCPWHGSCFNIKTGD
    IEEYPSLDCLPCFKVTVEDGKVFVTAKKKDLESSLRVKDMSKRCLLNRNTMLLLGGGVAALTCAETLRQEGFTGRIIMAT
    KEKHAPYDKSKLSKEMNLKAEDIYLRKPEFLCAHGIELWTEKEAASVDFQKQKVHFMDGSSQKYNQLLIATGGHSSFLKV
    PGADLQNV
    CHLQTPEDASKVLELASGKNLVIVGASFIGMETAAFLSDKAAAISVVEKQEFPFQKTLGPQVGGVVLKMLQS
    KGVKFYMKKELHELKGKDGKVAEAILASGEKLPADVVVVGIGVTPNSAFLKGTSIAKDNSGAILVDLRMQTNIPNVFAAG
    DVVSFPVALLNGDHSSIHHQQVAEAHGSIAAFNMLKKQKELHTVPFFWTTMLGRSIHYAGCGKGYTDTVLKGSLEEQKFL
    IFYLKDGFVTAAASLNCDPAVSLIAEVLYLGEKISKEEAEPLPAGAPLPAPADGPRRSDVTVTSAAARGPAALPMYGHRA
    PAPLPPHRRRRLRGRRPLEGARLRARPRAGLPPGLLPCSRLS

    >gi|50751219|ref|XP_426634.1| PREDICTED: similar to phosducin [Gallus gallus]
    MDINSLGLVCIQTLSIRTGPKGVINDWRKFKLESEDKDSLPLSKKEILRQMSSPHRSFSKDDKDTRERFCRKMSMQEYEL
    INDEKEDESCLQKYRKRCMQDMHQRLSFGPKYGYLCELQNGEQFLEAIEKERKTTTVIVHIYEDGIKG
    CNALNSSLTCLA
    AEYTTVKFCKIKASNTGAGDRFSDEVLPTLLVYKGGELLSNFISVSEQFNEEFFAVDVESFLNEYGLLPERELPALGNVN
    TDEQDVE

    >gi|57530789|ref|NP_001006374.1| thioredoxin domain containing 5 [Gallus gallus]
    MASLRSGPAWCRLLAWAALGPVLCGGSMQAEPEPGEEPEADPHARHLYSAEMLRHGAVAAPHFVMFFAPWCGHCQRLQPT
    WNDLGDKYNNMENPQVYVVKVDCTADTPLCSEFGVRGYPTLKLLKPGQEPLKYQGPRDFQALENWMLEKLNGEPSDPESA
    VEPPKAPEPKQGMYELSADNFKTHIAEGNHFIKFFAPW
    CGHCKALAPTWEQLALAFEHSETVKIGKVDCTQHYEVCSENQ
    VRGYPTLLWFRNGEKGDQYKGKRDFDSLKEYVDSQLQNSGKEPPASKPTEAPQPPAEPTQAEQAAVLSLSEKDFDETIAR
    GITFIKFYAPW
    CGHCKNLAPTWEILAKEQFPGLTDVKIAEVDCTVERNVCNRFSVRGYPTLLLFRGGKKVSEHNGTRDLE
    SLHSFVLRQARDEL

    >gi|57530768|ref|NP_001006370.1| protein disulfide isomerase family A, member 4 [Gallus gallus]
    MAQLAVLVAQEDGRESVTQEVDGDDDEEEEDDDDDDNSEVKEENDVLVLNDANFDTFTADKDTVLLEFYAPWCGHCKQFA
    PEYEKIAKTLKENDPPIPVAKIDATAATALASRFDVSGYPTIKILKKGQPVDYDGSRTEDAIVAKVKEISDPNWTPPPEA
    TLVLTQDNFDDVVKDADIILVEFYAPW
    CGHCKRLAPEYEKAAQELSKRTPPIPLAKVDATAETELAKKFDVTGYPTLKIF
    RKGKPYDYSGPREKYGIVDYMIEQAGPPSKQIQATKQVQEFLKDGDDVIIIGVFSGETDEVYQLYQEAANSLREDYKFHH
    TFSSEIAKLLKVSPGKLVVMQPEKFQSKHEPKMYVLDLKYSTSESEIKEHVVKHALPLVGHRKPSNDAKRYAKRPLVVVY
    YTVDFSFDYRVATQYWRGKVLEVAKDFPEYVFAVSDEEDYSSEIKDLGLLESGEDVNVAILDEGGKKYAMEPEEFDSDAL
    RQFVLAFKKGKLKPIVKSQPVPKNNKGPVKVVVGKTFDTIVMDPKNDVLIEFYAPW
    CGHCKKLEPVYTELGKKYKNEKNL
    VIAKMDATANDVTNDHYKVEGFPTIYFAPRDKKNNPIKFEGGDRDLEHLSKFIEEHATKLSRTKEEL

    >gi|118097918|ref|XP_414848.2| PREDICTED: hypothetical protein [Gallus gallus]
    MAAPSEGRPGRGASSFPGTESGPFAFPFTVPSGAAGSGAEEQPKKPCRACTDFKSWLREQKKQAAAGAVAAVEEKEPPPD
    CPLDSEQLGRSTWAFLHTMAAYYPERPSGTQQQEMRDFIHLFSKFYP
    CEHCAEDLRERLRTNQPDTSNRNNFSQWLCLLH
    NEVNRKLGKSEFDCSRVDERWRDGWKDGSCD

    >gi|50757382|ref|XP_415498.1| PREDICTED: hypothetical protein [Gallus gallus]
    MAAAGRAWRVAALLPPWRLRAPCRSLGSAARGAAAGGSRLLLGAAFALGGGAGLCLAARQRLREHSAAELPAGNLQLTLY
    QYKT
    CPFCSKVRAFLDYHGLPYEIVEVNPIMRKEIKFSSYRKVPILLADAGSPLQLNDSSVIISAIKTYLISKRNSLEEI
    VSFYPPMKTVTEQGKEVLEYGNKYWLMLDEKETKRVYPVKEVRVEEMQWRKWADDWLVHLISPNVYRTPKEALASFDYIV
    REGKFGTVEGFFAKYMGAIAMFFISKRLKKRHHLRDDVREDLYEAVDKWVKAIGKNRLFMGGSQPNLADLAVYGVLRVME
    GLEAFDDMMVHTKVQPWYQRMEEAIQKAAA

    >gi|57530538|ref|NP_001006329.1| methyltransferase like 2B [Gallus gallus]
    MAAPSEAPERRRPFGRRFLTDPTRLFQHNAWDNVEWSEEQEATAKSKVQENSSQLLPQDKQEEYEVNAKRYWDDFYKIHE
    NGFFKDRHWLFTEFPELAPNRNPSQNEDSLCEFSCKEVSKNEGLGSCENGHCTLENRAENQLNLLKSSPRFCTEELAPQK
    LKQSYEDYPGSSASYRILEVGCGAGNTVFPILQTNNDPGLFVYCCDFSTTAVDLVQSNVEYDSSRCFAFVHDLCNDQSPF
    PMPDESLDIVILIFVLSAILPEKMQCVINKLSRLLKPGGMILLRDYGRYDLAQLRFKKGQ
    CLSANFYVRGDGTRVYFFTQ
    DELDDLFTRAGLQKIQNLVDRRLQVNRGKQMTMYRVWIQCKYQKPAGPQL

