Equus caballus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|149693696|ref|XP_001496084.1| PREDICTED: similar to peroxiredoxin 1 [Equus caballus]
    MSSGNAKIGYPAPNFKATAVMPDGQFKDISLADYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|194225340|ref|XP_001917454.1| PREDICTED: similar to glutaredoxin 5 [Equus caballus]
    MSGSLGRAAAALLRWGRGAGGGGLRGPGVRAAGSGGGGGSAEQLDAMVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHG
    VRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELRKLGIRSALLDEKKDQDSK

    >gi|194226730|ref|XP_001497898.2| PREDICTED: thioredoxin reductase 1 [Equus caballus]
    MGLLTTFGKEWASEEGRLQKLLKMNGSEDLPESYDYDLIIIGGGSGGLAAAKEAAKYNKKVMVLDFVTPTPLGTRWGLGG
    T
    CVNVGCIPKKLMHQAALLGQALRDSRNYGWNVEEMVKHDWEKMTEAVQNHIGSLNWGYRVALREKKVTYENAYGQFIGP
    HRIKTTNNKGKEKIYSAEKFLIATGERPRYLDIPGDKEY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT
    VMVRSILLRGFDQDMANKIGEHMEEHGVKFIKQFVPIKVEQIEAGTPGQLRVVAQSTKGDETIEGEYNTVLLAIGRDACT
    RKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYENVPTTVFTP
    LEYGACGLSEENAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNIKDNERVVGFHVLGPNAGEVTQGFAAALK
    CGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSGGNILQTGC

    >gi|149744797|ref|XP_001501685.1| PREDICTED: similar to magnesium transporter 1 [Equus caballus]
    MAARWCLWCVSATVAVALLVCGVPSASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTAL
    QLHRQ
    CVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGF
    SAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAIIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRG
    PPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIF
    RSKYHGYPYSFLMS

    >gi|149744793|ref|XP_001501623.1| PREDICTED: ATPase, Cu++ transporting, alpha polypeptide (Menkes syndrome) [Equus caballus]
    MDPSVDVNSVTISVEGMTCSSCVWTIEQQIGKLSGVHHIKVSLEEKCATIIYDPKLQTPKTLQEAIDDMGFDAILNHPNP
    LPVLTDTVFLTVTASLSPPWDHIQSTLLKTKGVTDIKISPQQRTAVVTIIPSVVTANQIIELVPDLSLDIGTLEKKSGTC
    EDYSMAQAGEVMVKMKVEGMT
    CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLITVEEIKKQIEAAGFPAFIKK
    QPKFLKLGAIDIERLKNTPVKSSERPQQRSPSCTNDSAVTFIVDGMHCKSCVSNIESALSTLQYVSSVVVSLENRSAIVK
    YNASLVTPETLRKAIEAISPGQYRVSFPSEVESTSNSPSGSSLHKIPLNIVSQPLTQETVINIDGMTCNSCVQSIEGVIS
    KKAGVKSIRVSLANGNGTVEYDPLLTSPETLRKAIEDMGFDATLSDTNEPLVVIAQPSSEVPLLTSTNEFCPKTMTPTHD
    KEEAKTSSKCYIQVTGMT
    CASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPPIIAEFIRELGFGATVIENAD
    GGDGILELVVRGMT
    CASCVHKIESTLTKHRGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFKASLVKKDRSASH
    LDHKREIRQWRRSFLVSLFFCIPVMGLMIYMMVMDHHLETLHHNQNISQEEMIHIHSSMFLERQILPGLSIMNLLSFLLC
    VPVQFFGGWHFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHI
    AKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMP
    VAKKPGSTVIAGSINQNGSLLIRATHVGGDTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVIVSIATLLVWIIIG
    FLNFEIVEAYFPGYNRSISRTETIVRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKV
    VVFDKTGTITHGTPVVNQVKVLVESNRMSRNKILAIVGTAESNSEHPLGAAITKYCKKELNTETLGTCTDFQVVPGCGIS
    CKVTNIEGFLHKNNWKIEENNIKNASLVQIDASNEQPSTSSSIIIDAQLSNSLNSQQYKVLIGNREWMIRNGLVINNDVD
    DSMNEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAVHTLKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPS
    HKVAKVKQLQEEGKQVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFV
    FALIYNLVGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHARSQMGQKSPSEISVHVGI
    DDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSIGTSEPDKHSLLVGDCREDDDTAL

    >gi|194227734|ref|XP_001916326.1| PREDICTED: similar to Peroxiredoxin-4 (Prx-IV) (Thioredoxin p
    MEAPPPLPAAFIPASGSSRRLLLLPLLLLLLPAGPLRGWEAEERPRTREEFCHFYAGGQVYPGEASRVPVADHSLHLSKA
    KISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAW
    INTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTD
    KHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|194210368|ref|XP_001488665.2| PREDICTED: quiescin Q6 sulfhydryl oxidase 1 [Equus caballus]
    MTSPRPQQLQERESGVRAYASQTPHSFHGEVGAPRPGLRSRLLRPEAGTRLRSSEPRRTXXXXXLLLLLLLLAVARGDAA
    RARRSTRPSKPLTLLRADTLRGAVLGSRSAWAVEFFASW
    CEHCIAFAPTWKALADDVKAWRPALNLAALDCADEANTAVC
    RDFNIPGFPTVRFFKAFSKSGSGATLSVAGADVQALRERLIDALESHSDTWPTACPPLEPARLKEINGFFARNNEEYLAL
    IFEKEGSYLGREVTLDLSQHRGITVRRVLNTEGDVVSKFGVTDFPSCYLLFRNGSVSRVPVLVESRSFYTAYLQKFSGAT
    RVAAQTSVAPTTAHTIAPTVWKVADRSKIYMADLESALHYILRVEVGKFSMLEGHRLVALRKFMAVLAQYFPGQPLTQNF
    LHSMNDWLKRQQKKKIPYNLFKNALDNRKEGAMIAKKVNWVGCQGSEPHFRGFPCSLWILFHFLTVQAARQNVDRSQETA
    KAQEVLQAIRSYVRFFFG
    CRECAGHFERMAAASMNRVKNPNSAVLWFWSSHNKVNARLAAVPGPRRGARRMAATPKPGEL
    ELADRNFTLGPEKAEIMVGPGTKSPGTLIPDVPVERLGESRPQEMHTGLGVTTAGPDQGPPERTAELQRDKLKQPKGQQH
    LTKRDTGAELLAEFLAEKPLPRGPSELRRVGRSSKQLASVPEGEPEAGAVRGRGQWLQVLERDFSHLDISLCVVLYSLSF
    MGLLAVYTYFRARMRALKGHASHLAA

    >gi|126352381|ref|NP_001075317.1| phosducin [Equus caballus]
    MEEARRQSLEEDFEGQATHTGPKGVINDWRKFKLESEDSDSIPPCKKEILKQMSSPQSRDDKDSKERFSRKMSIQEYELI
    HQDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKITTIVVHIYEDGIKG
    CDALNSSLACLAA
    EYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELISNFLSVAEQFAEEFFAGDVESFLNEYGLLPEREIHALEQTSM
    EEDVE

    >gi|194227089|ref|XP_001496125.2| PREDICTED: similar to predicted protein [Equus caballus]
    MRLQFPQLLLLDVTCHAIVCCLLQPGLERSDSVFYLSSNKSSHEQGSCEKEVRLASSLDFWTLSSENFIAMLPVDPVKEN
    YVRKVKNCVFSIAFPTPFKSRVRLVAVSKEVLEDILDLDLSVSETDDFIQLVSGEKILFGSVPLAHRYGGHQFGIWADQL
    GDGRAHLIGIYMNSHGDGRAVLRSSVREFLGSEAVHHLGIPTSRAASLVVSDDEVWRDQFYDGNVVKERAAVVLRVAKSW
    FRIGSLEILAHYGELDLLRTLLDFIIQEHFPSVDVGEPNRYVDFFSVVVSETAQLIALWTSVGFAHVTTMYPYLCILEGV
    CNTDNFSLLSITIDYGPFGFMEAYNPDFVPNTSDDERRYKIGNQANIGMFNLNKLLQALNPLLDPRQKQLAALILEGYPD
    LYYTRFRELFKAKLGLLGERKGDEDLIAFLLHLMEKTAADFTMTFRQLSEITQSQLQELNIPQQFWALQTISKHELFPAW
    VSQYLLRLKSNMNDSDSERRKRMMTVNPRYVLKNWMAESAVRKAERNDFSEVRLLQQVLQHPFQKHSTAEKAGYASPTPS
    WAKNLRVS
    CSS

    >gi|194223776|ref|XP_001500606.2| PREDICTED: similar to IFI30 protein [Equus caballus]
    MELTEGRDAPPKAGDLCLQTLLRKSDPPPVNVSLYYEALCPGCRSFLVRELFPTWLMVLEILNVTLVPYGNAQERNVSGK
    WEFTCQHGEEECKLNKVEACLWDLLEKNLAFLTIVCVEEMDDMEKNLAPCLQLYAPKVSPGAIMECATGDRGAQLLHINA
    QLTDALQPPHEYVPWVVVNGKPLKDQSQLLYLVCQLYQGEKPDVCQLMASSHREVCFK

