Eremothecium gossypii uid10623

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|45184728|ref|NP_982446.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MSLYSLITPKAFSELLHRNTGKRIVPVDATWYMADKERDLAKKEFMELERIHNAIFFDIDVFMDQKSPYPHMLPSLETFN
    EEMGKLGIREDDILVVYDRCSNFSASRAAWELTTLGHETVFLLTGLNAYKEEGYPLDITQVDSVTPYEPTSYTSCTSHAK
    EQVITYEELHHLVETGEIKHYNFFDMRTLPRFLGEAPDPRPGVPSGHVPGAQPMPYAEVLEGGNYSNTVEGIQSRIAASL
    SEHGTRLDCSKHSIVM
    CGSGVTACTVKTAFEACGYVPVRLYDGSWSEWGRRAEPRYIAIGRDW

    >gi|45184949|ref|NP_982667.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MPSMTSTVHSNGGIGRFLSEIPLVTRGLLLALLLWCFNAFMRFSQLQVLVFAWNFRRHDYEFWRLYGRFIAVNSNSAAAL
    LALYQIYRNSSSLELDYFQANPVDYAFYLAFCTTTCAALTAACHALLGIEPGSLFPALDGMLLYTWALLNANVTVNYIVF
    NIRGKYLPLLNLFVHMLGGEPSGVLIILLGYAAAYIYCCLETRTAGPLYGKLAGLPHYGYPTLRDSHFRGSALLAPLIAT
    QSGGPPSAAAAVSGNFRGKGRRLHDGKAVAAPRHAARAAGTGAVVPLTSTSALAAALAGPGLAVIDFYAVW
    CGPCKQLAP
    LLDQYAAKHTAVRFYKIDVDRFPGVAATHEVHAMPTVLFFRAGKEVARVQGANPSAIRAALQSYS

    >gi|302306578|ref|NP_982983.3| hypothetical protein [Ashbya gossypii ATCC 10895]
    MPETSVSVSQKSYSAGPSGRTIVYDEDGKPCRSCNTLLDFKFATNALHGKVADSTGAVPEAAAAAATVSANIPGSKHYRQ
    VEPADVEELGRSSWTLLHTAAAKYPRQPSDAQKQEMRQFLSIFSHIYP
    CNWCAKDFEQYIRDRAPRVDSRDELGQWMCEA
    HNDVNQKLGKELFDCNFWKKRWLDGWE

    >gi|54299370|ref|NP_983191.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MPYPKVAIVFCTGCRWGLRASWYAQELLQTFGDSLAEIALVPGPSGQFQVLCYASQEQEATDSGNTIWDRRRDNGFPDSK
    YLKQAVKATLFADSGPALGAHIARAAPAALLKAPAEPLQHCDDCVGDT

    >gi|45185491|ref|NP_983207.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MSNTLRPQIYVGCKAPNFQVQSSQGIIDFYDYIGDSWCLFFSHPADFTPVCTTEIGALASLAEEFAMRRCKLLGLSTNNR
    ATHVKWLKDIERVTGFRVNFPLLCDVDRRLSTVFGMLDARTLDADGHPVPLRSTYFVDPNKVIRLVQSYPLSTGRNTAEL
    LRCLDSLQLSDATSHQFMTPVNWIPGDDVVLAPDLDAPTMQEKYPEHRTIRDYLRLAPFDPDQLDR

    >gi|45185557|ref|NP_983273.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MVSEIKSLSEFESAVGSDKLVVVDFYATWCGPCKMIAPMIEKFATQFQEASFYKVDVDAAAEVAHKYQITSMPTILFFKN
    GQAVDKVVGADVQSIRTKIAQHL

    >gi|45185579|ref|NP_983295.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MLAAATRYRLGQALQTRMVHHKVTIIGSGPAAHTAAIYLARAEIKPTLYEGMFANGVAAGGQLTTTTEIENFPGFPDGLT
    GSDLMERMKAQSVKFGTEVVTETVAKVDLSARPFKLWTEFNEDEEPTTTDAIILATGASAKRLGLPGEETYWQRGISA
    CA
    VCDGAVPIFRNKPLAVVGGGDSACEEASFLTKYGSKVFMLVRKDHMRASTIMQRRVERNEKIEVLYNTAPVEAKGDGSLL
    DALRVRDTRTGEESDLPVNGLFYAIGHTPATQLVAGQVDLDESGYVKTVPGSTLTNVPGLFAAGDVQDSRYRQAVTSAGS
    GCMAALDAEKFLSELE

    >gi|302307013|ref|NP_983488.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MEVTGLEAEMARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIE
    DCGFEARVGGCAREEQVRRLARAEETAQWRRRAAQAWAAAAVMMGLYMVAPLEEALGPTPLAGLFWRDVAGLAVASGVLA
    TAGRPFLRGLGALRHGRGTMDTLVALSSGVTYLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLESRARARAA
    DSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPGSRVLCG
    SVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNN
    SNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDKTGTLTTGKLTVHNFTS
    ESKALTPDQWALVCAAERLSEHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVEHRITIGSARLLPE
    GPSKFSGSTASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEG
    KCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLSGNSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVKL
    NIFWAVLYNSLMLPVSMGVLIPWGIQLPPMAAAAGMAMSSVSVVTSSLLLARWRPVPAASRKAAVGSWRNFFKKGPRADQ
    VELQHLAPEV

    >gi|45185861|ref|NP_983577.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MKLHRQKVLSIVAAAAIVGLWYMFFGQQLSNRETYDPDVVPQQEGRTPAAVRAAADKNQAPMIKGSIMPGMPDPTAKQEL
    GRATWKLFHTMLARFPDEPSEQEREKLHTFLHLLAELYP
    CGECSVHFVSWLKKLPPQTSSRSAAATWGCSIHNKVNLYLG
    KPAYDCSKILEDYDCGCGDDAAAGSLKVSVHTERPQGG

    >gi|302307169|ref|NP_983747.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MQLNKLMLGFMLCASALADDGQQAAEPHTSANFCKIDKDQQVGSTCDITFHELNEINEQIRPQLARLVKTDFFRYFKLDL
    YKECPFWSDNNGY
    CVNRACAVDVVDDWESVPDIWQPEVLGGLDEDSVKSEGGESDECSFLNELCGRRREFARPEPLSIDY
    CDVTDFTNKDSVLVDLVANPERFTGYGGEQSAQIWSAIYKENCFTLGEQGFCLAKDVFYRLISGLHASIATHLSNDYLDT
    KTGKWGPNLELFMARVGNHPDRVANIYFNFAVVAKALWKIQPYLERVEFCNVYDTNVKDMISNVVSRLDSRVFNEDLLFQ
    DDISMRMKDDFRRRFKNVTKIMDCVHCDRCRMWGKVQTTGYATSLKILFEMDAGDEKARQRVVDKLTKYELIGLFNTFDR
    ISKSVNAINNFERMYHSQMETNTSSIAAFFQNNFFRLGFTETEDQETSNATADMPLPEDSASDNEPYFADLKIPARRSKK
    QTKEESTSALQQELQGVYHALQFIWNSYVNLPRNLLILVLDVANTWFNNFIGVPTQINILGDDASD

    >gi|45187539|ref|NP_983762.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MFKRILARPPAGLPRPLAFYSAARLRGLRWQSSANVLAGDGAGPLVTPTRVVNGDPSLRLNITQRAAQRLGEIYRSSGEV
    LRVGVESGG
    CHGFQYNLALQPRPESQPSGADASEFDEFEDRKDIVYVLPEEQGEVVIDHASHEILNNTTLTYTTELIGST
    FRIIGGKMTSSCGCGSSFDFDGQS

    >gi|45187540|ref|NP_983763.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MRAREDSLARCRVLVLGAGGLGCELLKNLALLGIPELHVIDMDTVELTNLNRQFLFRETDIGHPKAAVAARYINGLALPS
    VVPGRGVRVEPHVGDLTQQPSAFWEGFTAVISGLDAIEPRRHANALLVRLTLSSNYAKCIPLIDGGSEGFAGHCKTILPG
    ISACYECSLDTLAPPGLAFPL
    CTIANKPRLPQHIVMYVLTVEWPTAPFQAGCSFDDPEAVAWLAQRCATRAAAFGMNAAA
    FTTAYVLGVAKRIVPSVASTNAIVAAACCSELLKLVHDLTDPENMNNFLQYNGAEGCFAYSFTHQRLPSCPVCSQGDGC

    >gi|45187719|ref|NP_983942.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MYLIGPTRGVQSMFSSFRLASRHTTSVLRTFHTSKPIMLQAGDAIPKSIPGLHENSPGNSVDIGAEVASGKHLIVGVPAA
    FSPA
    CSSSHVPGYIQHLDELKSKGFKQVLVTCVNDSFVTKAWAESLKCPSDVRVIADTQGAFASAGGFLFDGKQTFGNDR
    SVRYALVVEDGKVVRDFVEPDKTGLKVSAAENVLKEL

    >gi|45187856|ref|NP_984079.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MATELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTEAPKKEAGAAKKVETPKKAAAAEAS
    TGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPG
    CTRQACGFRDNYQELQKHAVVFGISADSVK
    SQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKKSLAGN
    PGKT

    >gi|45187866|ref|NP_984089.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MWVTLRVCIYVSLFAGRVFSASVGTPATEPAGEQEKMPEPLTSVDFSSTMSTGLHMVEFYSPLCHHCKLFAPTWEKTWKE
    FHKKGARMGISMAQVECLQSGDLCKQENVVSYPSIRLYGPAGYIKDYPHMERDQESLVQFMMAEARNKNNMELMGLESKS
    EPLNKKRFNQLLEAGVESPTLISFWPAPEVADITKVTQFRNCRYCAAFRNTWKLLSNRADTEGISTFHFSCYLNGDLCRK
    VGLERLTKRSGDGEKIPALALLLPNVDSLIFYERDSYAFEDFLDFVLRSYSNYLAPHISPEEVAKMLLTVPKVSDISEGF
    AGKTILLYNPAPTTNAEKDGKLLHSLLRELDGIPNVYIYKFEGRLKKNIDRMLDRIYTTLLERASQELVGLNKELFHLRT
    LSVGDPLFIMFKECSRTPIALQNQVDQEDISSRAIQWIKENSYPYLRDFTRTSGKPLLKGKDSPRKPVVIQVLDTSNEQE
    VKSSKNIKGFFDVISKFEGTWDEYVYKGLSRLYGDKAILKIVNGNDKTETAFLSEINEKLTENYNGVLYGYIDKSSKKAL
    KRLGLNVHDYELENGDVLIVDEKGKFYYAKGLDGSRMTVHSPEHVVDAIRALVFPESGKSRNDLRRFLVGSPFGPRWRFF
    EHIHQYGFLGWFLLIVAVFFALRLPRIYKKYVQRKKYAARHDTMGILGKEGAFPE

    >gi|45187926|ref|NP_984149.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MFATYSASILRSTLPLRSVGVRLLSQETRRAIEGAISSAPVVLFMKGTPEFPQCGFSKAAIEILGRQGVDPAKFAAFNVL
    EDSELRSGIKEYSEWPTIPQLYVNKEFVGGCDILTNMAQSGELTTMLEEASVLVPDTE

    >gi|302308087|ref|NP_984877.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MLPKSNSKFISRRGMRMLLVTGVLLVLTYFIIQNGTTSDQFVTPIAPRPVPNAPSVQDTVEAEEPSVQLLSKGAEGAVAA
    SKEDVDVARAQQQSKVLFDAAKTYNEILSLSSMVVFSKST
    CPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQKYVT
    KTTARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKITVTQKQRPSNS

    >gi|302308101|ref|NP_984899.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MRVCSVFLLVWGAVALASVVSIKSEDQFYALVDNGRYSLIKYYTAWCSHCKHLAPVFVELSDRELAMPAGAEVQFLEVDC
    DRFGNSLCARLPGFPVLELVRPSAQDGPEAAPQPPAAGGWRRVLHWLHALLPQQHPFRVPEDRIAEFRGSRTADTIASFI
    QQVVRNDRLEELAQRVLDGAAQEDEPLVHNGRAYLASVAGKDLREERNRLETLLGSDVGISKAEELRLHLSIVSKLQEAD
    SALLDDEL

    >gi|45190851|ref|NP_985105.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MTGESLDGSLHALTIELDALRRENANLKQQLKEKDGACGELPMSLEEFQRYGRQMIVGETGGLSGQVKLRSARVLIVGAG
    GLGCPALQYLAGAGIGHLGIVDNDVVEESNLHRQPLHDTSKVGLLKCDSAKEALSRLNPYCSIKTYPVRLSYANAFEIFP
    SWDLILDCTDSPMSRYLISDVAVNLGKTVVSGSGLGTEGQLSIYNFENKGPCYRCFYPIPPRPGSVVS
    CQSGGVLGPCIG
    VLGIMMAVEALKILFGIYTLENFKPFLMQYSGFPYQTLRMFKMRNRKQGCLCCGDNPTITKSTIESGHIKYEAFCGAINY
    DVLSKDERLSASEFEANYWSQKERGFVCLDVRPRLHYEISHLPGTYNMTVKELDEMEGSIEELQKHIPVITPDLDIVVLC
    RYGNDSRLATRILKDKFKLRNVRDVKGGYFAYIDEINPSLPKY

    >gi|45190914|ref|NP_985168.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MVAQVQKQAPAFKKTAVIDGVFDEVSLEKYKGKYVVLAFIPLAFTFVCPTEIVAFSDAAKKFEDLGAQVLFASTDSEYSL
    LAWTNIARKDGGLGNVNIPLVADTNHSLSRDYGVLIEEEGIALRGLFVIDPKGVVRHITINDLPVGRNVDEALRLVEGFQ
    WTDKNGTVLPCNWTPGAATIKPDVAASKEYFSEAHKD

    >gi|302308305|ref|NP_985186.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MVLGWRPMMRGVMLVLVTLLVQSVMGAVSWEELQPLREANGLIRVTDDNYEWVSKGAREFYSMVLVTSSVPNSKGAACEL
    CAAVQPTFEKVVGSFHGSVQADDQRLYQFFLLDVNLNPKFVKEMRLRSLPHFFVYPPSPEDESFAWARNPLYQYEMTPDG
    AKDAIKLADFAAKLVNIHVKVPEDFNASSFFSSFVGFTVVFVALKRFVRAQISHKGRYSGCLLALLVIMVSITGLKFTQI
    NQIPFLAKNDKGAIMFFAGSMGWQFGIEIISVSVMYLLMATCVLMLIWLGRGLAKAQKRARIVLTVMINVSLFYAFSYFL
    SCYKVKLPDYPYAI

    >gi|302308379|ref|NP_985268.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MKLGTWLAASVVAWVVGFGSALSTEKLAKQAAKDGGIIRLTNVNFKRILSGPRDAFIVVLMTATNPQIGCQLCTELGPEY
    DTLAQAWMETHSGGVSAAEPHQGLFFAKLDFAVPQSKEVFSHYQINNVPRLLLFRPGGDLDSYEPLGIPSHTGGARVRAI
    IDTLKSYTGIEDFEYHEPVNWGQYAAILMMAVPVVIMLRNYWSVVVSIALFRPLWGFSCVSIVIALVSGAMFNKIKDTPY
    VGSSGDGNYVQYFAIRQQQVQFGVETQIISVIYGTLSAGVVLLAIGTKSIRAYYIKYNYSMHAVVHLLLSLAAILLIYIS
    FAALLAVFKLKNFEYPFRLFKSPFR

    >gi|45198480|ref|NP_985509.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MIRIGSRLTPSLRHYTSSSQRITKFTMSGFYDLSPLDAKGEPFPFSQLKGKVVIIVNVASKCGFTPQYEELEELYKKYKD
    QGFEVIGFPCNQFAHQEPATNEEIVQFCKLNYGVTFPVLKKVDVNGADADPVYVYLKSQKSGLLGFKGIKWNFEKFLVDR
    KGQVKDRYSSITKPLSLEKTIETLLKEEGGPAPTATTEATATATADAAKPSGESL

    >gi|45198656|ref|NP_985685.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MRDYSVRQIIGDGQFTRLRDMKVLLVGAGGIGCELLKNLVQMGFGEVHVVDLDTIEISNLNRQFLFRQRDVKRAKAATAV
    AAVGYFSSGRLVAHQGNITDATVFPLAWFRGFAAVFNALDNVAARRHVNRMAQFASIPLLESGTAGFDGQVQPIVPGKTE
    CFDCTAKETPRTYPV
    CTIRSTPSQPVHCVIWAKNFLFQQLFGEPAEPPATEDLGTDDPAEIARIRQESGELAQLQEWART
    GDTARVRAVIEKLFVVDIQKLAAIESLWHTRPQPEALEGFELGVPSNAADASALWGIQEHLNRFAASLRRLMERMPREGS
    IEFDKDDADALEFVATAANIRAHIFHIKMLSVFDIKQIAGNIIPAIVTTNAIIAGLSALVSLRVLNLLRVMPNDPLNLPM
    AFTSMASKISSNRYLAAPRLSPPNPNCSVCAHYQRCALTVGAVRCKTLTLGELIEAVQEKYGFSNEVSVVDTSTNRLLAD
    FDFDDLNGNTLEKLELRTGSILTVSDDVPSEEDNTVRKPIEFYLELSDSATGFELIELPHIRVIDKETASNSDSVEADGK
    TAEVDLDLVDASGAIVIQDEEDSQPDAAKRKHSRDSESDDSTSKRARLDADSAEILILD

    >gi|302308755|ref|NP_985786.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MTFDTPPPAAPVSPSLKFSPQKHKLLTLAAGCFWGTEHMLRKHLGHKIVDLVAGYANGNVPTDTKGVTYERVCVGNTNFA
    EVVQVAFDPEVLGLSELCDFFFRMHDPTTLNAQGPDVGTQYRSALYAHSDEDLSQVRQILERWQPRWANCIKTEVALAES
    FYDAEEYHQRYLTNNPTGYQCPTHYLRNV

    >gi|45198951|ref|NP_985980.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MSKSDDIDESLYSRQLYVLGKEAMLKMQVSNVLVVGVTGLGVEIAKNVALAGVRSLTLYDPEAVTVQDLATQFFLRESDV
    GQRRDHVTAPRLAELNSYVPVRVAESLEEARLGEFQVIVATNTVPLAERLRLNRYAHAHGVRFIAAETRGLFGQIFVDLG
    EDFTVIDSTGEDPKSGIVSDIEADGTVTMLDDSRHNLEDGDYVRFTEVDGLEGLNDGTPYKVEVLGPFAFRIGSVEKFGV
    YKKGGIFTQVKMPAKLSFKSYEEALRDPEYLVSDFSKFDRPAQLHLGFQALHLFAEKNNGQYPRPSNEEDANNLIKLASD
    MAEQQPQILGESELDRDLLRELSYQARGDIAGMVAFFGGLAAQEVLKACSGKFTPLKQFMYFDSLESLPDPAKYPRTEAT
    TAPIQSRYDNQIAVFGLDFQRALANLKIFLVGSGAIGCEMLKNWALMGVGSGPEGKIMVTDNDSIEKSNLNRQFLFRPKD
    VGRNKSEVAAAATIEMNPDLAGHIDAKCDKVGPETEHIFDSDFWNSLDIVTNALDNVDARTYVDRRCVFYRKPLLESGTL
    GTKGNTQVVIPNLTESYSSSRDPPEKSIPL
    CTLRSFPNKIDHTIAWAKSLFHGYFTETPENVNTYLTQPNFVEQTLKQSS
    DIRGILEPIVASLSDRPYNYEDCIKWARLEFEKKYNDDIQQLLYNFPKDAKTSTGAPFWSGPKRAPEPLIFDINNPSHFQ
    FIVAGSSLRAYCYGLKGDDGHFDVEFYKKVLSNVEVPEFTPRSDVKIQANDDEPDPNANAKFEDDVMDQLASSLPEPATL
    AGFSMVPAEFEKDDDTNHHIEFITAASNCRAMNYNIEPADHQKTKFIAGRIIPAIATTTGLVTGLVNLELYKVVDHKMDI
    EKYKNGFVNLALPFFGFSEPIASPQGKYNDQTYDKIWDRFDIQGDIKLKDLIDYFKNQKGLEVTMLSYGVSLLYASFFPP
    KKLKDRLNLPITEVVKSVTKSEIPAHVKTMILEICVDDQEGEDVEVPYVTIHL

    >gi|302308914|ref|NP_986059.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MLRNVCRPAMRRSFHQTAWMSANKKHDVVVIGGGPGGYVAAIKAAQLGFDTACVEKRGRLGGTCLNVGCIPSKALLNNSH
    LLHQMQHDAKQRGIDVKGEVTVNMPQFQKAKDTVVKQLTGGIEMLFKKNGVTYYKGLGTFESESSIKVSPVEGLEGAVAE
    ETILEAKNIIVATGSEVTPFPGITIDEERIVSSTGALSLKEVPKRLVVIGGGIIGLEMGSVYSRLGSKVTVIEFQPQIGA
    TMDGEVASTTQKFLKKQGFDFHLGTKVLSAERNGDVVDIKAENVKTGKVESFQADVLLVAIGRRPYIEGLGAENIGLDVD
    KRGRLVIDEQFNTKFPHIKVIGDVTFGPMLAHKAEEEGIAAAEYIKHGHGHVNYGNIPSVMYSHPEVAWVGKTEEQLKEA
    GIAYKVGKFPFMANSRAKTNLDTEGFVKVLIDAETERLLGAHIIGPNAGEMIAEAGLALEYGASAEDIARTCHAHPTLSE
    AFKEANLAAFSKSINF

    >gi|45199074|ref|NP_986103.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MLRNCLSRGVFVRRFGTPAPKVYQLEEIRRLVRQPAADKVLVDVREPAELRECKLPNAINLPLKTYPAALSLSEEEFKKV
    FGIDKPSPEKELIFF
    CQAGVRAEAAQDLANSYGYEKTAVWPGSMKEWLAHGGGENV

    >gi|302308942|ref|NP_986106.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MAQDANTASSTPGRIANMKIGLLAAALGGLAAAQNLYDRNPHVMELTAKTFKRAVHGTNHTTLVEFYAPWCGYCQKLKPT
    MERAARALDGLMQVAAVNCDVDANKQLCVKHDVRGYPTLAVFQPAPAKAGARARHVRELYQGQQKLRPLVDFSLGRIRNH
    VRRLDGDKLRALFDEGGPRPAAVLVSARERVAPLYKSMAIDWLGAVDFAFVAAAKLPKDTPVPDRPGLAPCAEHLAEHLD
    RSALLLFNPQADECRVYSGELTKPAVAEFLSQAAMPREGPLSKRERFLETLKGKKRTRGPDHDDRDEL

    >gi|45199095|ref|NP_986124.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MCCRAAESRMSEYEEKARELVSQHKYLQLSASWCPDCVYANGVWERLGLQQQIVVFDIAQEAKDKQEEGAWRDGFERATG
    SRNLPTLYVDGQVWGTERELHALEDAGTLRAELAKIGLDAK

    >gi|45199227|ref|NP_986256.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MSRQLIRTLRVGSMCASKWNPQLSAEQLRVLRDRGTERPHTGTYLYNKSTGIYHCANCDVPLYSSSAKFDSGCGWPAFYQ
    EVRPGALRYIRDSSLGMERVEIRCSACDGHLGHVFEGEGFAQRLGLPKDVRH
    CVNSCSLRFRGEGN

    >gi|45199229|ref|NP_986258.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MVSPSVIKQVQALIQQNRVFIASKTYCPYCQAAKRTLLEEKRVPASAVKLLELDTMGEEGAVIQAALQELSGQRTVPNIY
    INGRHVGGNSDLEALKASGELDQLLEEALRE

    >gi|302309062|ref|NP_986266.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MLFDKRFVLSIAGLLAQFAQAQDATAPEDSAVVKLTGETFGKFLEENPLVMAEFYAPWCGHCKHLAPEYVKAAGELAEKG
    IKLAQVDCEQELDLCAGQNVRGYPTLKVFHSGASEEGMPYTGARKAEEIVAYMLRQAEPAVTVLEGKEAAQDLEDLLAES
    KTAVVVDGGVKGLNESFYELANLLRNDFVFVQYPTKKPTLAVHLPGEKEPIVFEGKNTTLPHLVDWISVESLPYFGEVDA
    ITYQKYMTSDLPLAYFFYSSEEEREQYAGLFRKLGKAHRGSLNFAGLDAVKYGQHAENLNMKQQFPLFVIHNATSDLKYG
    LPQLSDEEVSAGTAVTIKEADIEKFVVDFLDSKIEPIIKSEDVPEVQESSVYKLVATTHDQIVKDEDKDVLVKYYAPW
    CG
    H
    CKKMAPTFEELADVYANDEDAKNKVLIADIDATLNDVHGVVIEGFPTIVLYPAGKDSTPVVYQRSRSLEEFLDFIKEEG
    THKVDGQAIHARNAETAADKPAEKAEAEAEDADLERDEL

    >gi|45200868|ref|NP_986438.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MLRLLGGAKRMQSSVSVLRTAAELQAATARPRAVVNLSAAWCGPCRGMAPVYKRLSEEHRDISFYKVDIDELPDAARHFG
    VTGVPTYVVLRDGREHARVVGADPRALEQALTLDG

    >gi|45200968|ref|NP_986538.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MAAERVAQSEDKLTASGSDDEALDELLESLENDDSFLDRYREQRTEQLAQHFREARQNAASGDYGQLHTLEDEGALLALS
    TRTARVVIHFYLETFPR
    CQTMDSKLRKLAAKHMHTRFVRISVEKCPFLVQRLGIKVLPCVISYRDGLERDRLVGFQDLGN
    QPEDFPLAALERRLASIGMLPSGADALTVNRIDRDHDY

    >gi|45201063|ref|NP_986633.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MMVYYYLSKVPAASHRRMGAVLCRTAALLGKRTTTIDNKRQLQLHSQQTKSKTYEKPAVPRGWSFDSQPVGSSGASHDSS
    EAKGDEHPRTKWASYSLSRSDAPQGHHAGSDAAAHVTKRSDSATNKEVRSHAAAPAAANATGAGASSTKKPRRKLRPKKA
    LIKLSPDALVHLKALLDQPEPQLIRIGVRNRG
    CSGLTYDLQYIKEPGEFDEVIEQDGVKVVIDSKALFSIVGSEMDWIDD
    KLSSRFVFKNPNSKGTCGCGESFMV

    >gi|45201207|ref|NP_986777.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MTVIDITSKDQFTQQTTVAAGSKLVALYFHTAWAEPCKAMSAVFSAVSEEPAHKDVLFLAIDADEHAEISELFEVAAVPY
    FVLIKEGAIVKEISGSDPKDFVSALNEYTAGSNSTGAAATASAPAEEYGEEETEEQLQERLKKLTSAAPVMLFMKGTPSE
    PK
    CGFSRQMVGILREHQVRFGFFDILKDESVRQGLKTFSDWPTFPQLYINGEFQGGLDIIKESLEEDPEFFQNTLSS

    >gi|45201292|ref|NP_986862.1| hypothetical protein [Ashbya gossypii ATCC 10895]
    MLRCREVYNICKGAMSNEVKHYDYLVIGGGSGGVASSRRAASYGAKTVLIEGKALGGTCVNVGCVPKKVMWYASDLAHRL
    LHARDYGLLQEVDISKEKLHFNWKEFAGKRNAYVERLNGIYERNLAKEGVEYVHGWARFNSEGQVEVTRPDQTTEKYTAD
    HILIATGGEPVLPEGIPGAEYGVDSDGFFRLEEQPKKVVISGSGYIATEFAGVFNGLGTETHIVIRKDHVLTKFDPSIQE
    IVTEHYEKEGVNIHKKESIQRVEKDPNTGKLTVHLSGKIIEDVDQLVWAIGRKSLLGIAPENVGVKLGETGHVVVDEYQN
    TSTKGIYALGDVVGNMELTPVAIAAGRKLANRLFGPEQMRAQKQDYDNVPSVVFSHPEAGSIGLTEPQAIERYGKENIKI
    YQTKFTAMYYAMLEDKSPTKYKLICAGPEEKVVGLHIVGDGSAEILQGFGVAIKMGATKADFDSCVAIHPTSAEEIVTLK


    >gi|302309571|ref|NP_987034.2| hypothetical protein [Ashbya gossypii ATCC 10895]
    MLARITTIAKNTFKTPSTVLGSMSSTRSVRTFRQEDQPRLRINSPAPNFTADTTEGRINFHEFLGNSWGILFSHPADFTP
    V
    CTTELGTFAQLKPEFDKRDVKLLGLSAEGLEKHHEWARDIEEISQLDKFSFPIVADVDREVAFLYDMVDEEGFQNLSGG
    LVQTIRSVYVIDPSKKIRLMFTYPASVGRNSLEVLRVVDALQLSDRKGIATPINWQQGDEVIIPPAVSDKAAAEKFGEFR
    TVKPYLRYTKVD