Encephalitozoon cuniculi

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|19073965|ref|NP_584571.1| GLUTATHION PEROXIDASE [Encephalitozoon cuniculi GB-M1]
    MERGMESEAFYGLSARGWDGSEVSLGSFRGCVIMIANVASSCKFAESNYKSFAGLLDKFYRKGLRILLFPCNQYLGQESR
    PIEEIRGEVSKKYSDRFVVFDKVDVFGKGAHPVFRHLVNTKNGKGRLGNFIKWNFTKFLVDRKGCVVKRFGPSDIVKEDD
    ENLLRSIEDGENGMQNS

    >gi|19074004|ref|NP_584610.1| PROTEIN DISULFIDE ISOMERASE [Encephalitozoon cuniculi GB-M1]
    MFRDVYTFLYKGSGSDKYMILFVYLLSCLGEIVEQCKPINEGYVLSKYFTQWCPACQKMGPLIEEISNKIDRHGANLRIR
    SVDCDECTCTNVKSYPTLELSKDGEVLGRLEGAQDYDAMVEFIVSHTRVEKGVFDGHVMQKDAAVKSLTKSDFLSGFDGP
    HVVLFYSREDDKYREMFKELAKIYDGKLSLGEIDSAESSELVNRYDIRSYPSISGIFNGLVVPFIEKEKTPSMASLIEFC
    DKLIEPSFRNLTLSKFDEVASKLEPGEPIYVVFHKNLALASAYFQRMAHMYKFRASIYRSDDQALFERASIFPKELGAGS
    DPSTSPSHEDAVILSVYKNGIFYRYSDTFGDEAKITDWIFHTHYKYLTKIDNHNFYSIFHGLKPAMILLTRGEEFVDRMN
    EFSADRHLGTPYTDMIFATMEIDEYPLFIPTLLPKLSTPALIVFEPWVNLFRHKKVKLTEANFTSAAMDAYNLYQSNSLP
    LYPPKPRTLLRYCMLGGLVLGIGLYCSSRTSFAKKNK

    >gi|19074013|ref|NP_584619.1| THIOREDOXIN REDUCTASE [Encephalitozoon cuniculi GB-M1]
    MENIVIIGSGPAAYNAALYAMDKEPLLFEGGYIGNNGPGGQLTTTTSVDNYPGFPDGVEGPVLTDLMKDHAVSRGLRVVK
    ETVSDLRKEGECFVVVSEKGERRARAVIVATGASARRLFVPGTGDGEFWQRGVSS
    CAVCDGFAYTNKITCVIGGGDAAME
    EALYLSGIAKKVYIIHRRNEFRARNDMVEKARETVNIEMVTPYVLESALGTSKVERITIRNVETGEMKTIPMDGVFFGIG
    HDPNTSFLKNTKVEMDLNGYIVVRDEVYTNIPGLFAAGDVCDKKYRQAVTAAASGAISGMKAVEFLCKE

    >gi|19173051|ref|NP_597602.1| UBIQUITIN-ACTIVATING ENZYME E1 [Encephalitozoon cuniculi GB-M1]
    MKNNADVDIDESLYSRQLYVVGKEAMKKMMGSKVLVMGLDGLGQEVVKNVCLAGISKVALFDDRAVSEEDLCSGFYLRKE
    DIGKPRDASVVGRFRSMNEYVDVDVVSDVNSFEGYDIVVACNESYGEQIRLNEMARKDGCMFIGCQVRGLFSQVFCDFGA
    EFVCVDRTGEIPASGMINDISEDGVMTVVDGQRHNLEDYDIIKITQCDEYEGKYFRVKAVSPTQVMLQSIDGVRMFEEEM
    EFKAEKFKPVYGGDFEQQKKPIMISFKPLGRTIDEPGILGFNHEVEERSLVIHKCFVALGEYMEQSGQELSGEGFLSFFV
    KKYKSHFEFEALIRSFGKQCGGMLMPMCSVIGGFVAQEVLKGVGSKFTPLHQFFYFDAVDVIPNDPEDDGRDYGRYGPMV
    RCLGKRCVERLFGLHVFMVGAGAIGCEHLKNMVMCGIGSNGRISVTDMDAIEQSNLNRQFLFRSGDVSSMKAEIAVREAM
    LLNEDFLKVPRRADSEEPERGVSEMTNGISCIGSAQPNLIYYNLKAGKETETVFSDRFFQSVDVVATALDNVDARVYVDG
    RCVVNRKFMVDAGTSGTKGNVQVVVPFHTESYGSSQDPPEKSIPL
    CTIKNFPYAIEHTIEWARSEFEFKFHDEILLIKEY
    LSREKEGTSEEEREEEPSNEAMEDVVDKIPTNGKECIRNGILLFVKLFHTSIKNLITAFPPDSKTKEGQPFWMPPKRPPM
    TVSFDVNNDLHILFVQSAANIFSLNFGIKQQISKEMVVEFVKNEILVEELSSAADNTCVEESPRPCIDPSAIVPCIFEKD
    DDTNFHVDFLYAAANLRAINYKIKQADRLTVKGIAGRIIPAIATTTAVVSGLAVLEMIKYALGVDYTKHKNSFLNLALPF
    FASTDPVEPVKHSYKIENKKYTFTLWNRLEYKDSKLGTILKAFEIQFKRKISMVTAGNSLIYWDFDSKYADNLEKTVGEL
    VNRRPDEMFVVLDVITDDDEGEFPRIVVVFE

    >gi|19173077|ref|NP_597628.1| THIOREDOXIN PEROXIDASE (THIOL-SPECIFIC ANTIOXIDANT PROTEIN) [Encephalitozoon cuniculi GB-M1]
    MFPKTLTDSKYKAFVDGEIKEISLQDYIGKYVVLAFYPLDFTFVCPTEINRFSDLKGAFLRRNAVVLLISCDSVYTHKAW
    ASIPREQNGVLGTAWPMVWDAKRELCNQFGLYDEENGHPMRSTVILAKDLSVRHISSNYHAIGRSVDEIIRLIDAITFND
    ENGDICPAEWRSENKDN

    >gi|19173086|ref|NP_597637.1| similarity to HYPOTHETICAL PROTEIN YABA_SCHPO [Encephalitozoon cuniculi GB-M1]
    MVFESDLPETDVERYSRQIIVPGIHVRGQKSLGDSGILVVGCGGLGSPAIMYLSSCGARRIGLVDFDKVEIHNLQRQVIY
    TEADVSQHKVVAALSFVRRANSSVEVEGYNEFLSRENVERIINPYDVVLDCTDNIHTRYLLSDYCKALGKSLICGSVLRW
    EGQLYKLTPNGPCYRCLFPNIKTETMT
    CEDAGVVGPICGVIGSLQALEAIKTITGDVEPKMTIYNGMTSDLMDFKLRTPK
    HGCSVCSKKCVPESSSFFMPPCTSATDLEDLDVDTVEWEDILDNLESYFLIDIRSPIQYEMFRVKGSVNIPLIDLPGKTG
    DIDASGKRIGVICRRGISSKEGAWILKRSGIHAFSVNGGINGLKNQLRKARQAESASG

    >gi|19173678|ref|NP_597481.1| similarity to HYPOTHETICAL PROTEIN YD98_yeast [Encephalitozoon cuniculi GB-M1]
    MALSQPLKMEVLDHNDAFEELKEYDVVVGYESESNELCNMLRNAGVDYVEVNLGESERLKAEFMKHFNVSKLPVLIIKGS
    PVSGDPSDKIREYAEEREGDILRRIQSTVDPKRVTLFIKGSPENPK
    CGFTKTLMDILYSAGVTKDQIVYFDILSDEDVRR
    KLKEINSWPTFPQVYIGGRFIGGLDVVRKMSEKGELRREIQEII

    >gi|19074359|ref|NP_585865.1| PROTEIN OF THE ERV1/ALR FAMILY [Encephalitozoon cuniculi GB-M1]
    MKREQSYGRILVVLAAAWVTYRCYGLMVRDREGKVSSELLGGSGKSENPRTEKLSKKEIRERLGRSTWTLLHTMGARYPA
    FPTYQQKKDTLSFIHLLSSVFP
    CGECTKHFQKLLSDYPPRVGSNEEFKTWLCEVHNVVNRRLGKTVVDCRTVDEIWDCGC
    EA

    >gi|19173463|ref|NP_597266.1| GLUTAREDOXIN [Encephalitozoon cuniculi GB-M1]
    MTEADYGEMVRREKCIMFVKRFCPYSIRARELLHDRGVGCKIIEVDNNLDAYSFAKRNHSTFPVFFLDGDLVEGGCEKLL
    VLSDSNLPPFDKSPLLTQNREPVLLD

    >gi|85014389|ref|XP_955690.1| thioltransferase [Encephalitozoon cuniculi GB-M1]
    MKGGELEKALDRSENLMVSKDGCPFCKDASEILKSWKIEFACIKNTENERLSKEIEREYGFSTFPKIFLKRKFVGGASDL
    KEYVKKKEFLDAFGSGRE

    >gi|85014427|ref|XP_955709.1| protein disulfide isomerase [Encephalitozoon cuniculi GB-M1]
    MFGSVFTIALFAGYTMGEGIHGQDIQVLDRLKIVPSPSMIGMLKDMKSIFSYVSEDEKFEGEGVEIKHDGRMFVVPKAED
    VEGAVDVLRKYPAPTEEIVKVMKSGSGGLNSKQGNFIVYFLDGSGYKADLRSNMEGSSAFISTDLSLASELEVPVPGIYG
    HNASDDLSYKLSFSNESTKKILSLSNLPVFGFTSAANISLYRSFDGTIFYIFFDTNRGEDIMKEYSGSLDSFRSDVRVIL
    IPSLKGNIDIGEYGLAEENLPGCVSISEDGGKYVLKNANRESLVGFVRDVLDKKAEIFYKSQEEPEDNSSRNVKVVTRNN
    IKSHLEDVGKDRLIVFGTER
    CPHCIRVKPIVEKLGEIAKDNADGKVLVGYCDVDLNDITDLEIRFVPTLLLFKAGGKESV
    QYSGGERNLQNLISFIRESGGLGIDLSKFVPAEPEQRRFEAGDDAKGPREDDVRAEL

    >gi|85691015|ref|XP_965907.1| thioredoxin [Encephalitozoon cuniculi GB-M1]
    MPAGHEDIGLPQDDEAFMRYRERRIQELCGKVEEVVSEKELIEKTKSLRMIVHFYKPEFKRCKTMDKGLEEVKDCFPGIR
    FYRVNAEICPVVARKLEIRVLPFLGFFKDGYFVDQVVGFEKLGGDSVEPEVLKKRILDSNIFKPISSI

    >gi|85691057|ref|XP_965928.1| thioredoxin [Encephalitozoon cuniculi GB-M1]
    MSAGRHPVPTAICPSSKERRFCFPAVIRHINKFYWKTKKAPMPIIVRSCNGMSMDEIKAKVKEAGRPVLLKFSSERCAPC
    EDLKEKLAQYETDLQVNIFDLCRTRTASYVELWDKFYITAFPTIVLVDEDMNEMQSSEDSAGQAGPYRMSGSNIKKFDEL
    IKRHKHLFE