    >gi|194219372|ref|XP_001915422.1| PREDICTED: similar to FAD-linked sulfhydryl oxidase ALR (Augmenter of liver regeneration) (hERV1) [Equus caballus]
    MRTQQKRDSKFREDCPQDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDIRKRIRRNQPDT
    RTRACFTQWLCRLHNEVNRKLGKPDFDCSQVDERWRDGWKDGSCD

    >gi|149744775|ref|XP_001501016.1| PREDICTED: similar to peroxiredoxin 1 [Equus caballus]
    MSSGNAKIGHPAPNFKATALMPDGQFKDINLADYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASIDS
    RFCHLAWIKTPKKQGGLRPMNIPLVSDPKCTIAQDYGVLKADEGISFRGLFIIDDKGILRQISVNDLPVGHSVDETLRLI
    QASQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFLKQK

    >gi|149754724|ref|XP_001504930.1| PREDICTED: glutathione peroxidase 5 [Equus caballus]
    MTAQLRASYLFLLLLAGFVQTENNAEKMKTDCYKDVKDTIYEYSAVTLNGKEHIQFNQYAGKPVLFVNVATYCGLTAQYP
    ELNTLQEELKPFDLVVLGFPCNQFGKQEPGENSEILPGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPS
    DVLGSLKHISWEPIKVHDIRWNFEKFLVGPDGVPVMRWFHKTPVSTVKSDILAYLKQFKIKKGG

    >gi|194227105|ref|XP_001495944.2| PREDICTED: similar to methionine sulfoxide reductase B2 isoform 2 [Equus caballus]
    MSGSGAPGAHRGTPGSPTKPELSLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNEESGMYHCVCCDSPLFSSEKKYS
    SGTGWPSFSEAHGTSGSDESKTGILRRVDHSSGSVRTEVVCKQCEAHLGHVFPDGPGPTGQRF
    CINSVALKFKPSSN

    >gi|194207886|ref|XP_001501270.2| PREDICTED: similar to Chloride intracellular channel 4 [Equus caballus]
    MLLACEEQCPESMMRNSKLNRAAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNN
    EVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDE
    IDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEI
    AYSDVAKRLTK

    >gi|194210084|ref|XP_001915778.1| PREDICTED: similar to Protein disulfide-isomerase A4 precursor (Protein ERp-72) (ERp72) [Equus caballus]
    MVPLGKFDSHTGQSSRAVRVDMHGPRALPNCPQQAFQTVAGGLGPLQVCPPQRVPAVEEGGGEVTVEVGMLESCGPECKD
    SSDKEDALEEEDEEEDDDDEEEEDDLEVKEENGVLVLKDANFDNFVADKDTVLLEFYAPWXGPTFCFMRH
    CKQFAPEYEK
    IASTLKENDPPIPVAKIDATSESALASRFGVSGYPTLKILKKGQAVDYEGSRTQEEIVAKVKEISQPNWTPPPEVTLVLT
    KDNFDEVVNDADIILVEFYAPW
    CGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGKP
    FDYNGPREKYGIIDYMIEQSGPPSKEIQALKQVQEFLKDGDDVIIIGVFKAESDPAYQQYQDAANNLREDYKFHHTFSTE
    IAKFLKVSPGKLVVMQPEKFQSKYEPRSNVLDIQGSTEGSAIKDHVLKHSLPLVGHRKTSNDAKRYTRRPLVVVYYSVDF
    GFDYRAATQFWRNKVLEVAKDFPEYTFAVADEDDFATEVKDLGLSESGEDVNAAILDESGRKFAMEPDEFDSDTLREFVT
    AFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPW
    CGHCKQLEPVYTALGKKYKSHKNLVIAKM
    DATANDVTNDRYKVEGFPTIYFAPSGDKKNPIKFEDGDRDLEHLSKFIEEHATKLSRTREEL

    >gi|149690874|ref|XP_001496590.1| PREDICTED: similar to SFLQ611 [Equus caballus]
    MGGTLNPWDGQNFLKMFFLQDPSLFTMGMWSIGVGALGAAALALFLANTDVFLPKSQKAALEYLEDTDLKTLEKEPRTFK
    AKELWEKNGAVIMAVRRPG
    CFLCREEAMDLSLLKPKLDELGVPLYAVVKEQLSTEVEDFQPYFKGEIFLDEKKKFYGPQR
    RKMMLLGFVRLGVWRNFFRAWDRGISGNLEGEGFILGGVFVVGSGRQGILLEHREKEFGDKVNVDSVLEAARKIKPQTLA
    SEEK

    >gi|194226778|ref|XP_001499297.2| PREDICTED: similar to Thioredoxin, mitochondrial precursor (Mt-Trx) (MTRX) (Thioredoxin-2) [Equus caballus]
    MAQRLLLRRFLASVVSRRPCPGRWGPLTSRALPAPQCGPGDLTGTPSQARSLYTTRVCATTFNIQDGPDFQDRVVNSETP
    VVVDFHAQW
    CGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAF
    LRKLIG

    >gi|194215281|ref|XP_001490698.2| PREDICTED: similar to SUMO-activating enzyme subunit 2 (Ubiquitin-like 1-activating enzyme E1B) (Anthracycline-associated resistance ARX) [Equus caballus]
    MFLTDEKNIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIIAYHDSIMNPDYNVEFFRQFILVMNALDN
    RAARNHVNRMCLAAGVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFG
    EEDADQEVSPDRADPEASWEPMEAEARARASNEDGDIKRISTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKP
    PVPLDWAEVQSQGEETNASDQQSEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSA
    ANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPN
    PNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQ
    ADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEGPS
    NNADISEEERSRKRKLDEKENVSAKRSRTEQTEELDDVIALD

    >gi|149756541|ref|XP_001504823.1| PREDICTED: similar to Methyltransferase-like protein 7B [Equus caballus]
    MDALVQLLRLLLLLLTLPLHLMALLGCWQPLCKRYFPHLMAVLTPKCNRVMDSKKRELFGQIKVPTGASGKVALLEVGCG
    TGANFKFYPAGCRITCLDPNPNFEKFLTKSMAENRHLEYERFVVAPGEDMKELADSSMDVVVITLVLCSVQSPRRVLQEV
    YRVLRPGGVFFFWEHVAEPRGSWAFLWQQVLEPTWKHFTDGC
    CLTRETWKDLESTGFSQLQMERQPPPLKWLPVGPHIMG
    KAVK

    >gi|194226461|ref|XP_001494003.2| PREDICTED: similar to glutathione reductase [Equus caballus]
    MSRETASLAARLAQSCEGKEAWALARRLPRRGRQRLSLRPADSGGCGKALRREMKWKRKRSVARTFIPLPSELSALRAMG
    TGHGRWTIATRIQSPVTNLLCRKVGATGNSKVPAQERLGETRGRSSFRAPLAFRNRHLVDATTVAGDRCWGKRRLAEGDR
    RIPTLGRRAARSSRAGTGTGCGEARPAAGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGT
    CVNV
    GCVPKKVMWNTAVHSEFIHDHVDYGFQS
    CESKFNWRVIKEKRDAYVSRLNTVYQNNLTKSHIEIIRGHAAFTSDPRPTVE
    VSGKKYTAPHILIATGGMPSRPQESEIPGASLGITSDGFFELEELPRRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDK
    VLRNFDSMISSNCTEELENAGIEVLKYSQVKEVKKTSSGLDVCMITSVPGRKPTLTMIPDVDCLLWAIGRDPNSRDLNLN
    ALGIQTDDKGHILVDEFQNTSVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKEDSKLDYDNIPTVVFSHPPIGTVG
    LTEDEAIYKYGKENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKADFD
    NTVAIHPTSAEELVTLR

    >gi|149689640|ref|XP_001493666.1| PREDICTED: similar to antioxidant protein isoform 1 [Equus caballus]
    MAAAVGRLLRASVARRVSAIPWGIAASAALRPAASQRTCLTNVLWSGFNQAKLAFSTSSSYHTPAVTQHAPYFKGTAVVK
    GEFKELSLDDFKGKYLVLFFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIP
    LLSDLTKQISRDYGVLLEGAGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVEAHGEVCPANWTPDSPT
    IKPHPTASKEYFEKVN

    >gi|149743026|ref|XP_001500675.1| PREDICTED: similar to Thiosulfate sulfurtransferase (Rhodanese) [Equus caballus]
    MVHQVLYRALVSTKWLAESVRAGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRNAASPYEMMLPSEAG
    FADYVGRLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAIFKATLDRS
    LLKTYEQVLENLKSKRFQLVDSRSQGRYLGTEPEPDAVGLEPGHIRGSVNMPFMDFLTEDGFEKSPEELRAMFEAKKVNL
    EQPLIAT
    CRKGVTACHIALAAYLCGKPDVAIYDGSWSEWFRRAPPETRVSQWKGGKA

    >gi|149689642|ref|XP_001493688.1| PREDICTED: similar to antioxidant protein isoform 2 [Equus caballus]
    MAAAVGRLLRASVARRVSAIPWGIAASAALRPAASQRTCLTNVLWSGSSYHTPAVTQHAPYFKGTAVVKGEFKELSLDDF
    KGKYLVLFFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIPLLSDLTKQISR
    DYGVLLEGAGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVEAHGEVCPANWTPDSPTIKPHPTASKEY
    FEKVN

    >gi|194218400|ref|XP_001489792.2| PREDICTED: similar to peroxiredoxin 5 [Equus caballus]
    MPKAPPLRRRASGPAPNANEPRVPEAPPPRARLRTAEGRGGCGPGRRDAVAAVPPGPPNRFGGGAGGRRPVCRSGESRRV
    LGRRQGVDAWRDPRFQKRLRSPWPPIKVGDAIPSVVVFEGDPANKVNLAELFKGKKGVLFGVPGAFTPG
    CSKTHLPGFVE
    QAAALKAKGVEVVACLTVNDVFVTEEWGRAHNTKGKVRLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIEDGIV
    KSLNVEPDGTGLTCSLAPNIISQL

    >gi|194226791|ref|XP_001916737.1| PREDICTED: similar to Mercaptopyruvate sulfurtransferase [Equus caballus]
    MAPQQLFRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPSAA
    HFAEYAGRLGVGAATHVVVYDASDQGLYAAPRVWWMFRAFGHRAVSLLDGGFRHWLRQGLPLSSGKSRPAPAEFHAALDP
    AFVKTYKDIKENLESRRFQVVDARATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLTDEGLEKSPEDIRRLFQDKKVDL
    SQPLVAT
    CGSGVTACHVALGAYLCGKPDVAIYDGSWVEWYMRAQPEEVISEGRGKTV

    >gi|149751649|ref|XP_001497418.1| PREDICTED: ubiquitin-like modifier activating enzyme 6 [Equus caballus]
    MLKHSSKAELSENTNTNLPIMSTESVEIDDALYSRQRYVLGDTAMQKMAKSRVFLSGMGGLGLEIAKNLVLAGIKALTIH
    DTEKCQAWDLGINFFLCEDDVANMRNRAEAVLQHIAELNPYVHVTTSSVPLNETTDLSFLDNYQCVVLTEIQLPLQKKIN
    DFCRSQHPPIKFISADIHGIWSRLFCDFGDEFEVLDTTGEESKEIFISNITQANPGIVTCLENLPHKLETGQFLTFREIN
    GMTGLNGSTQQITVVSPFSFSIGDTTELEPYLHGGIAVQVKTPKTFCFEPLERQIKHPKCLIADFSKPEASLQIHTAMLA
    LDQFQETYSRKPNIGCQKDSEALLKLATSVSETLDEKPEVNVDVVRWLSWTAQGFLAPLAAVVGGIASQEVLKAVTGKFS
    PLCQWLYIEAEDIVEPLDKPERKEFLPRGDRYDALRACIGDTLCQKLQNLNIFLVGCGAIGCEMLKNFALLGVGTSKEKG
    MITVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAADATLKINPQLKIDAHLNKVCPATEAIYSDEFYTRQDIIITALDNV
    EARRYVDSRCLANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPF
    CTLKSFPAAIEHTIQWARDKFESSFSH
    KPSLFNKFWQTYPSAEEVLQKIQTGHSLEGCFQVIKLLSRRPRNWSQCIELARLKFEKYFNHKALQLLHCFPLDTQLKDG
    SLFWQSPKRPPSPIKFDLNEPLHFSFLLNAAKLYAAVYCIPFTEEDLSADALLNILSEVKIQEFKPSNKVVQTDETARKP
    DHVPISSEDERNAIFQLEKAISSNEATTSDLQMAVLSFEKDDDSNGHIDFITAASNLRAKMYSIEPADRFKTKRIAGKII
    PAIATSTAAVSGLVALEMIKVAGGYPFEAYKNCFLNLAIPVIVFTETSEVRKTEIRNGISFTIWDRWTIHGKEDFTLLDF
    INAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPSTEKKYVDLTVSFAPDSDGDEDLPGPPVRYYFSHDT
    D

    >gi|149726487|ref|XP_001504659.1| PREDICTED: similar to Glutaredoxin-1 (Thioltransferase-1) (TTase-1) [Equus caballus]
    MAKEFVNSKLQPGKVVVFIKPTCPYCKKTHELLSRLPFKQGSLEFVDITATGDDVSKIQDYLQELTGARTVPRVFIGKDC
    IGGCTDLLNMHQSGQLLTRLKQIGALE

    >gi|149721199|ref|XP_001488842.1| PREDICTED: similar to Thioredoxin-like protein 1 (32 kDa thioredoxin-related protein) [Equus caballus]
    MHTQIPLPERTTSLLQGERFALCSCYCRLQGHLSFPAEVMHSSGSLWRMPKQAKPGDLPRIRDRTTLKPLPGGPKTLGST
    YPPLRKPGSLSTFPPLGNPSLKASGLGIAEEYTNFRVSVCACAGDRYSAAPTPLSQRGGGGEGGGGSSAEGGATVRVLGL
    DGGSQSGRSGNDAKVRKRLRLCRAGAAG
    CGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNK
    VRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDLTFLESDCDEQL
    LITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVT
    IFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|194214009|ref|XP_001490530.2| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3 [Equus caballus]
    MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLPAPHPYAGTQDCVEAAVCHVKDLEN
    GQMREVELGWGKVLLVKENGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEK
    EKVYVWASKQALQLQRRTKVMAKCISPSAGHSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSK
    SLDAQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYNKLLLAPGSSPKTLSCKGKEVENVFTLRTP
    EDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSEL
    RAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGISLDSRGFIPVNKMMQTNIPGVFAAGDAVTFPLAWRNNRK
    VNIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVAS
    MNYDPIVSKVAEVLASGRAIRKREVELFLLHSKTGDMSWLTGKGS

    >gi|149704581|ref|XP_001491626.1| PREDICTED: dihydrolipoamide dehydrogenase [Equus caballus]
    MQGWSRVYCSLAKRGHFNRISHGLQGVSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTC
    LNVGCIPSKALLNNSHYYHLAHGKDFASRGIEMSEVRLNLEKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKN
    QVTAAKADGSTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
    AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTQ
    NLGLEELGIELDPRGRIPINTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVA
    WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
    ARVCHAHPTLSEAFREANLAASFGKSINF

    >gi|194226485|ref|XP_001488081.2| PREDICTED: similar to tumor suppressor candidate 3 isoform 1 [Equus caballus]
    MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAP
    PRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGSDVFQQLNMNSAPTFMHFPPKGRP
    KRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
    AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLG
    LVVFFFSFLLSIFRSKYHGYPYSDLDFE

    >gi|194209482|ref|XP_001492951.2| PREDICTED: similar to thioredoxin domain containing 3 (spermatozoa) [Equus caballus]
    MASKKREIQLQAVVNSQSLWDEMLPNKGLTVIDVYQAWCGPCKAMQTLFRKLKNELNEDEILHFVVAEADSVVTLQPFRD
    KCEPVFLFSVNGKIISKIKGANAPLVNQKIINLINEERKIAAGEMARPQYHEILFVDSDTEEAGEAPYESAEQICSIAII
    KPDAVITRKDREIKEKIIKAGFVIEAEDKRVLTEEQVRDFYSRIADEPEFEDFVRFMTSGLSYILVIAPGNERQPPWEET
    EANPETEPKEPSEDQEETATAMKTKWESLQECLERQHVSHFCDVEDNTTDVNKFIDIFFPNFKNMKSIKLERIMALLRPD
    LFQQRKEDVLDIIQDEGFKILMQRQIVLSEVEAQTLCKKYENEVYFGSLIENMTSGPSLALVLLRDNGLQHWKELIGPST
    VEEAKKNLPESLCAQFAMGSLPINQLYGSDSLEAAEKEILHFFPPQNTLAVIKPHVTHQEREEILSLIKEAGFDITQVKE
    MLLTEELAEKIYFKIKGKDFYKDVLAVLSEGPSMVMVLTKWNAVSEWRRLMGPTDPEEAKLLSPDSIRAQFGRSVLKNAV
    HGSSNTYEAMETINRLFEEFVSENPEEN

    >gi|149702951|ref|XP_001492025.1| PREDICTED: similar to Phosducin-like 2 [Equus caballus]
    MQKNEVGLLTPKDPNEDTEWNEILRNFGILPPKEEPKDEIEEMVLRLQKEAMVKPYEKMTLAQLKEAEDEFDDEDMKAIE
    IYREKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDVWVIIHLYRSSIPM
    CLLVNQHLSLLARKFPETKFVKAIVN
    SCIQHYHDNCLPTIFAYKNGQIESKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENPKKDIVDVMVSSIRNASIYDD
    TNSSNSDNDDTK

    >gi|149743569|ref|XP_001498833.1| PREDICTED: selenophosphate synthetase 1 [Equus caballus]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQSVNPTPGATS

    >gi|149689662|ref|XP_001495693.1| PREDICTED: NHL repeat containing 2 [Equus caballus]
    MAAPGPRGCSLSGLLPAQTSLEYALLDAVTQEEKDSLVYQYLQKVDGWEQDLLVPEFPEGLEWLNTEEPISVYKDLSGKV
    VVFDFFSYC
    CINCIHLLPDLHALEHTYSDKDGLLIVGVHSAKFPNEKVLDSIKSAVLRYNITHPVVNDADASLWQELEVS
    CWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIKDNKIGIKLYKDSLPPSPLLFPGKVTVDRVTNRLVI
    ADTGHHRILVVWKNGQIQYSIGGPNPGRKDGTFSESTFNSPQGVAIMNNIIYVADTENHLIRKIDLEAEMVSTVAGIGIQ
    GTDKEGGAEGEQQPISSPWDVVFGTSGSEVQRDDILWIAMAGTHQIWALLLDSGRLPKKNELKKGTCLRFAGSGNEENRN
    NAYPHKAGFAQPSGLSVASEDPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMDLFAFGDVDGVGINAKLQHPLGV
    TWDKKRNLVYVADSYNHKIKVVDPKTKTCTTLAGTGDASNVISSSFTQSTFNEPGGLCIGENGQLLYVADTNNHQIKVMD
    LETKMISVLPLFTSENTVVDGPFPEEKQKTLPRLPKSAPAVKLSPVAASPGQTLQFKLRLDLPSGAKLTEGAPSCWFLTA
    EGNEWLLQGQIPSGEIESISNQPTISLQIPGDCVSLEAVISVSVFLYYCSADSSACMMKGILFSQPLQISATQQGCIAPV
    ELQYVF

    >gi|194219448|ref|XP_001496836.2| PREDICTED: similar to PDIA2 protein (predicted) [Equus caballus]
    MDGQLLLVLLLLLLGASGPWGQGPGPEGPSEELLKEEFPEEEVTEEENGILVLSRRTLARALQEHPALLVEFYAPWCGPC
    KVLAPEYSKAAALLAAELATARLAKVDGHAEPELTEEFSVTEYPTLKFFRDGDRLHPEEYTGPREAEGIAEWLRRRVGSS
    ATRLENEEGARALIDAQDVVVIGFFRDLQDEDAAAFLALAQDALDMTFXXXXXXXXXYFVLGPEEDPTLRFIDMDTPRKY
    RAAAEKLVTAATITAFCHAVLSGQVKPYHLSQEVPPDWDQQPLKTLVGKNFEQVAFDETKNVFIKFYAPW
    CPHCKEMAPV
    WEALAEKYKDHEDIVIAELDATANELEAFAVHSFPTLKYFPAGPGRKVIDYKSTRDLETFSKFLDSGGQLPAEEPTEEPV
    APFPETPANSTTGPKEEL

    >gi|194224161|ref|XP_001495847.2| PREDICTED: similar to Thioredoxin domain containing 13 [Equus caballus]
    MNYAPWCPSCQQTDSEWETFAKNGDLLQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQNYILE
    KKWQSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVLATLIFGLLMGLVLVVISECFYVP
    LPRHLSEHSEQNQESEEAHRAEQLQDAEEEKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEEEEDSLAPGVDEERNDTQ
    DQGPLREAQEDLDAHETEEDVPEPPSSADTEVAEDTLRQRKSQHADKGP

    >gi|194217012|ref|XP_001501126.2| PREDICTED: similar to chromosome 17 open reading frame 37 [Equus caballus]
    MTEQEPKPLAGGDTAGRRRVGAEEKEGEEATGKPKLMWKSQNVAAAAACRGRPNVTRASAPPRRPRPVTCSRRRAHPEAA
    AGVEPAAMSGEPGLTSVAPPPGEIEPGSGVRIVVEYCEP
    CGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQL
    VFSKLENGGFPYEKDLIEAIRRASNGEPLEKITNSRPPCVIL

    >gi|149746491|ref|XP_001493645.1| PREDICTED: similar to methionine sulfoxide reductase A [Equus caballus]
    MHLLLKAADMFTRKKEDRCVYGASLEAELPPFRVVYGACYPAVFMAHFTDWVNILIIRSFQRKPPRFTLEPRASIVFQVT
    AWPSGDPLTTSQELTGGAGSAAPSSTVLRKIRPGHTPKHHVSGNRTVEPFPEGTQMAVFGMG
    CFWGAERKFWTLKGVYST
    QVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVYQPERISFEELLKVFWENHDPTQGMRQGNDYGSQYRSAIYPTSADHMEA
    ALRSKEDYQKVLSEHGYGLITTDIREGQTFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPLGIKK

    >gi|194227853|ref|XP_001492997.2| PREDICTED: ubiquitin-like modifier activating enzyme 1 [Equus caballus]
    MSSSPLSKKRRVSGPDPKPGSNCSPAHSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGL
    RGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVSAYTGPLVEDFLSGFQ
    VVVLTNTPLEDQLRVGEFCHSRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDSPGVVTCLDEARH
    GFESGDFVSFSEVQGMIELNGSQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLLASLAEPDFVMTDF
    AKYSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVTLAQAVNARALPAVQQDNLDEDLIRKLAYVAAGDLAPINAF
    IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEALTEDKCLPRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIG
    CELLKNFAMIGLGCREGGEIVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIQVTSHQNRVGPDTERIY
    DDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYNSSQDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSN
    NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQAYGLMGSRDRAAVATLLQSVQVPEFT
    PKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPEKLRGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPPADR
    HKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
    QGLQPNGEEMTLKQFLDFFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCC
    NDESGEDVEVPYVRYTIR

    >gi|194222374|ref|XP_001498116.2| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 [Equus caballus]
    MGVWFNKDDYVIDLKRVTVCFLIVYMAVLVGTDQDFYSLLGVSKTSSSREIRQAFKKLALKLHPDKNPNNANAHSDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLSDNQGGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CS
    H
    CHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVSFAMQHVRSTVTE
    LWTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNLCKSLDITTSTTAYFPPGAT
    LNNKEKSSILFLNSLDAKEIYLEIMHNLPDFELLSANTLEDRLAHHRWLLFFHFGKNEDSNDPELKKLKTLLKNEHIQIG
    RFDCSSAPDVCRTLYIFQPCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPW
    CPPCRALLPELRKASKHLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVI
    SLTPTTFNELVTQRKHDEVWMVDFYSPW
    CHPCQVLMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVRRYPEIRFFPQ
    KSDKAYQYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVLQGKSHWVIDFYAPW
    CGPCQNFAPEFELLARMIKG
    KVKAGKVDCQAYAQICQKAGIRAYPTVKFYPYERAQRNTWGEQIDTRDAKEIATLIYEKLKNLQNHEKRNKIPVTQATES
    SAVGTMDHSAGIHGPSLKPNHTPLPYRPEPPSPDVSCASSA

    >gi|194205683|ref|XP_001499416.2| PREDICTED: similar to glutathione S-transferase omega 2 [Equus caballus]
    MAEDATRALGKGSLPPGPVPEGLIRIYSMRFCPYSHRTRLILQAKGIRHEVININLKNKPEWYYTKHPFGQIPVLENSKH
    QLIYESVIACEYLDDAYPGRKLYPFDPYERARQKMLLELFYKVPHLTKECLVAFRCGRECTDLKLALRQEFCNLEEILGY
    QNTVFFGGDCISMIDYLFWPWFERLDVYGIADCVSHTPALRLWIAAMKQDPAVCALLIDKNIFLGFLNLYFQNNPDAFDY
    GLSC

    >gi|149721181|ref|XP_001493036.1| PREDICTED: thioredoxin domain containing 10 [Equus caballus]
    MAAWRRGVALRLCATVVLLDMAFCKGFVEDLDESFKDSRKDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVG
    KMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKNDIIEFAHRVSGALIRPLPSQQMFEHVQKRHRVFFVYIGGE
    SPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWISRERFQNYLTVDGFLLY
    ELGDTGKLVAIAVIDEKNTSTEHTRLKSIIQEVARDYRDQFHRDFQFGHMDGNDYINTLLMDELKVPTVVVLNTSNQQYF
    LLDRQITNAEDMVQFINNILDGTVEAQGGDSILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTAD
    ADGGYIEERYEVSRSEIESPEQIEESKAQQEPRTGDSPVPAVQEPKDVLEKKKD

    >gi|194219156|ref|XP_001500567.2| PREDICTED: similar to Protein disulfide-isomerase-like protein of the testis [Equus caballus]
    MEWLWMSLLLVASCTSTVQGSREVDVKEASINTSQPLHILVERNLLVLTPAGLTHMLNQTRFLMVLFYNPSSKQSRNMAE
    ELGKAVEIMGKGKNGVGFGKVDITIEKELQKEFDIKTTPDLKLFFEGNRSEPISCKGVVESTALVVWLRRQISQKAFLFT
    DTQQVVEFVKSRPLVIIGFFQDLEEEVAELFYDVIKDFPELTFGVTSISNAIGRFHVPLDSVLVFKKGKIVKRQELIYDS
    TNKQVLSQVIKEHLTDFVIEYNIENKDLIYELNILNHMLLFISKSSKSFGTIMQHYKLALKEFQNKILFILVDADEPRNR
    HVFKYFRITEVNIPSVQILNLSSDARYKMPSEEITYENLKKFGRSFLNNSAKKHQSSEEIPKFWDQGPVKQLVGKNFNVV
    VFDKERDVFVMFYAPWSEK
    CRALFPVLEELGRKYQNHSTVTIAKIDITANDIQLMNLDRYPFFRLFPTDSQKVVPYKGEY
    TMKGFSDFLESQIKTRIEDEDELLSIEQSAVIEEEVLAEEEEVPFMEKELPEQKLTELENGTKPEYPAGQKEIAEKERKV
    AKPKGPPRQEKKPRVKEEL

    >gi|194205685|ref|XP_001499427.2| PREDICTED: similar to glutathione-S-transferase omega 1 [Equus caballus]
    MSGGSARSLGKGSPPPGPVPEGVIRVYSMRFCPFAERTRLVLNAKGIRHEVININLKNKPEWFFEKNPLGLVPVLENSQG
    QLIYESTITCEYLDEAYPGKKLLPDDPYEKARQKMIFELSSQVPTYGKQSVLALQCGDDYSGQKEQLHKEFSKLEEVLTN
    KKTTFFGGKNISMVDYLIWPWFERLEAVELIDCVDHTPKLKLWMEAMRKDPTVSALITDAKTLRGFIDLYLQNSPDACDY
    GL

    >gi|149728366|ref|XP_001498689.1| PREDICTED: ubiquitin-like modifier activating enzyme 3 [Equus caballus]
    MADGEQPMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFR
    QIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRW
    INGMLISLLNYEDGALDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVR
    ILQWPKEQPFGEGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATS
    AYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLY
    LQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|194228479|ref|XP_001494312.2| PREDICTED: similar to chloride intracellular channel 2 [Equus caballus]
    MAGPKSSIETDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGINPPFLVYNKELK
    TDFIKIEEFLEQTLAPPRYPHLSPKNKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSMLREFKRLDDYLNTPLLDEIDP
    DSAEELTVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
    GVAKQKS

    >gi|194223000|ref|XP_001493755.2| PREDICTED: similar to Thioredoxin domain-containing protein 5 precursor (Thioredoxin-like protein p46) (Endoplasmic reticulum protein ERp46) [Equus caballus]
    MHCAGCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFQTLENW
    MLQTLNEEPATPAPEVDPPRAPELKQGLYELSASNFELHVAQGDHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSETVKIG
    KVDCTQHYELCSGNQVRGYPTLLWFRDGKKIDQYKGKRDLESLREYVESQRQSVERGAPETVEPSEAPVPATEPVAAQGT
    VLALTENNFDDTIAEGITFIKFYAPW
    CGHCKNLAPTWEELSKKEFPGLAGVKIAEVDCTAERSVCSKYSVRGYPTLLLFR
    GGKKVSEHSGGRDLESLHQFVLRQVKDEL

    >gi|149738274|ref|XP_001500041.1| PREDICTED: similar to prostaglandin E synthase 2 [Equus caballus]
    MEQHRAESRRRAEVPFLAAGDQGGWKGSGILCIFLLPTPPTWRELSLTGHLQLTLYQYKTCPFCSKVRAFLDFHALPYRV
    VEVNPVRKAEIKFSSYRKVPILLAQEGDSLQQLNDSSVIISALKTHLVSGQPLEDIITYYPPMKAMNDQGKEVTEFCNKY
    WLMLDEKEAQRMYSGKEARTEEMKWRQWADDWLVHLISPNVYRTPAEALASFDYIVREGKFGVVEGAVAKYMGAAAMYLI
    SKRLKSRHHLQDDVRVDLYEAANKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLEAFDDLMRHTHIQPWYLRVEKA
    IAEAPH

    >gi|194223889|ref|XP_001496949.2| PREDICTED: similar to PHGPx CG12013-PB [Equus caballus]
    MEPLTAYPLRCSGPKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYAFEVKDARGRMVSLEKFKGKVALVVNVASDCQ
    LTDRNYLGLQELHKEFGPFHFSVLAFPCNQFGESEPRPSNEVVSFARNNYGATFPIFHKIKILGSEADPAFRFLVDSSKK
    EPRWNFWKYLVNPEGQVVKFWRPEEPIDVIRPEIAALIRQMILKKKEDL

    >gi|149732240|ref|XP_001502632.1| PREDICTED: chloride intracellular channel 5 isoform 2 [Equus caballus]
    MNDEDYSTIYDTIQKETTYEVPDQPEEGEAPLYDNVQEDLKSENNVYAAELETHEYDSVSVYAAAGEEDSLASSQPEEGD
    YVLPDDVCSEAQDLQSDEPQEERDISTEELHSPAQDQEPSPEEPQERGRMMKEDLPPPSSFIVQQSRTLSTSEASATYSV
    ADGLEDGESASTGPEINLFVKAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGD
    VKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKPQNNAALERGLTKALKKLDDYLNTPLPEEI
    DANTRGDDDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAADTEIEL
    AYADVAKRLSRS

    >gi|149732242|ref|XP_001502627.1| PREDICTED: chloride intracellular channel 5 isoform 1 [Equus caballus]
    MTDAATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGD
    VKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKPQNNAALERGLTKALKKLDDYLNTPLPEEI
    DANTRGDDDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAADTEIEL
    AYADVAKRLSRS

    >gi|194217398|ref|XP_001502218.2| PREDICTED: similar to nucleoredoxin [Equus caballus]
    MMCSLQKDQLFSVRWTQNKLSSSLSVKLTWNKYRICNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVI
    AGPLLRNNGQSLESSSLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAGQKFEIIFVSADRSEDSFKQYFSEMPWLA
    VPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAVQLNEGPCLVLFVD
    SEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEIT
    PAIVEAFVNDFLAEKLKPEPI

    >gi|194205713|ref|XP_001916919.1| PREDICTED: similar to arsenic (+3 oxidation state) methyltransferase [Equus caballus]
    MTLGLAGPEVRRGGTALGRWAGSGGISRTPGRDPACLPWGGASGALGLGSRLRGAQVLESRDRGDMAAPRDAEIWKDVQT
    YYGQVLKKAADLQTNACVTSTRPVPKHIQEALQNVHEEVALRYYGCGLVIPECLENCWILDLGSGSGRDCYALSQLVGEK
    GHVTGIDMTEGQVEVAKKYIGYHMEKYGFQVPNVTFIHGYIEKLGEAGIKNESYDIIISNCVINLVPDKQEVLKEVYRVL
    KHGGELYFSDVYASLELPEEIRTHKVLWGE
    CLGGALYWKDLAILAQKIGFCPPRLVTASLITVQNKEVERVIGNCRFVSA
    TFRLFKLLKTEPAKRCQVIYNGGITGHKKELIFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLITPIGEKLPTCGGCS
    ALESKDVITDPFKLAEESDNMMSRCPPDVASGCCGTKKSC

    >gi|149759839|ref|XP_001496942.1| PREDICTED: similar to KAT protein [Equus caballus]
    MAGAPAVSLPELRSLLALGRARLIDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSTQKPKLEDENLIFFCQ
    MGKRGLQATQLAQGLGYTGARNYTGAYREWLQQEG

    >gi|194224536|ref|XP_001914719.1| PREDICTED: similar to molybdenum cofactor synthesis 3 [Equus caballus]
    MAARDEVLALQAEVAQREEELSCLKQRLAAALLAEQKAERRVPVSPLPPKASLSRDEILRYSRQLVLPELGVHRQLRLAT
    ASVLVVGCGGLGCPLAQYLAAAGVGRLALVDYDVVEMSNLPRQVLHGESLAGQAKVFSAAAALRRLNSAVECVPYAQALT
    PATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYHGGPCYRCVFPQPPPAETVTN
    CADG
    GVLGIVTGVVGCLQALEVLKIAAELGPSYSGSLLLFDALRGHFRCIKLRSRRPDCAACGERPTVTDLQDYEAFCGSSATD
    KCRSLQLLSPEERVSVTDYKRLLDSGAPHLLLDVRPQVEVDICRLPHALHIPLKHLQRRDAESLKLLGEAIRKGKQGTQE
    GAALPIYVICKLGNDSQKAVKILQSLTAVQELESLTVQDVVGGLMAWAARIDETFPQY

    >gi|149742383|ref|XP_001494002.1| PREDICTED: similar to chloride intracellular channel 6 [Equus caballus]
    MPRRRLRGSPGTPAAPEAEGEAERGPEEPGGGAPGAPGASMDAEGPAEGPEGGAHGAQGEPRDGGHRSPQPQAEAMEAAV
    VESEEHSPGELAAEPRGAAGEAGTPRGEESEEAAPGEGRADAGEDGDQSGAQEEMEEAEKERREQGLEEPGQDATAGNEK
    EPLEGSADGEAATPTGAAEPEAELSNHLAEEGSVEGGDETAARVNGGGEDSEASEEGAPGQEHDITLFVKAGCDGESIGN
    CPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAPPRYPKLGTQHPDS
    NSAGNDVFAKFSAFIKNTKKDAHEIYEKNLLKALKKLDNYLNSPLPDEIDADSTEEVAVSGRKFLDGDELTLADCNLLPK
    LHIIKIVAKRYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVAKRMK

    >gi|149758579|ref|XP_001492801.1| PREDICTED: similar to thioredoxin reductase 3 [Equus caballus]
    MDDPIVKELFSSLGVECHILELDQVDDGASVQEVLSEITNQRTVPNIFVNKVHMGGCEQTFQAHQSGVLEKLLQGDSAYD
    YDLIVIGGGSGGLACAQEAAVLGKKVMVLDFVLPSPQGTSWGLGGT
    CVNVGCIPKKLMHQAALLGQALIDSRKFGWEYNQ
    QVKHNWETMTEAIQNHIGSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNRKGQETCYTAAKFVIATGERPRYLGIQG
    DKEY
    CITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGLGLDVTVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFV
    PVMIQQLEKGSPGKLRVVAESTEGPGAVEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAI
    GDILEGKLELTPVAIQAGKLLARRLFGGRLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVHKKENLEVYHTLFWPLEWT
    VAGRDNNTCYAKIICNKFDNERVVGFHILGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEITKASGLDI
    TQKGC

    >gi|194207379|ref|XP_001916231.1| PREDICTED: similar to Trx-like protein [Equus caballus]
    MGMLMCLAAHGYAPWCPACQNLQPEWESFAEWGEDLEVNVAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTK
    KDFINFISEKEWKNIGPVSSWFGPGSILMGSMSALFQLSMWIRTWHNYFIEDLGLPVWGSYAVFALATLLSGLFLGLCMI
    FVADCLCPSKRRRPQPYPSKKLLPESSQPLKKVEEEQEADEEDVSEEEAERKEGTNTDFPQNAVRQRSVGPALAADQS

    >gi|194214486|ref|XP_001489598.2| PREDICTED: similar to thioredoxin domain-containing 2 [Equus caballus]
    MVTGVDIDKELEMENDKPGAPEEPEVRPDKQEGTNEGDANESPLLQVLSSHMTLLVPEFLDSAHTQEKAFVHEAGNIQHK
    PAEEFEVPQPPDTFLPEQSGDISNSSAKTMQPKESDTLSSSAKSITPKQADTPNTSAKTMQADTPNSQAKTILPKQADTP
    NSPAKTTQADTPNSPARTMQADTPNSQAKPIPPKQADTPNSPAKTMQADTPNSRAKTISPKQADIPNSPGKTVPPKQGNT
    PNSPAKTIPLKQGNIPNSPAKSILRKQSNIPKFSAKTILPKQGNTPESSEGTIQPKEGDTPKSSEGTIRPKEGNTPKSSE
    GTIRPKEGDTPKSSEGTIQPKEGDTSKSSEGTTQLVEGDIPKPAETTVELLEADMVKVILSKEDFKLALQEAGERLVAVD
    FSAMW
    CGPCRTIKPLFRSLSVKHDDVVFLEVDADDCEELVKDLEISCIPTFQFYKKEEKVGEFCGALKEKLETVIAELK

    >gi|149732344|ref|XP_001491405.1| PREDICTED: similar to Chloride intracellular channel protein
    MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI
    EEFLEAVLCPPRYPKLAALNPESNTAGLDVFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTTPLPEEVDETSAEDE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFSIPEAFRGVHRYLRNAYAREEFASTCPDDEEIELAYEQVAKAL
    K

    >gi|149758691|ref|XP_001488273.1| PREDICTED: similar to TXNRD2 protein [Equus caballus]
    MEGRQGYDLLVIGGGSGGLACAKEAAQLGKKVAVVDYVEPSPRGTRWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAPHY
    GWEVPPLVPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVNEHMVCGVTKDGKETLLSAEHIVIATGGRPR
    YPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGLGLDATVMVRSIPLRGFDQQMSSLVTEYMASHGT
    RFLRGCTPSRVGRLPDGQLQVTWEDLASGKKDVGTFDTVLWAIGRVPETRSLHLENAGVNTHPNSQKILVDAGEATSVPH
    IYAIGDVAEGRPELTPPAVMAGKLLARRLCGQSSDLMDYDNVPTTVFTPLEYGCVGLSEEKAVARHGEEHVEVYHAYYKP
    LEFTVAERDASQCYIKMVCLREPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMRTLGIHPTCAEEVAKLRITKRS
    GLDPTVTGC

    >gi|194238516|ref|XP_001916285.1| PREDICTED: similar to Protein disulfide-isomerase-like protein of the testis [Equus caballus]
    MEWLWMSLLLVASCTSTVQGSREVDVKEASINTSQPLHILVEHNLLVLTPAGLTHRLNQTRFLMVLFYIPSSKQSRNMAE
    ELGKAAEIMGKGKNGVGFGKVDITIEKELQKEFDIKKTPDLKLFFEGNRSEPISCKGVVESTALVVWLRRQISQKAFLFT
    DTQQVVEFVKSRPLVIIGFFQDLEEEVAELFYDVIKDFPELTFGVTSISNAIGRFHVPLDSVLVFKKKHQSSDEIPKFWD
    QGPVKQLVGKNFNVVVFDKERDVFVMFYAPWSQK
    CRALLPVLEELGRKYQNHSTVSIAKIDITANDIQLMKLDWYPFFRL
    FPTDSQKVVPYKGEYTMKGFSDFLESQIKTRIEDEDELLSIEQSAVIEEEVLAEEEEVPFMEKELPEQKLTELENGTKPE
    YPAGQKEIAEKERKVAKPKGPPRQEKKPRVKEEL

    >gi|194212345|ref|XP_001490760.2| PREDICTED: similar to Methionine-R-sulfoxide reductase B3, mitochondrial precursor (MsrB3) [Equus caballus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDQKSCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYIRHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVISSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSASLSFT
    PADGLGAGGSGAGSEGRADKAEL

    >gi|194213066|ref|XP_001915062.1| PREDICTED: similar to Peroxiredoxin 2 [Equus caballus]
    MACGNAHIGKPAPDFHATAVVEGAFREVKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSEHAEDFRKLGCEVLGVSVDSQ
    FTHLAWINTPRKEGGLGPLNIPLLADVTRSLSHDYGVLKEDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQ
    AFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

    >gi|149737405|ref|XP_001493411.1| PREDICTED: similar to glutathione transferase zeta 1 isoform 1 [Equus caballus]
    MQAGKPILYSYFRSSCSWRVRIALALKSIDYETIPINLIKDGGQQFSEEFQKLNPMKQVPALKIDGTTIGQSLAIIEYLE
    ETRPTPRLLPQDPKKRAHVRMISDLIASGIQPLQNLSVLKEVGQENQLTWAQEAINFGFNALEHILQTTAGKYCVGNEVS
    MADLCLVPQVANAERFKVDLTPYPTISRINKSLLALEAFQVSHPCRQPDTPPELRA

    >gi|194217119|ref|XP_001499729.2| PREDICTED: similar to MGC142822 protein [Equus caballus]
    MRASPAPTARTGAGRGCHSRTGTRSSDRQRSRSRPEACKDAAPGLRRPLPLQELETDDLPGTETTPRNKDWNHVLSSHQE
    DFLRGPGAWRPGLDPNASHLLLWKQLLHMRGLLLPGARPGLAASRRGSSSRDKDRSVSVSGSVPMPAGGKGSRTNCSQAT
    PQKVPNRLINEKSPYLQQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYST
    CHWCHMMEEESFQNEEIGRLLNEDFVSV
    KVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFHTVLQRIREQWKQNKNTLLENSQ
    RVTTALLARSEISMGDRQLPPSAATMNSRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRLTQDGSRAQQMA
    LHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQLAVAYSQAFQISGDEFYSDVAKGILQYVTRNLSHRSG
    GFYSAEDADSPPERGMRPKEGAFYVWTVKEVQQLLPEPVPGATEPLTSGQLLMKHYGLTEAGNISSNQDPKGELHGQNVL
    TVRYSLELTAARFGLDVDAVRTLLNTGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGLERLINYAINCAK
    FLKRHMFDVASGRLMRTCYAGSGGTVEHSNPPCWGFLEDYAFVVRGLLDLYEATQESAWLEWALRLQDTQDRLFWDSQGG
    GYFCSEAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAH
    QQTLKQIVICGDPQAKGTKALLQCVHSIYIPNKVLILADGDPSSFLSRQLPFLSTLRRLEDRATAYIYGSQVCSLPVTEP
    CELRKLLHQ

    >gi|194222760|ref|XP_001500235.2| PREDICTED: similar to Protein disulfide-isomerase A5 precursor (Protein disulfide isomerase-related protein) [Equus caballus]
    MARAGPAWLLLLAVWVVLPAWLSSSKVSSLIERISDPKDLKKLLRTRNNVLVLYSRSEAAAESHLRLLSTVAQAVKGQGT
    ICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSLVAFLKDPKGPPLWEEDPGAKDVVHIDSE
    KDFRRLLKKEEKPLLMMFYAPW
    CSMCKRIMPHFQKAATQLRGHSVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFL
    LQYDHYGSTAEDIVEWMKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPW
    CGHCKKMKPEFESAA
    EVLHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKNGEKYTVPVLRTKKNFIEWLRNPEAPPPPEPTWEEQQTSV
    LHLMGDNFRETLKKKKHTLVMFYAPW
    CPHCKKVIPHFTATADIFKDDRKIACAAVDCVKEKNQDLCQQEAVKAYPTFHYY
    HYGKSAEKYEGDRTEQGFTNFIRTLREGDHERLGKKKEEL

    >gi|149730284|ref|XP_001488500.1| PREDICTED: similar to copper-transporting ATPase [Equus caballus]
    MEKTGGETPGSPEQSFLATLSDPQVTLLSVHKWQSFRRSLGARGSTRQVTAEEEGSLPLEEGEFSRKVLNGTREVSSTQN
    PEPANCQVLNLAVWRGYLEETKVQQPPDGSQYQLATNHILSKLSLPARGWEPTMKQSFAFDNVGYEDSLDGVCPSQTSTG
    TISILGMTCQSCVKSIEGRISTLKGIVNINVSLERGSATVKYMPSVVSLPQVCRQIEDMGFTASTAEGKSVSWPSGSSSA
    LEAMVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLSNQEAVITYQPFLIRPQELRDHVNDMGFEAVIKNKVPPLSLG
    PVDIGRLQSTNPKTPSASANQNSNNSETLGHQGSQLVTLQLRVDGMR
    CKSCVLHIEESIGRLPGVQNIQVSLENRTAQVQ
    YDPSRVSPGDLQRAIEALPPGHFKVSLPDGTEGSGADNGSSTRHSPSPLQRTQVQGTCRTVVLAIAGMACASCVQSIEGL
    ISQREGVQRVSVSLAKGTGTVLYDPSVTNPEELRAAVEDMGFEVSVISENGSSNHVGNHTVENSMVQTAAGSPLSVQEVA
    PYTGGPPQNHSSGRSSKSRQATATVAPQKCFLQVTGMT
    CASCVSVIEKNLQKEDGILSVLVALMAGKAEVKYNPEVIQPL
    EIARLIQDLGFEATVMEDCTGSDGDIELIITGMT
    CASCVHNIESTLTRTNGITYASVALTTSKAHVKFDPEIIGARDIVK
    IIEEMGFHASPAQRNPNAHHLDHKAEIKQWKKSFLCSLVFGIPVMGLMIYMMIPSNEPHESMFLNHNIIPGLSILNLVFF
    ILCTLVQFLGGWYFYVQAYKSLRHRAANMDVLIVLATSIAYVYSLSILVVAIAEKAERSPVTFFDTPPMLFVFIALGRWL
    EHVAKSKTSEALAKLMSLQATEATVVTLGQDNLIIREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGNTMADESLITGE
    AMPVTKKPGSIVIAGSINAHGSVLVTATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWI
    IIGFIDFGIVQKYFRTPNKHISQAEVVIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHK
    IKTVMFDKTGTITHGVPKVMRVLLLVDMAELPLRKVLAVVGTAEASSEHPLGVAVTKYCKEVLGTETLGYCTDFQAVPGC
    GIGCKVSSVEGILTHSEHLPSERTAHLNGVGSVPSEIDVAPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAI
    LVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVLITGDNRKTARAIAAQVGINKVFAEVLPSHKVAKVQELQNKGK
    KVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKKTIWRIRLNLVLALIYNLVGIPVAA
    GVFMPVGIVLQPWMGSAAMAASSVSVLLSSLQLKCYKKPDLERYEAQAQGRMKALTASQVSVHIGMDDRRRDPPRATVWD
    QVSYVSQVSLSSLTSDKLSRPGTAANGGDKWSLLLNDKDEEQYI

    >gi|149726875|ref|XP_001502811.1| PREDICTED: similar to Thioredoxin domain-containing protein 15 [Equus caballus]
    MQRRAGAVCRQQPGPDSRVKKDGHRPLLEHCPGLGVRKLKKPPEMKGAHLLEPRALRRTPRATGHRQAARLKNGARSGCQ
    LPRWRRGAARALPGSPPPAFSRLGARLVSPCAGCPSAWAGVPAAAARAMWLLGWWQVLLWVLAPPARGLEVAEESGHLWS
    EEQPAQPLQVGSVYMSEEEPSRGPMGQDTSAEEADAVLGLDTDGDHMAMLSVIPGEAEDKLSSEPSGGTCRAGGEEDSRC
    SLGESVFSLDSAGAGFPEREEEYYTEPEGAESDPAPPEDSNNTESLKSPKVNCEERNVTGLENFTLKILNMSQDLMDFLN
    PNGSDCTLVLFYTPW
    CRFSASLAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTL
    ETLKIFIFNQTGIEAKKNVVVTQADRIGPLPSTLMKSVDWLLVFSLFFLISFIMYATIRTESIRWLIPGQEQEHAEQ

    >gi|194207453|ref|XP_001490325.2| PREDICTED: similar to LOC523311 protein [Equus caballus]
    MCGSSARLKVSTRFRPEAGSPRHSVEFGPKAPHCPPQAAQAAAPTSLISASPWGTQAQSGGQHRGKLVSLEKYRGSVSLV
    VNVASE
    CGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVVGTGAHPAFK
    YLTQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEIRPHITELVRKLILKKREDL

    >gi|194216537|ref|XP_001489541.2| PREDICTED: similar to P4HB protein [Equus caballus]
    MRRSGTEGDIPGTCRLEPYMRRAPRAARRAAQPSTAFHLVFGPLRSLRPSSRWRLGSRFSGLTAVTSARGFTGPSHPASV
    LAAPRNNPLPGRRRTGLTCAGSCVSSAQEPRWQLATVVCEARACAQSQGEGGVGPEVYCPIAGRATRGAAPRDAAQWDGV
    LKEKGREVVRLGRVLLSESCFLFSDAPW
    CGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKF
    FKNGDTASPKEYTAGREAEDIVNWLKKRTGPAATTLPDGAAAEALVESSEVTVIGFFKDVESDFAKQFLLAAEAIDDIPF
    GITSSSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFVKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKS
    VSDYDGKLSNFKKAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCH
    RFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPW
    CGHCKQLAPIWDKLGETYKDHENIVIAK
    MDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDLEEDDDQKAV
    KDEL

    >gi|149728149|ref|XP_001502324.1| PREDICTED: similar to Protein disulfide-isomerase A6 precursor (Protein disulfide isomerase P5) (Thioredoxin domain-containing protein 7) [Equus caballus]
    MGLEQRDEHLVAGLMSCTLFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKD
    VVKVGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRSGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRS
    ESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGI
    RGFPTIKIFQKGESPVDYDGGRTRSDIISRALDLFSDNAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRN
    SYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGS
    TAPVGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDDLEKDEL

    >gi|194206717|ref|XP_001503038.2| PREDICTED: similar to protein disulfide isomerase-associated 3 isoform 1 [Equus caballus]
    MCPFPSVDLNTPSGSSSFSQFPPLPHLSPGSLPAHSALTSLLRPRLWRPLCPALLSQGELRVGSRARCGTFPAPPRRTPG
    PACAQTPQAEPCVVARPGFPQSPPKPRPFLAAPASPRRHATFRRLALLPGVALLLAAARLAAASDVLELTDDNFESRISD
    TGSAGLMLVEFFAPW
    CGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTA
    DGIVSHLKKQAGPASVPLKTEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRDNYRFAHTNVESLVNKYDDNGE
    GITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRN
    RVMMVAKKFLDAGNKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNL
    KRYLKSEPIPESNDGPVKVVVAENFDEIVNDEKKDVLIEFYAPW
    CGHCKNLEPKYKELGEKLRKDPNIVIAKMDATANDV
    PSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPIIQEEKPKKKKKAQEDL

    >gi|149690645|ref|XP_001492302.1| PREDICTED: similar to ERO1-like protein beta precursor (ERO1-Lbeta) (Oxidoreductin-1-Lbeta) (Endoplasmic oxidoreductin-1-like protein B) [Equus caballus]
    MSRGVRRAGAGQGAAAAVQLLVTLSFLPSVVEAQVTGVLDDCLCDIDSIDNFNTFKIFPKIKKLQERDYFRYYKVNLKRP
    CPFWAEDGH
    CSIKDCHVEPCPESKIPVGIKAGSSNKYLKVANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDS
    QDHFCELDDERSPAAQYVDLLLNPERYTGYKGPSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLC
    LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNMKEFKRRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPY
    FERSIVDLYTGNVEEDADTKTLLLNIFQDTKSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWG
    KLQTQGLGTALKILFSEKEIQKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKVLLQHSR

    >gi|149707887|ref|XP_001496882.1| PREDICTED: similar to non-selenium glutathione phospholipid hydroperoxide peroxidase [Equus caballus]
    MPGGLLLGDEAPNFEANTTVGRIRFHDYLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKMIALSIDSVEDHL
    AWSKDINAYNGDEPKETLPFPIIDDKNRDLAILLGMLDPAEKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEI
    LRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

    >gi|149727292|ref|XP_001492042.1| PREDICTED: similar to phosducin-like 3 [Equus caballus]
    MQVSEPRAGGLEAAAACLPHWVLADGGLSQPGLREAPGAAGTGEATRVEAGRRRSAGGRAWSRRDLRAGRPYPSVSCPDP
    NADTEWNDILRKKGILPSKESLKELEKKAEEEEEQRVLQQSIVKTYEDMTLEELEDNEDEFNEEDERAIEMYRQQRLAEW
    KATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPL
    CALINQHFSALARKFPDVKFIKAISTTCIPNYPDKN
    LPTVFVYLEGDIKAQFIGPLVFGGMNLTVDELEWKLSESGAIKTDLEENPKKPIEDALLSSVRCSVPTRRDSDSEDD

    >gi|149727132|ref|XP_001490320.1| PREDICTED: similar to ATP binding protein associated with cell differentiation [Equus caballus]
    MEANASVDMFSKVLENQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLEALRKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKKVVCHFYRDSTFR
    CKILDRHLVILSKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDYVVG
    FTDLGNTDDFTTETLEWRLGCSDILNYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

    >gi|149722824|ref|XP_001503936.1| PREDICTED: similar to CG12279 CG12279-PA [Equus caballus]
    MVPLRLLLWSARWAILGSADSALWGVKSIKGSCHNFCTAVSEDVTYEELKNRLNSKSIMLIDVREKWEILEYGKIPGSVN
    IPLAEVSEALQMNPKAFHEKYNEAKPSRSDRLVFS
    CVAGVRSKKALDTAISLGFSSAQHYAGGWKEWATYECSEKKERN

    >gi|149705581|ref|XP_001496165.1| PREDICTED: similar to anterior gradient 2 homolog [Equus caballus]
    MEKISVSAFLLLVALSYTLAKDTTVKPGAKKDAKDSGPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDE
    CPHSQALKKVFAENKDIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPSDAALL
    LDNMRKALKLLKTEL

    >gi|194208142|ref|XP_001915482.1| PREDICTED: hypothetical protein [Equus caballus]
    MSTVDLGRVGALVLKHALTGRAVGPCHPSPSTAQAVELRDLWQEQACVVAGLRRFGCMVCRWIARDLSSLKGLLDQHGVR
    LVGVGPEALGLQEFLDGGYFAGELYLDESKQFYKELGFKRYTSLSILPAALGKPVCDVAAKAKAVGIQGNLSGDLLQSGG
    LLVVTKGGDKVLLHFVQKSPGDYVPQESILQALGISAEVCASAPPQCDEEACTR

    >gi|149706006|ref|XP_001496192.1| PREDICTED: similar to breast cancer membrane protein 11 [Equus caballus]
    MMLHSALVFCLLLITVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHIQKSNKPLMVIHHLEDCQYSQALKKV
    FAQNKEIQEMAQNNFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADLTGKYSNRLYTYEPQDLPVLIENMKKALK
    LIQSEL

    >gi|194224679|ref|XP_001493974.2| PREDICTED: similar to UPF0308 protein C9orf21 [Equus caballus]
    MEQAATALSMLADDIHQHSALCKGDPHGLQVDKYHRQKTLFSESQIQIQRLRLPFVLLFRERRAVVVFMRHFLCYICKEY
    VEDLAKIPKSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIAFSGKSPHIKSNILSGS
    IRSLWRAMTGPLFDFQGDPAQQGGTLILGPGNNIHFIHCDRNRLDHKPINAVLQLVGVQPVDFTGRPSVTHV

    >gi|194226060|ref|XP_001494884.2| PREDICTED: similar to chloride intracellular channel 3 [Equus caballus]
    MAETSKLQLFVKASEDGESVGHCPSCQRLFMILLLKGVPFTLTTVDMRRSPDVLKDFAPGSQLPILLYDGDAKTDTMQIE
    EFLEETLGPPKFPSLAPRYRESTTAGNDVFHKFSAFIKNPVPAQDHALYQLLLRALARLDSYLRAPLEHERAREPQLRES
    RRRFLDGDQLTLADCGLLPKLHIVDTVCAHFRQAPIPAELRGVRHYLERALQEKEFKYTCPHSAEILAAYRPAVHPR

    >gi|126352340|ref|NP_001075282.1| thioredoxin [Equus caballus]
    MVKQIESKSAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVAAECEVKCMPTFQFF
    KKGQKVDEFSGANKEKLEATIKGLI

    >gi|194205536|ref|XP_001488597.2| PREDICTED: similar to Thioredoxin-like [Equus caballus]
    MRVADAALPLHSQRSEGVSLRHFRRGAEGWRGVHRQSLVVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPE
    VSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHASSGSFPPSGNEHPKEDLNLRLKKLTHAAPCMLFMKGTPQ
    EPR
    CGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSSWPTYPQLYVSGELVGGLDIIKELEASEELDTICPKAPKL
    EERLKVLTNKASVMLFMKGNKQEAK
    CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGL
    DIVKELKENGELMPILKGEN

    >gi|194205540|ref|XP_001488475.2| PREDICTED: similar to Methylated-DNA--protein-cysteine methyl
    MMDSPLGKIELSGCEQGLHGIKLHGRKGADTDPVEAPAPPELLGGPEDVAEPLMQCAAWLDAYFHKPALLTELPLPALHH
    PVFQQDSFTRQVLWKLLKVVKFGEMISYQQLAALAGNPKAARAVGGAMRNNPVPILIP
    CHRVICSSGAVGNYSGGLGVKE
    WLLAHEGSLVEGPSRGGGSRLARSWRGALGGTTSSQPAGRN

    >gi|149699297|ref|XP_001500313.1| PREDICTED: similar to thioredoxin-like 4B [Equus caballus]
    MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTPVYTHYFDISYIPS
    TVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLVEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

    >gi|194219224|ref|XP_001916468.1| PREDICTED: thioredoxin domain containing 11 [Equus caballus]
    MSHFLLCEAVALSYTLLLALKITCNRAKDVIIPAKPPVSFFSSRSPVLDLFQGQLDYAERVRRDSEVVLLFFYAPWCGQS
    IAARAEVEQAARQLSDQVLFVAINCWWNQGKCRKQKHFFYFPVIYLYHRSFGPIEYKGPVSAVYIEKFVRRVMTPLVYVP
    SQSELLDFLSNYEPGVLGYFEFSGSPQPPGYLTFFSSALHSLKKDYLGTVRFGVITNKHLAKLVSLVHSGSVYLHRHFNT
    SLVFPREVINYTAENIYKWALENRETLLRWLRPHGGKSLLLNNELKKGPALFLFIPFNPLAESHPLIDEITEVALEYNNC
    HRDQVVERLLQHLRRVGCPGVQPWAPESPVGLPEPPLIAASPCCNTVVLPQWRSLSRTRNVCELCVNQTARVVGPGSIST
    PRCSFLSRWQARWDSFYLKEQTFHQVASGSTECSNFLSSYSPFRYYTACCRTVSTAHXRGLLGSERDASESPATAFSSLE
    ESCEVGPASSVPHIEENRDLFPEADVRSTDFTGLSCRTNKTLNIYLLDSNLFWLYAERLGAPSAARVKEFATIVDVKEES
    HYILDPKQALMKLTLESFIQNFSVLHSPLKRHLIGSGSAQFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAQW
    CGFCPAL
    NHVFIQLARLLPADTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCKRKDLSVKYPEDLPITLPDLLRFVLRHSDPAPAPP
    SSATPPTGECLQSEAVLQQGHISHLEREIRKLRAEISALQRAQGQVEARLSSARRDEHRLLRQKQTLERQHGLLQLHSEQ
    LQALYEQKTQELEEVARKLQELADASESLLTENTWLKILVATMERKLEGKDRAESPTPPEEARAVPPEPPGAPRLPGSTP
    PSNGSATLASDRSNENRTD

    >gi|149721195|ref|XP_001494862.1| PREDICTED: similar to Thioredoxin-like protein 4A (Thioredoxi
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY