Encephalitozoon intestinalis ATCC 50506 uid51607

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|303388097|ref|XP_003072283.1| thioredoxin-like protein [Encephalitozoon intestinalis ATCC 50506]
    MPYGQEDIGIPRDGEAFMRYREKRIQELSGNVEDITSERELIEKTKSLKMIVHFYKPEFGRCQTMDKRVREIKNCFPEIR
    FYRVNAEICPVVTRKLEIRVLPFLGFFKDGYFVDQVVGFEKLGDNLDLEALKKRISDSNIFKPISSI

    >gi|303388141|ref|XP_003072305.1| thioredoxin [Encephalitozoon intestinalis ATCC 50506]
    MHFIGKQNNPKMPIVVRDCSGMSTGEISAKVREIGKPVLLKFSSEGCAPCEDLKEKLGQYQTDLEVNVLELRRTRTSSYA
    DLWDKFDITAFPTIVLVDKDLEEIRSTDEINGKTLSRIIGSNIKKFEELINGHRNLFKQGCSQ

    >gi|303388327|ref|XP_003072398.1| glutathione peroxidase [Encephalitozoon intestinalis ATCC 50506]
    MDQNLESQTFYNLSARGWNGEEVNFSVFRGCVLIIVNVASSCKLAEGNYKSFVGLLEKFYKKNLRILLFPCNQYLGQEPK
    PIERIHREVSEKYSDKFEVMDKVEVFGENAHPVFKHLTSTKNGKGTFGNFIKWNFTKFLVDRSGHVVKRFGPSNIIKEDE
    ECLLNIIGDEGEEQSPLMG

    >gi|303388407|ref|XP_003072438.1| protein disulfide isomerase [Encephalitozoon intestinalis ATCC 50506]
    MLLVYLLGCLAEIVEQCKPINEGYVLSKYFAQWCPACQNMGPLIEEISNKIDRHEANLKIRSVDCDECSCPNVKSYPTLE
    MSKDGETLGKLEGPQDYDEIIEFIVNHTGIERSVFEGHAAQKEAEVRRLNKNDFLSGFDGPHIVLFYSREDDKYREIFKE
    IAKIYNGKLNVGEIDSAESAEFVNRYDIRSYPSISGIYNGLVVPFIEKGKEPSMPNLIEFCDKLIEQSFANLTLAKFGEL
    ASKLEPGEPIYVVFHKNLALANAYFQRMAHMYKFRASIYRSDDQALFEKASIFPKELGSGSDTTSSPNHEDVVILSVYKN
    GVFYRYSDTFGDETKITDWIFHTHYRYLTRIDNHNFYSIFHGLKPVMILLTRGEELVNKMNEFSADRHLGVPYTDMIFAT
    MEIDEYPLFVPTLLPRLSTPALIVFEPWRNLFRHKKAKLTEDNFISTAMDTYTLYQNNRLPLYPPKSHNVLKYCLLGGLV
    LGVGLYYSSKAGFAKKNK

    >gi|303388425|ref|XP_003072447.1| thioredoxin reductase [Encephalitozoon intestinalis ATCC 50506]
    MENIVIIGSGPAAYNAALYTMRGNPLLFEGGYIGNNGPGGQLTTTTSVDNYPGFPGGIEGPELTQLMKEHAVSRGLRVVK
    ETVSDVRKEDEWFVVSSEKGEKKARIVIVATGASARRLFVPGTGDDEFWQKGVSS
    CAVCDGFIYVNKVTCVIGGGDAAME
    EGLYLSNIAKKVYIIHRRNEFRARSDMIEKARNTENIEIMTPYVLERAEGTNKIKEIVVRNTETGETKTIPMDGVFFGIG
    HDPNTSFLKSVNVDLDSNGYIVVKDDACTSVPGLFAAGDVCDRKYRQAVTAAASGAICGIKAMEFLDKNK

    >gi|303388705|ref|XP_003072586.1| ubiquitin-activating enzyme E1 [Encephalitozoon intestinalis ATCC 50506]
    MKNNEEVEIDESLYSRQLYVVGKDAMKKMMNSRVLVMGLDGLGQEVAKNICLAGVSKVTLFDDRIVEEEDLCTGFYLRRE
    DIGKARDASVVEKFRSMNEYVDVSVASEVNNFEGYDVVVVCNEGYGEQIKLNEMARKDKCMFVGCQVRGLFSQVFCDFGA
    EFICVDRTGEIPMSGMINDISEDGVMTVVDGQRHNLEDYDIIKITQCEEYEGKYFRVKVISPTQVMLQGVDGVRMFEEEA
    EFKAERFKSVYGGDFEQQKKPSMISFKPLGRTIDEPRILGFNYEVEERNLVIHKCFVALGEYMKQSKQTPSGEEFLSFFV
    RKYKSHFEFEALIRSFGRQCGGTLMPMCSVVGGFVAQEILKAVGSRFTPLHQFFYFDAMDVVPGDPKDDGKDYGRYGPMV
    RCLGKECVEKLFNLHVFMVGAGAIGCEHLKNMVMCGIGSRGRVSVTDMDAIEQSNLNRQFLFRSGDVSSMKAEIAVGKAI
    ELNEDFLKIPLERGEEKLEGKDVSEMTNGMSGSGLPYSNLVYYNLKVGKETESVFSDRFFQSVDVVATALDNVDARIYVD
    GRCVVNRKFMVDAGTSGTKGNVQVVVPFHTESYGSSQDPPEKSIPL
    CTIKNFPYAIEHTIEWARSEFEFKFHDEILLIKE
    YLGREKKNGGEGKEEASNETMEDIVEKTPRSAKECIRNGILLFVKLFHTSIKNLITAFPPDSKTKEGQPFWMPPKRSPVT
    ISFDVNNSLHVLFVQSTANIFSFNFGIGEHISREMVVDFVKNEILVEEFSSAVDNICVEESPRPPVDPSAITPCTFEKDD
    DSNFHVDFLYAAANLRAMNYKIKQADRLTVKGIAGRIIPAIATTTAVVSGLAILEMIKYALGVEHTKHKNSFLNLALPFF
    ASTDPVEPMKQLYKIENKKYTFTLWNRLEYKDSKLGTILKAFEIQFKKKISMVTAENALIYWDFDSKYADNLEKTVGELV
    GRKPDELFVMLDVITDDEEGEFPRIVVVFE

    >gi|303388757|ref|XP_003072612.1| thioredoxin peroxidase [Encephalitozoon intestinalis ATCC 50506]
    MIQIWNVFPYICRKINSTLMKFPKVLTSNKYKALVDGEIKEISLEDYRGKYVVIVFYPLDFTFVCPTEVNRFCDLKEEFL
    KRNALVLFVSCDSVYSHRAWASISRENGGILGVSWPMIWDMKRELCNQFEMFDEENGHPMRGTVILSKDLDVKHLSINYH
    AVGRSVSEILRLIDAITFNDENGEICPVEWKKKMNNH

    >gi|303388775|ref|XP_003072621.1| molybdopterin and thiamine biosynthesis E1-like protein [Encephalitozoon intestinalis ATCC 50506]
    MVFESDLPEATLERYSRQIIVPGIHVKGQKSLGSSGVLVVGCGGLGSPAILYLLSCGIGRIGLVDFDKVEIHNLQRQVIY
    TEADVSQYKVTAALSFVKRANSLIKAVGYNEFLGRENVERIVAPYDIVLDCTDSICTRYLLSDCCQALSKSLICGSVLRW
    EGQLYKLTPDGPCYRCLFPDMRERTLT
    CEDAGVVGPICGIIGSLQALEAIKTIMGNTEPKMTIYNGITSNFVDSKLRSSR
    NDCIVCSRKCIPEDLYFPTAKCTAVSDDKATNQNVETINWEDILNNLDSYLLIDVRPPIQHEMFRIKGSVSIPLADLPDK
    IGDIEASGKKIGVV
    CKRGISSRKGAWILNMNGIEAFSVNGGVDRLKSLLRKTGAGP

    >gi|303389138|ref|XP_003072802.1| hypothetical protein Eint_041550 [Encephalitozoon intestinalis ATCC 50506]
    MNIVFLLLGKVISDAFSQLPVLRKEDISLDDAFLVYIYYSRPNVHCPACESFNQSISDLQKYIPVKKINFFEDPKIASRF
    YTFLFPSFVVRDKGRSYHLDVDSFEELEEIIRDRKWTQFKPIRLWMDVDSYFINMYSLANCIFFKAMQRLYVVFDTVPEW
    AINFGFSAIIGYMVYSICLVFMVPPSDKKKE

    >gi|303389437|ref|XP_003072951.1| glutaredoxin-like protein [Encephalitozoon intestinalis ATCC 50506]
    MNGIEDSNPFEELKEYEVVVAYDDENKKLSNVMKDRGLDYVEVNLAVSEKLRTEFMKHFRVSELPVLLIEGIPALDDPSE
    RIKEYIERKEKKSLEKIQSVIDPNKITLFIKGSPEHPR
    CGFTKSLIEILYGLGVTRDKIEYLDVLSDEDIRERLKEINRW
    PTFPQVYIRGRFIGGLDIVRKMSEKGKLKDELSGII

    >gi|303389674|ref|XP_003073069.1| mitochondrial sulfhydryl oxidase [Encephalitozoon intestinalis ATCC 50506]
    MKREKGYGKILAVLIAAWIIYRCYEFVAGNREKKISNLSSWNGVRLEDFQVRKMNKKEIRERLGRATWTLLHTMGSRYPA
    SPSFQQKKDTLSFIHLLSSLFP
    CGECTKHFQKLIQDHPPRVGSGKEFKTWLCEVHNIVNERLGKTIVDCRTVDEIWQCGC
    EA

    >gi|303390394|ref|XP_003073428.1| glutaredoxin-like protein [Encephalitozoon intestinalis ATCC 50506]
    MLLIYGIQGIEIEWSISEKDTDYEKIIREEKCVLFIKKFCPFSIKARELLYNKGISCKIIPVDGRIKPYNFAKTYQSTFP
    VFFFNGTFIEGGYQKLKDLSIHKLPPFDQSPLFTEGSYEASFRSKIK

    >gi|303390781|ref|XP_003073621.1| glutaredoxin [Encephalitozoon intestinalis ATCC 50506]
    MKGGELEKALDKNENLIVSKEGCPFCLDAVEILNEWKIKFDEVRNIENEELSKEIERRYGISTFPKIFLKRRFVGGASDL
    RKYVTKKEFVDAFGSERK

    >gi|303390829|ref|XP_003073645.1| protein disulfide isomerase [Encephalitozoon intestinalis ATCC 50506]
    MFGIMLGTVFFSGYAMAEAVHMQDSTLLDNLKIVPSPSMIGMVRDMKSIVSYVSEDEKFDGEGIKIKHDGRMFVVSKAED
    VEGAVNILKKYPAPTEEVIKTIKSSDGKGIEGNFIIYFLDNSGYKEKLVGSREGLNVFVSTDPALASLLDASIPGIYGYN
    GRDRLSYKFPFSDKNATKIFSLTNLPIFGFTSAESISLYRSLDGTIFYIFFNPSSSLDVLNGYSGVLDDFRYDVRVILIP
    SVKDGINLEDYGLTEKDLPGCISISEDGGKYILRNVTKESISEFVKDVLGGKAEAFYKSQEEPKDNGSKNVKVVTRNNSK
    TYLGDVSKDRLVVFGTER
    CPHCIRIKPTLEKLGEIVKNNADDKVFIGYCDVDMNDMNDVEIRFVPTILLYKAGENKSIQY
    SGGERNLLNLITFIRESGSLGVDLSKFAGQEDESEKRKFEAGKEATGSWGEDARAEL