    >gi|118098391|ref|XP_415076.2| PREDICTED: hypothetical protein [Gallus gallus]
    MAALWRRGERFLGVPGLCRTARALSGKKEYDLLVIGGGSGGLACAKEAAQFGKNVAVLDYVEPSPRGTKWGLGGTCVNVG
    CIPKKLMHQAALLGGALKDAQHYGWSVAHPVHHNWSVMAQAVQNYVKSLNWGHRVQLQDKKVKYFNMKGSFSDSHTVCGI
    AKGGKETTLTAEKIVIATGGRPKYPTHITGALEYGITSDDLFWLKDSPGKTLVVGASYVSLECAGFLTGIGLDTTVIMRI
    IMRSIPLRGFDQQMASLVTEHMESYGTKFLKKCVPAKVEKLESSRLQVTWKNTELGTEETDSFDTVMWAVGRVPDIKTLN
    LDSVGVKTNSETGKIIVDASEATSVPHIYAIGDITEGRPELTPTAIAAGKLLARRLFGHSSELMDYDNVPTTVFTPLEYG
    CVGLSEEKAVQCYGSDNVEVFHAYYKPLEFTVAERDAAQCYIKMVCLREREQRILGLHFIGPNAGEVIQGFALGIKCGAT
    YPQLMKTIGIHPTCAEEITKLHITKRSGLDATVTGC

    >gi|50796088|ref|XP_423834.1| PREDICTED: similar to LOC495339 protein [Gallus gallus]
    MEPLTAAYPLKYSVPKARVFVVFLSMVFCTAVLCLLQLRFFKPKTKDFYSFEIKDSRGRIVSLEKYRGKATLVVNVASYC
    QHTDKNYIALQDLHREFGPSHFTVLAFPCNQFGESEPGSSQEIEAFAKGNYGVTFPVFHKIKILGSEAEPAFKFLIDSSK
    KEPRWNFWKYLVSPEGKVVKFWRPEEPIESIKPEIASLIRQIIMKKREDL

    >gi|118101587|ref|XP_417741.2| PREDICTED: similar to Chain A, Crystal Structure Of Soluble Form Of Clic4 [Gallus gallus]
    MREMQLMAEEYTAFAVQCVHAHQLSDLGHLWDGFLWDITEKWAAMQFLRVTLMGCSAESSWEFTFNKYPLKCSAVGNHAG
    IWRAGSDGESIGN
    CPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITYNGEVKTDVNKIEEFLEEVLAP
    PKYLKLSPKHPESYTAGMDIFAKFSAFIKNSRPEANEGLERGLLKTLQKLDEYLNSPLPDEIDENSMEDITVSTRKFLDG
    NEMTLADCNLLPKLHIVKVVAKKYRNFEIPKEMTGIWRYLSNAYSRDEFTNTCPGDKEIEIAYSDVAKRLTK

    >gi|118097028|ref|XP_423750.2| PREDICTED: similar to ubiquitin-activating enzyme E1C [Gallus gallus]
    MADGEEPMAVDGGYGDSGDWEGRWNHVKKFLERSGPFTHPDFEPGTQALDFLLSTCKVLVIGAGGLGCELLKNLALSGFR
    QIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNSRIPSCAVVAYFKKIQDMDESFYRQFHIIVCGLDSIIARRW
    INGMLMSFLRYEDGVLDPSSIIPLIDGGTEGFKGNARVIIPGMTACVECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVR
    ILQWPKEQPFGEGVALDGDDPEHIQWIYQKSLERASQFNIKGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATS
    AYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIEISPSAKLQEILDYLTNNASLQMKSPAITATMYGGNKTLY
    LQTVASIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTMLFKLHFTT

    >gi|118104643|ref|XP_001231797.1| PREDICTED: hypothetical protein [Gallus gallus]
    MSGSRLLRGLPKHLPLLAAGGFRRKPRVATRCHAYSTTEDSSSRPIGRYPVPNKKDMPYDIVELMEEVEVKTGFLPNVFK
    AMSHRPAEFRAFFAYYNVIMNKETGRLSKADKELIIVATSAVNRCPY
    CVVAHGALHRIYSKQPTLADQVVVNWKLADLSG
    RDLAMLEFALAVCRADNITEEHFQKLEAHGFDREDAWDIAMISAFFAMSNRIAHFVDLRPNNEFYNMGRTPHEARRDRT

    >gi|118085664|ref|XP_418593.2| PREDICTED: similar to putative selenoprotein O [Gallus gallus]
    MRPSRRVAAALSPARGEGGGLPRLLVPGALACLVWVCGARNPPEAFCPAVPGPNASRLEQSCDRERAAAGIGAWSLSLGS
    LLDPFPIDPIQENYVRNEVIEDILDLHISVKETSDFLQFVSGEKVLHGSVPLAHRCGERWELQLKGSGKTPYSRNGDGRA
    VLRSSVREFLCSEAMHYLGIPTSRAASLVVSDDAVWRDQFYNGNIKKERGAIVLRLAKSWFRIGSLEILAHSGELDLLRR
    LLDFIIHEHFPSIVPNSSDRYLEFFSTVVSETANLIALWMSVGFAHGVCNTDNFSLLSITIDYGPFGFMDSYDPNFVPNT
    SDDEGRYKIGNQANVGLFNLNKLLQALKPLLDPRQKQLASHILEEYGQTYYVRFTELFKRKLGLLGDSEDDNYLIAFLLK
    LMEDTKADFTMTFRQLSEITAEQLKELHIPEEFWALQDLGKHGLFSEWVAMYLSRLDGNRDDSDIKRRKRMTTVNPRYVL
    RNWMAESAVRKANLNDFSEVQLLQQVLQHPFQRQQAAEKAGYALRPPAWARDLKVS
    CSS

    >gi|45383890|ref|NP_989441.1| 58kDa glucose regulated protein precursor [Gallus gallus]
    MSVPRPSRAALLLLVPLLALSAGASDVVELSDADFESGLAERPGLVLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLVK
    VDCTANSNTCNKYGVSGYPTLKIFRDGEESGTYDGPRTADGIVSHLKKQAGPASVALSSVADFEKFIGDKDASVVGFFRD
    ASGDAYSEFMKAANNLRDNYRFAHTSEEQLVQKYEEDGEGVVLYRPSRLANKFEDSTVKYTEDKITSAKIKKFIQENIFG
    ICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMIAKKFLDAGHKLSFAVASRKTFGHELSEFGLDNSVGE
    APVVAIRTAKGDKFVMQEEFSRDGKALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFY
    APW
    CGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGREVSDFISYLKR
    EATSTPVLQEEDKAKKSKKKAKEDL

    >gi|57530273|ref|NP_001006411.1| hypothetical protein LOC421792 [Gallus gallus]
    MAACGWCRCRAVLALRAAGSSLWGRRGAAPEPRALHVPSPSLCSERESSVSYQELKDLKKANVLHIDVRERWEIERDGKI
    PASVNIPLNELVEALQMNPADFKEQYNQKMPAKSDHVVFS
    CFAGTRSRQALSFAASLGFSRVQHYAGGFEDWAKHETPEK
    K

    >gi|50728294|ref|XP_416074.1| PREDICTED: hypothetical protein [Gallus gallus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKDCKVVFSQEELRKRLTPLQYHVTQEKGTESAFEGEYTHHKAQGIYKCV
    VCGTPLFKSETKFDSNSGWPSFYDVISPDTITLTDDFSYGMHRIEISCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFK
    PAEKNSAGEGSGSTRPAQTGKAEL

    >gi|118088842|ref|XP_419855.2| PREDICTED: similar to 5 nucleotidase, ecto [Gallus gallus]
    MAYGLSALCLWLWLNAAAGLRLTLLHTNDVHAHVEARGCAEGPRGCFGGVARRAARVAAERAAQRNVLLLDAGDQYQGSV
    WFSRFKGQEAVHFMNLLRYDAMALGNHEFDEGVRGLLNPLLRNASFAILSANIKGKTPLGNQMMKYVHPYKILHIDSEKI
    GIVGYTTQETSFLSQPGNDVIFEDEIEALQVQVNKLTAMGVNKIIALGHSGFTVDINIAQKVKGVDVVIGGHTNTFLYTG
    TPPSTEQPAGPYPFMVDSDDGRKVPVVQAYAYGKYLGYLNVTFDEKGNVVEAVGNPILLDSSVPEDEQIKEEVEKWRKNL
    GNYSKEIGTTSVYLNGTSEACRFQECNMGNLLCDAMLYENVRRPDRKSWNHVSLCILNGGGIRASIDERNANGTITMEDL
    LSVLPFGGRFDLVTLKGSTLKEAFEHSVRRYGRGTGELLQVGGIHVVYDLSRAPGHRAVSIEVLCTACRVPAYVPLEMDE
    VYNVTLPSYMLFGGDGYYMLRDNHITYSKGEPDIEVVSRYLDRMKRVYPAVEGRIKFSSGSLIQGSLTLISALLTVTFWH
    C

    >gi|57529823|ref|NP_001006504.1| NHL repeat containing 2 [Gallus gallus]
    MAAEGLAGLLPAQTQLEYALLDADTPQEKENLVYQYLKKMDSRERDLTVPELSRDLQWLNTEGPISLHKDLCGKVVVLDF
    FTYC
    CINCLHLLPDLHELEHQYSDKDGLVIIGVHSAKFPNEKVLDSIKSAVLRYNIVHPVVNDADATLWHELEVSCWPTL
    VILGPRGNMLFSLVGEGHKEKLFLFTSITLKFYKERGQIKDNSIGIKLYKDSLPPSPLLFPGKVTVDKSGERLVIADTGH
    HRILVTLKNGQILHTIGGPNSGRKDGRFSEAAFNSPQGVAIKNNVIYVADTENHLIRKIDLELEIVTTVAGIGIQGVDKE
    GGAKGEEQPISSPWDVVFGNSVSGTQEDDVLWIAMAGIHQVWALMLEGGKLPKGSDLKKGVCLRFAGSGNEENRNNAYPH
    KAGFAQPSGLSLASEEPWNCLFVADSESSTVRMISLKDGAVKHLVGGERDPLNLFAFGDVDGAGINAKLQHPLGITWDKK
    RKLLYVADSYNHKIKVVDPKMKNCATLAGTGEASNVVGSSFTQSTFNEPGGLCIEENGRLVYVADTNNHQIKVLDLETKI
    LSMLPILNPETCDVTDNLSVQKDQIANLPKLPKSAPNIQLPSLSAAPGQTIQFLLKLTLPPDSKLNEEAPNAWFITAEDN
    NTWLLQGQCLSGEIKDVSCQTVIPFQLPRVCLSAEAVLAIKACLYYCSKDSSACMMKGISFNQPLQIGSTNQGRLTQVEL
    THSFITN

    >gi|56605958|ref|NP_001008472.1| glutaredoxin 5 homolog [Gallus gallus]
    MSGSLRAALRLGVWAARGRPGRRHLSEAASGSAGGSGGADGGGSGSREAVERLVREHPVVVFMKGSPAQPLCGFSNAVVQ
    ILRLHGVEDYRAHDVLQDPDLRQGIKNYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALLDAEKDQE
    KK

    >gi|50749765|ref|XP_421747.1| PREDICTED: similar to glutathione-S-transferase homolog isoform 2 [Gallus gallus]
    MAGDHSRSLGKGSAAPGPVPEGVIRLYSMRFCPFAQRTRLVLRAKGIRHEVVNINLKNKPDWIFEKNPDGLVPVLETSKG
    QLIYESPITCEYLDEAFPGRKLMPSDPYERALQKMLLEHFSKITSVISKALKEGGDLTALTAELAEKFGKLDEILSQRNT
    VFYGGDSTSLIDYMMWPWFERLEAFQLKDVLTHTPKLQHWMEAMRKDPAVKDTITDTQTFRSFLQLYFKNSPEACDYGL

    >gi|118092968|ref|XP_001232808.1| PREDICTED: similar to glutathione-S-transferase homolog isoform 1 [Gallus gallus]
    MAGDHSRSLGKGSAAPGPVPEGVIRLYSMRFCPFAQRTRLVLRAKGIRHEVVNINLKNKPDWIFEKNPDGLVPVLETSKG
    QLIYESPITCEYLDEAFPGRKLMPSDPYERALQKMLLEHFSKVLHDQGGIITSVISKALKEGGDLTALTAELAEKFGKLD
    EILSQRNTVFYGGDSTSLIDYMMWPWFERLEAFQLKDVLTHTPKLQHWMEAMRKDPAVKDTITDTQTFRSFLQLYFKNSP
    EACDYGL

    >gi|118092981|ref|XP_421735.2| PREDICTED: hypothetical protein [Gallus gallus]
    MAAPCRDCAPQDRISQDLIHREVQDYYGRELQKSEDLKTNACVTLTRPVPKAVRDALQRVHEEVVARYYGCGLIIPECLE
    SCRVLDLGSGSGRDCYVLSQLVGEQGHVTGIDMTEAQVEVAKKHIAYHMEKFGYQKPNVEFLQGYVENLGDVGLADESYD
    IVISNCVINLTPDKRAVLREAYRVLKPGGEMYFSDVYANQHLSEAMRKHRVLWGE
    CLAGALFWRDLYSIAKEVGFSPPCL
    VTASPITVSNEELERIIGDCRFVSATFRLFKVPGSSRAAPGQVIYNGGIAGHERELEFDASFTFKVGEVVDVDAEMAAIL
    QSSRFAEKFLIRAGGTDGAAPQGCCCGKMKGEDL

    >gi|45382053|ref|NP_990784.1| thioredoxin [Gallus gallus]
    MVKSVGNLADFEAELKAAGEKLVVVDFSATWCGPCKMIKPFFHSLCDKFGDVVFIEIDVDDAQDVATHCDVKCMPTFQFY
    KNGKKVQEFSGANKEKLEETIKSLV

    >gi|118110988|ref|XP_001231691.1| PREDICTED: hypothetical protein [Gallus gallus]
    MSQQLLYRALVSAKWLSEAIKSKQTGQALKVVDASWYLPKMKRDPKQEFEERHIPGAVFFDIDQCSDRTSPYDHMMPKAD
    EFAEYVGKLGVGNDSHVVVYDGSDQGLFSAPRVWWMFRVFGHEAVSLLDGGLKNWLREGFPLSSGKTQVAPSDFHATLDK
    CMVKTYEDILDNLDSHRFQVVDARVEGRFRGIEPEPRDGIEPGHIPGSLNMPFTSFLTESGLEKTPEQIRSLFQEKKVDL
    SKPLVAT
    CGSGVTACHVALGAYLCGKPDVAVYDGAWVEWYMRAQPENIISEGKGKTV

    >gi|50736203|ref|XP_419079.1| PREDICTED: similar to Thioredoxin domain containing 4 (endoplasmic reticulum) [Gallus gallus]
    MRPAIFLLPPQPGRLFLLLVSWLFNPTRSEITSLDSGNIDDILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEEYP
    DKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADYIRQQKSNPIREVQDLEEINTVDRSR
    RNIIGYFEQKDSDNYRTFERVANILHDDCVFLSAFGAISKAERFSGDNIIYKPPGENAPDMVYLGSLTNFDLIYAWTQDK
    CVPLVREITFENGEELTEEGLPFLILFHMKDDLESLEKFQQEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPTDCPV
    IAIDSFRHMYVFPDFNDLSVPGKLKQFVLDLHSGKLHREFHHGPDPTDVAPGQPIQDVASSPPESSFQKLAPSEHRYTLL
    REKDEL

    >gi|118104187|ref|XP_423839.2| PREDICTED: similar to MGC83491 protein [Gallus gallus]
    MVDVFSGRLLVSKDGRSVDPEEALQNKVVGLYFSAGWCSPCRDFTPVLCDFYTDLLEECQPPAPFEVVFISSDHSAEEMV
    SYMHSMHGDWLALPFHDPYKHRSAQGARRRHNQES

    >gi|118086300|ref|XP_001232091.1| PREDICTED: similar to Dim1p homolog isoform 1 [Gallus gallus]
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY

    >gi|50733538|ref|XP_418903.1| PREDICTED: similar to Dim1p homolog isoform 2 [Gallus gallus]
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY