Drosophila melanogaster

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|24639068|ref|NP_651990.1| CG3719 [Drosophila melanogaster]
    MLKIAAEGIAPRLAAACCSIGAKSRGQRMAPQAARGTQKYLSQSQHLHKMLVIKDHYEFDQKVINSDNPVIVNFHAEWCD
    P
    CKILTPKMLELLENSNEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKLKRKQQQKQ


    >gi|24639508|ref|NP_570060.1| CG12206, isoform A [Drosophila melanogaster]
    MAAITSNVSRLEPMRGISIIIESPEVATATPPPATTTATAEAEAATKQVAPTAKSNSNTEMSLKSQAAGMLLAFGDTAAT
    AKDNLETSYDTAAKSTAAPETNKIYPQLLLRIGGEIAGATASAEAAASAATAAAATATSPTIISCNGEIAASQAAATAAD
    TAATLQHNNTVKIQIESQGQQRTLGKQISVVKLNEGVEEMQQHMCYLVDTSGQYSPCETLDSGTGSDLENHPQQQQQPQQ
    VRSPQLELHLQTTRLMVNEEADHKHSPLETPSPVPKRAYSLTDDSEECDESSNSSLSCDSLHSGGLLPTTLLRDIRFRER
    ASGPLVTKINGRPLQFETDGYYTFHVREHENFRSFGSNSSTEYEAQHFTDEQPGEDFVGFRDIRTAGKLAGNSTIKSAKG
    TVRGVKNRVRNGVATFLQLQQPNVKNYMEKDVGKVVLYTTSMGIIRDTYAK
    CANVKKILRTLLIKFEERDIFMSVEYQQE
    MRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATAYTCQTCGGYRMLPCPACNGSKKSMHRNHFT
    AEFVALKCMNCDEVGLIKCPNC

    >gi|24639510|ref|NP_726865.1| CG12206, isoform B [Drosophila melanogaster]
    MAAITSNVSRLEPMRGISIIIESPEVATATPPPATTTATAEAEAATKQVAPTAKSNSNTEMSLKSQAAGMLLAFGDTAAT
    AKDNLETSYDTAAKSTAAPETNKIYPQLLLRIGGEIAGATASAEAAASAATAAAATATSPTIISCNGEIAASQAAATAAD
    TAATLQHNNTVKIQIESQGQQRTLGKQISVVKLNEGVEEMQQHMCYLVDTSGQYSPCETLDSGTGSDLENHPQQQQQPQQ
    VRSPQLELHLQTTRLMVNEEADHKHSPLETPSPVPKRAYSLTDDSEECDESSNSSLSCDSLHSGGLLPTTLLRDIRFRER
    ASGPLVTKINGRPLQFETDGYYTFHVREHENFRSFGSNSSTEYEAQHFTDEQPGEDFVGFRDIRTAGKLAGNSTIKSAKG
    TVRGVKNRVRNGVATFLQLQQPNVKNYMEKDVGKVVLYTTSMGIIRDTYAK
    CANVKKILRTLLIKFEERDIFMSVEYQQE
    MRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATAYTCQTCGGYRMLPCPACNGSKKSMHRNHFT
    AEFVALKCMNCDEVGLIKCPNC

    >gi|24639512|ref|NP_726866.1| CG12206, isoform C [Drosophila melanogaster]
    MAAITSNVSRLEPMRGISIIIESPEVATATPPPATTTATAEAEAATKQVAPTAKSNSNTEMSLKSQAAGMLLAFGDTAAT
    AKDNLETSYDTAAKSTAAPETNKIYPQLLLRIGGEIAGATASAEAAASAATAAAATATSPTIISCNGEIAASQAAATAAD
    TAATLQHNNTVKIQIESQGQQRTLGKQISVVKLNEGVEEMQQHMCYLVDTSGQYSPCETLDSGTGSDLENHPQQQQQPQQ
    VRSPQLELHLQTTRLMVNEEADHKHSPLETPSPVPKRAYSLTDDSEECDESSNSSLSCDSLHSGGLLPTTLLRDIRFRER
    ASGPLVTKINGRPLQFETDGYYTFHVREHENFRSFGSNSSTEYEAQHFTDEQPGEDFVGFRDIRTAGKLAGNSTIKSAKG
    TVRGVKNRVRNGVATFLQLQQPNVKNYMEKDVGKVVLYTTSMGIIRDTYAK
    CANVKKILRTLLIKFEERDIFMSVEYQQE
    MRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATAYTCQTCGGYRMLPCPACNGSKKSMHRNHFT
    AEFVALKCMNCDEVGLIKCPNC

    >gi|24639826|ref|NP_572212.1| thioredoxin T [Drosophila melanogaster]
    MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVF
    IKGGNVLELFVGCNSDKLAKLMEKHAGVYTDEAADVKAVHIDGECIVDLTAESSESDNDNNNVNEVSAHDENAVLEH

    >gi|17530795|ref|NP_511046.1| deadhead [Drosophila melanogaster]
    MASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVFL
    RQNRRLASFAGADEHKLTNMMAKLVKA

    >gi|24640549|ref|NP_511082.2| thioredoxin reductase-1, isoform A [Drosophila melanogaster]
    MAPVQGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHE
    AAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGG
    RPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEER
    GIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVAN
    IYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKP
    TEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRS
    GLDPTPASC
    CS

    >gi|24640551|ref|NP_727251.1| thioredoxin reductase-1, isoform B [Drosophila melanogaster]
    MNLCNSRFSVTFVRQCSTILTSPSAGIIQNRGSLTTKVPHWISSSLSCAHHTFQRTMNLTGQRGSRDSTGATGGNAPAGS
    GAGAPPPFQHPHCDRAAMYAQPVRKMSTKGGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGG
    T
    CVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDS
    HTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTV
    MVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLN
    LPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACV
    GLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTIN
    TLINTVGIHPTTAEEFTRLAITKRSGLDPTPASC
    CS

    >gi|24640553|ref|NP_727252.1| thioredoxin reductase-1, isoform C [Drosophila melanogaster]
    MLKYMICAIVVGAKKSTSSKYNGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCI
    PKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLK
    SGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLR
    GFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTV
    QKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAV
    KQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGI
    HPTTAEEFTRLAITKRSGLDPTPASC
    CS

    >gi|18858217|ref|NP_572538.1| suppressor of rudimentary, isoform B [Drosophila melanogaster]
    MSPPQLLSKDSPDIEDLLSLNPRVKTQCSVVPTKQTKENKKHWKRNADHAAPPCTTLANDFSDIKHTTLSERGALEEAAR
    CLKCADAPCQKSCPTQLDIKSFITSIANKNFYGAAKAIFSDNPLGLTCGMVCPTSDLCVGGCNLQASEAGPINIGGLQQF
    ATEVFKKMGVRQRRTPQAEANPLSQKIALVGGGPASLSCATFLARLGYRDVTIYERRSYLGGLSAAEIPQYRLPIDAVNF
    EIDLVRDLGVRIETGRSLGTKDLTIQGLLSTGHDAVFVGIGLPEPKLNPIFAGLQPSNGFYTSKNFLPLVSDGSKPGLCA
    CKAAAGLPKLHGNVIVLGAGDTAFDCATSALRCGARRVFVVFRKGSSGIRAVPEEVELARDERCELLPYLSPRKVIVKDG
    LITAMEFCRTEQNENDEWVEDEEQTQRLKANFVISAFGSGLEDQDVKAALAPLQFRGELPVVDRVTMQSSVKQVFLGGDL
    AGVANTTVESVNDGKVAAWSIHCQLQGLPLDTPAALPLFYTDIDAVDISVEMCGIRFENPFGLASAPPTTSTAMIRRAFE
    QGWGFVVTKTFGLDKDLVTNVSPRIVRGTTSGYKYGPQQGCFLNIELISEKRAEYWLKSIGELKRDFPEKIVIASIMCSF
    NEEDWTELAIKAEQSGADALELNLSCPHGMGERGMGLACGQDPELVEQISRWVRKAVKLPFFIKLTPNITDIVSIAAAAK
    RGGADGGSAINTVQGLMGLKADSTAWPAIGKEQRTTYGGVSGNATRPMALKAISDIANRVPGFPILGIGGIDSGEVALQF
    IHAGATVLQICSSVQNQDFTVIEDYCTALKALLYLKANPPPVDGPFWDGQSPPTPVHQKGKPVVRLTGEGKATLGFFGPY
    QRQRDIKMAELRSQKGALWDAEQVKATPPASNGAPNPAPRIKDVIGAALDKIGSYNKLDNKQQKVALIDDDMCINCGKCY
    MTCADSGYQAIEFDKDTHIPHVNDDCTGCTLCVSVCPIIDCITMVPKKIPHVIKRGVEEKIFYTHALSQCQ

    >gi|24640763|ref|NP_727320.1| suppressor of rudimentary, isoform C [Drosophila melanogaster]
    MSPPQLLSKDSPDIEDLLSLNPRVKTQCSVVPTKQTKENKKHWKRNADHAAPPCTTLANDFSDIKHTTLSERGALEEAAR
    CLKCADAPCQKSCPTQLDIKSFITSIANKNFYGAAKAIFSDNPLGLTCGMVCPTSDLCVGGCNLQASEAGPINIGGLQQF
    ATEVFKKMGVRQRRTPQAEANPLSQKIALVGGGPASLSCATFLARLGYRDVTIYERRSYLGGLSAAEIPQYRLPIDAVNF
    EIDLVRDLGVRIETGRSLGTKDLTIQGLLSTGHDAVFVGIGLPEPKLNPIFAGLQPSNGFYTSKNFLPLVSDGSKPGLCA
    CKAAAGLPKLHGNVIVLGAGDTAFDCATSALRCGARRVFVVFRKGSSGIRAVPEEVELARDERCELLPYLSPRKVIVKDG
    LITAMEFCRTEQNENDEWVEDEEQTQRLKANFVISAFGSGLEDQDVKAALAPLQFRGELPVVDRVTMQSSVKQVFLGGDL
    AGVANTTVESVNDGKVAAWSIHCQLQGLPLDTPAALPLFYTDIDAVDISVEMCGIRFENPFGLASAPPTTSTAMIRRAFE
    QGWGFVVTKTFGLDKDLVTNVSPRIVRGTTSGYKYGPQQGCFLNIELISEKRAEYWLKSIGELKRDFPEKIVIASIMCSF
    NEEDWTELAIKAEQSGADALELNLSCPHGMGERGMGLACGQDPELVEQISRWVRKAVKLPFFIKLTPNITDIVSIAAAAK
    RGGADGGSAINTVQGLMGLKADSTAWPAIGKEQRTTYGGVSGNATRPMALKAISDIANRVPGFPILGIGGIDSGEVALQF
    IHAGATVLQICSSVQNQDFTVIEDYCTALKALLYLKANPPPVDGPFWDGQSPPTPVHQKGKPVVRLTGEGKATLGFFGPY
    QRQRDIKMAELRSQKGALWDAEQVKATPPASNGAPNPAPRIKDVIGAALDKIGSYNKLDNKQQKVALIDDDMCINCGKCY
    MTCADSGYQAIEFDKDTHIPHVNDDCTGCTLCVSVCPIIDCITMVPKKIPHVIKRGVEEKIFYTHALSQCQ

    >gi|18859803|ref|NP_572742.1| CG1837 [Drosophila melanogaster]
    MLTRSILSVAVCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAIAGGNVFVKFFAPWCGHCKRIQPLWEQLAE
    IMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVKREQV
    ENLNIGKVVDLTEDTFAKHVSTGNHFVKFFAPW
    CSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDFEVKGYP
    TLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEG
    VAFIKFYAPW
    CGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSL
    PELQAYLKKFLGHDEL

    >gi|221329854|ref|NP_572756.3| ATP7 [Drosophila melanogaster]
    MPSDERVEATMSTVRLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFECSYP
    GDAADPPETPASAWTNIRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASV
    QEPRSPSQSPSPAPASSPKKRATPTPPPPSYAQNGSAVAIPVEQELLTKCFLHIRGMT
    CASCVAAIEKHCKKIYGLDSIL
    VALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAEVELEIMGMT
    CASCVNKIESHVLKIRGVTTASVTLL
    TKRGKFRYITEETGPRSICEAIEALGFEAKLMTGRDKMAHNYLEHKEEIRKWRNAFLVSLIFGGPCMVAMIYFMLEMSDK
    GHANMCCLVPGLSMENLVMFLLSTPVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAAVLLEQNSSP
    LTFFDTPPMLLIFISLGRWLEHIAKGKTSEALSKLLSLKAADALLVEISPDFDIISEKVISVDYVQRGDILKVIPGAKVP
    VDGKVLYGHSSCDESLITGESMPVAKRKGSVVIGGSINQNGVLLVEATHTGENTTLAQIVRLVEEAQTSKAPIQQLADRI
    AGYFVPFVVVVSSITLIAWIIIGFSNPNLVPVAMEHKMHMDQNTIIVSYAFKCALSVLAIACPCALGLATPTAVMVATGT
    GAINGVLVKGATALENAHKVKTVVFDKTGTITHGTPMTSKVTLFVTAQVCSLARALTIVGAAEQNSEHPIASAIVHFAKD
    MLNVGATPQAGSFGKSSHFQAVPGCGIRVTVSNYEQTLRQACNADRIINYENLHRTHPQGSVPVDNGASIEHLLPQRSVR
    KSMELNNQQLLSDLVLEPEEELLTDQKIIDSPEILVLIGNREWMERNAIEVPLEISDCMTHEERKGHTAVLCALNGQLVC
    MFAVSDMVKPEAHLAVYTLKRMGIDVVLLTGDNKNTAASIAREVGIRTVYAEVLPSHKVAKIQRIQANGIRVAMVGDGVN
    DSPALAQADVGITIAAGTDVAAEASDIVLMRNDLLDVVACLDLSRCTVRRIRYNFFFASMYNLLGIPLASGLFAPYGFTL
    LPWMASVAMAASSVSVVCSSLLLKMYRKPTAKTLRTAEYEAQLAAERASGSEDELDKLSLHRGLDDLPEKGRMPFKRSST
    SLISRIFMHDYGNITSPDAKYGEGLLDPEEQYDGRTKIVRSRFHANDSTELQKL

    >gi|24641739|ref|NP_727689.1| thioredoxin peroxidase 1, isoform B [Drosophila melanogaster]
    MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHL
    AWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQY
    TDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS

    >gi|17157991|ref|NP_477510.1| thioredoxin peroxidase 1, isoform A [Drosophila melanogaster]
    MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHL
    AWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQY
    TDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS

    >gi|28571177|ref|NP_572903.3| BthD selenoprotein [Drosophila melanogaster]
    MPPKRNKKAEAPIAERDAGEELDPNAPVLYVEHCRSCRVFRRRAEELHSALRERGLQQLQLQLNALGAPRRGAFELSLSA
    GGMGKQEQVALWSGLKRGPPRARKFPTVEEVYDRIVGILGDQQESKEQINTQKLSKIDLPGSEALASPKKSESTEEAQEN
    EAPTSTSTSRKSKKEQKSEEEPTQVDSKEAKQSKELVKTKRQPKAQKKQAKASESQEEVAEDKPPSSQKRKRTTRSSTDE
    ATAGAKRRR

    >gi|24642023|ref|NP_572974.1| CG14407 [Drosophila melanogaster]
    MNRICQSLRHPRYQILATTAPQSLLTRFLAADAATGAAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHG
    VQYDAHDVLQNESLRQGVKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKAGIISELLKAEEAKQQDDKAK

    >gi|24642263|ref|NP_573062.1| lethal (1) G0136 [Drosophila melanogaster]
    MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSYTLDYASQKDKLDEEVVQ
    DGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM

    >gi|24642441|ref|NP_727948.1| CG9911, isoform D [Drosophila melanogaster]
    MFGARIGIGKLGPCVALVAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIK
    EEFPEAGKVVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKDLENL
    DSKKRLILGYFDRRDQPEYDIFRKVATNLKEDCQFHVGFGDAAQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDEL
    KIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHPTDHNSIKDYKSIIERQLLDEKQNVNFLTADGKRFAHPLHHLGK
    SEDDLPLIAIDSFKHMYLFPHFSDMYSPGKLKQFLQDLYSGKLHREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELGPS
    KHRYTLLEKDEL

    >gi|24642439|ref|NP_727947.1| CG9911, isoform B [Drosophila melanogaster]
    MFGARIGIGKLGPCVALVAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIK
    EEFPEAGKVVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKDLENL
    DSKKRLILGYFDRRDQPEYDIFRKVATNLKEDCQFHVGFGDAAQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDEL
    KIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHPTDHNSIKDYKSIIERQLLDEKQNVNFLTADGKRFAHPLHHLGK
    SEDDLPLIAIDSFKHMYLFPHFSDMYSPGKLKQFLQDLYSGKLHREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELGPS
    KHRYTLLEKDEL

    >gi|18860011|ref|NP_573111.1| CG9911, isoform A [Drosophila melanogaster]
    MFGARIGIGKLGPCVALVAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIK
    EEFPEAGKVVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKDLENL
    DSKKRLILGYFDRRDQPEYDIFRKVATNLKEDCQFHVGFGDAAQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDEL
    KIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHPTDHNSIKDYKSIIERQLLDEKQNVNFLTADGKRFAHPLHHLGK
    SEDDLPLIAIDSFKHMYLFPHFSDMYSPGKLKQFLQDLYSGKLHREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELGPS
    KHRYTLLEKDEL

    >gi|24642443|ref|NP_727949.1| CG9911, isoform C [Drosophila melanogaster]
    MTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCDKETAIASRFHINKYPTLKIV
    RNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKDLENLDSKKRLILGYFDRRDQPEYDIFRKVATNLKEDCQFHV
    GFGDAAQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDELKIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHP
    TDHNSIKDYKSIIERQLLDEKQNVNFLTADGKRFAHPLHHLGKSEDDLPLIAIDSFKHMYLFPHFSDMYSPGKLKQFLQD
    LYSGKLHREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELGPSKHRYTLLEKDEL

    >gi|221499725|ref|NP_608353.2| augmenter of liver regeneration [Drosophila melanogaster]
    MIFTIAERSFKILELPTTPTLLLRRQSHNYGYDYISPTHIELSREATRLVIRRLQRTVLRLIRDPDFIMSAEANPEMDKE
    HHESPFAANRKAGASGAGKQDSNCRTCNDFKSWSKQQRLISNVQSAKVKHMAAAEKLTVNAAEDPLPRDDCPLDKVRLGI
    STWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYP
    CEFCAKDFRTDLDVNPINVNSQKELALWLCKFHNRVNDKLGKP
    LFDCTKVNERWRDGWLDGSCD

    >gi|24643518|ref|NP_652292.1| CG15456 [Drosophila melanogaster]
    MVKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTGRRGSFEVSIDGQLVHSKLSCLAFPQHASVLAQVQKAERGEP
    VEKVLEQPIKDCVVM

    >gi|17137554|ref|NP_477366.1| O-6-alkylguanine-DNA alkyltransferase [Drosophila melanogaster]
    MTMWIGQNTQIRLVPLKDPPKTIRYSFLATKFGQMMMGVINPISGDSKDQVAIGVLHFVIKDNVSTYNEVQERWPKSELW
    KDDDAVKLVADKLFESDKENSQAIPIAIYGTDFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAIL
    IP
    CHRVVSQNGASKYHWGAALKQLLLADEKSKNY

    >gi|24644807|ref|NP_649716.1| CG10029 [Drosophila melanogaster]
    MKVVGSLHILYSLAILVSLHSLVAGNSSVVAVTHENLQGIIDSNELVLLSFYTDWCRFSQILQPIFEEAAAKVIQKFPEN
    GRVILGKVNCDTEDILADQFDILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVEKELSDPIKEFHNIDDLKNVDVGYGI
    VIGYFISKDHAEYDNYRRVASLLRNDCRFLVGFGDLTKDLRPPGKNALIFRGDPSIPNHKNQYSEYLGNMTSFKELTFWI
    DKTCVPLVREVTFDNAEELSEEGLPFVLLFYNKDDLSPIQEFKNAIQSQMENETRVIFLTAEGEVFKHPLFHLGKSPSDL
    PVIAIDSFMHMYLFPRFQDIYDPGALKKFIDDLFSGALHYNYHVAQQAKEDLESIIDPTEDLPVVHESKFKDLKPSKHRY
    TLVNRTRDEL

    >gi|21355915|ref|NP_649919.1| CG9427 [Drosophila melanogaster]
    MTKLASTASLLLLVLSLGWAKLEEKPREKRQSNKLHITLLYESLCPDSRNFMHQLGPVYEEFGDYIDILLVPFGKSQSER
    NGAIFHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANEAGLLTDVVHCLSSETGTKLQLQAEL
    VTKQYSPSFIPTIVYNGVFDQQLQDHSLRDFRGTVCYMLRQQNLLPSSSTICQ

    >gi|21356365|ref|NP_650026.1| CG4511, isoform A [Drosophila melanogaster]
    MANILENQLFTAAKTIEQQLDQQLDRLDNLDSDDLKVLREQRLREMKDLNNKKQEWLRNGHGTYTELADEKEFFEMSKKS
    PNIVCHFYRDSTER
    CKIVDMHLKILAAKHVEAKFCKVNAEKTPFLTQRLRIKVIPTIALVKDSKTKDFIVGFTDLGNCDD
    FATEMLEWRIAHSGAIDYKGDLMQPPDVKRKPFINRPQKTIRGGYDSDDSDIDLDD

    >gi|281361548|ref|NP_001163585.1| CG4511, isoform B [Drosophila melanogaster]
    MANILENQLFTAAKTIEQQLDQQLDRLDNLDSDDLKVLREQRLREMKDLNNKKQEWLRNGHGTYTELADEKEFFEMSKKS
    PNIVCHFYRDSTER
    CKIVDMHLKILAAKHVEAKFCKVNAEKTPFLTQRLRIKVIPTIALVKDSKTKDFIVGFTDLGNCDD
    FATEMLEWRIAHSGAIDYKGDLMQPPDVKRKPFINRPQKTIRGGYDSDDSDIDLDD

    >gi|24645799|ref|NP_731522.1| SelR, isoform C [Drosophila melanogaster]
    MFALSARHALRRTRIFAIPRFFADSRQDSDNPDKRYSGPAATMDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTG
    CYNKHYEKGVYQCIVCHQDLFSSETKYDSGCGWPAFNDVLDKGKVTLHRDASIPERIRTEVRCARCNAHMGHVFEDGPKP
    TRKRY
    CINSASIEFVNADPATSSPPVATPTAAPIAQQ

    >gi|24645801|ref|NP_731523.1| SelR, isoform E [Drosophila melanogaster]
    MFALSARHALRRTRIFAIPRFFADSRQDSDNPDKRYSGPAATMDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTG
    CYNKHYEKGVYQCIVCHQDLFSSETKYDSGCGWPAFNDVLDKGKVTLHRDASIPGGNILLLIAHPERIRTEVRCARCNAH
    MGHVFEDGPKPTRKRY
    CINSASIEFVNADPATSSPPVATPTAAPIAQQ

    >gi|24645804|ref|NP_731524.1| SelR, isoform B [Drosophila melanogaster]
    MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSGCGWPAFNDVLDK
    GKVTLHRDASIPGGNILLLIAHPERIRTEVRCARCNAHMGHVFEDGPKPTRKRY
    CINSASIEFVNADPATSSPPVATPTA
    APIAQQ

    >gi|21356369|ref|NP_650030.1| SelR, isoform A [Drosophila melanogaster]
    MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSGCGWPAFNDVLDK
    GKVTLHRDASIPERIRTEVRCARCNAHMGHVFEDGPKPTRKRY
    CINSASIEFVNADPATSSPPVATPTAAPIAQQ

    >gi|45553335|ref|NP_996195.1| SelR, isoform I [Drosophila melanogaster]
    MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSGCGWPAFNDVLDK
    GKVTLHRDASIPERIRTEVRCARCNAHMGHVFEDGPKPTRKRY
    CINSASIEFVNADPATSSPPVATPTAAPIAQQ

    >gi|221378662|ref|NP_001138036.1| SelR, isoform G [Drosophila melanogaster]
    MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSGCGWPAFNDVLDK
    GKVTLHRDASIPVVISKTLGMVRTEVRCSRCSAHMGHVFDDGPPPKHRRF
    CINSASIDFVKSATPSKADPSTASSKK

    >gi|221378664|ref|NP_731525.2| SelR, isoform H [Drosophila melanogaster]
    MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSGCGWPAFNDVLDK
    GKVTLHRDASIPGMVRTEVRCSRCSAHMGHVFDDGPPPKHRRF
    CINSASIDFVKSATPSKADPSTASSKK

    >gi|24646383|ref|NP_650227.1| CG12279 [Drosophila melanogaster]
    MATYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPAVDAVLIFSCKAGGRA
    ARAANLASTLGFTNAKAYAGSWTEWQAKQS

    >gi|28573018|ref|NP_650287.3| CG9796 [Drosophila melanogaster]
    MSHKIAAVCLLMSCLIATAYSAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQGSEVTFT
    CHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFPDNVYPGQRCASENHINNWENIKTCANSTE
    GSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQVNLVGTICQYVSAPQPRICNQHNGASTPSLASVSAILSSL
    LGLWFIRSFY

    >gi|17738015|ref|NP_524387.1| peroxiredoxin 5037 [Drosophila melanogaster]
    MSFVARSLIRNVPLMGKAILSQQKQIAARLLHQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLD
    FTFV
    CPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISL
    RGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSKHG

    >gi|78709078|ref|NP_650679.3| peroxiredoxin 5, isoform A [Drosophila melanogaster]
    MRVLSCKFLGRVVNSALPQQIISLRSLSKTSAAMVKVGDSLPSVDLFEDSPANKINTGDLVNGKKVIIFGVPGAFTPGCS
    KTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLGGVRSKRYSL
    VVENGKVTELNVEPDGTGLSCSLANNIGKK

    >gi|78706776|ref|NP_001027191.1| peroxiredoxin 5, isoform B [Drosophila melanogaster]
    MRVLSCKFLGRVVNSALPQQIISLRSLSKTSAAMVKVGDSLPSVDLFEDSPANKINTGDLVNGKKVIIFGVPGAFTPGCS
    KTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLGGVRSKRYSL
    VVENGKVTELNVEPDGTGLSCSLANNIGKK

    >gi|21355839|ref|NP_650998.1| CG17843 [Drosophila melanogaster]
    MIRLLKTLLYCLLLISPADVLGRLNARKSANEASLYSDTDNVIMLDIESLRPALNLKNSKLVQFLNSFCGDCHRFAPVFK
    TLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLGAVIPGQDPEFISSTLAELVSQNDYG
    PGQPNFRPLKATDYEIFQDQDGETPIQFVALVLQPKNSKIGRDTLLELLPFKELSVRIIEDSQIFNEFGLGPDDQKLAIV
    DRNGTAQYLTPSSDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYRADLEQAIDKL
    LHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLSSKQSIKGADFGDLVDSLENGRRVFKARRYVGC
    IGSRPLLRSFTCSMWTLFHHLTVEAAKPPNYFEAGSILKTFHGFAKYFFG
    CTDCSEHFQQMAIRRNLTSVKTHDEEILWL
    WAAHNEVNARIAGDSTEDPKFPKIQFPSAENCPTCRSNDSEWRTDEVLKYLKQLYDINNVSFYGLPTPQGYD

    >gi|21355441|ref|NP_651165.1| CG13822 [Drosophila melanogaster]
    MNKIFGLLFTLCLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYPFGKAGFYNN
    TSTGESQVFCQHGVDECELNALHACIIETLDIRKAFNLIYCMLRSYSNELGPCSRSMGVDVSKARECKASRTTAEILAPY
    GKETLKLGISFVPTIVFENDFDPYDQRSIRNNFERHFCRQYLKKFNIKLPTCSAIL

    >gi|21355397|ref|NP_651166.1| CG10157 [Drosophila melanogaster]
    MRAAVFVCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNARTNDDG
    NVECQHGVMECELNAWHACILEHHDIAQSLKLIACMMRGKKNRLEKCADHYQIDVGDVKNCKKTRQVNDILRKYGKETAK
    VSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKEKFNKQLNNCQ

    >gi|45550806|ref|NP_651210.2| CG6000, isoform A [Drosophila melanogaster]
    MMALRVARSQIPFSTARNTQSNLLQRFYSQAPQIGIVDYDVVKKLPSEPQKLLIDVREPEELKETGQIPASINIPLGVVS
    QELAASEQLFKSKYGREKPKPETEIIFH
    CKIGKRSLKAAEAAAALGFKNVKNYQGSWLDWAEREGLPK

    >gi|24649697|ref|NP_651267.1| CG13623 [Drosophila melanogaster]
    MAFLLRQVARSGLQRNLILMRHATASTSANPELSVQVSESCLKRLREICVDGSFLRVTVEGGGCSGFQYKFDLDKQLNED
    DRQFGEAEAKVVIDTVSLEYCSGATVDYHSELIRAGFRMVANPLAEQGCSCGSSFSIKL

    >gi|116007528|ref|NP_001036460.1| CG12547 [Drosophila melanogaster]
    MDFNNDLSPIDILTFITDELLQAYKSSKGENEKAGTIVKFLDRWNDDISIAKLKDLTVEFESDLEWFNVSCPLSIKGLQG
    KVIILDFFTYC
    CINCMHVLQELHLLEERFPIESGVVVIGVHSPKFENERNAANILSAVQRYGISHPIVNDSRSGMWRALG
    IRCWPSLLILSPTGVPMMLLMGEGHGKFLQDFFSSALSYFSRQGIIDHRGLPLKLFNDFQPASNLRFPAKIVQGPNGLYA
    IADTGNNRVLVLTAGGVVQHRIGGHQPGFVDGDLTVARFNNPQGIAFLNENVLIVADTKNHAIRQISLTNAMVETLAGTG
    IQGNDRIGGRLGPLQPLSSPWDVAIFRTRDMDMSFHLDERNIPEKTIILISMAGTHQIWGYFPEGIIWWKFRKFEPCCCV
    SLIGNGLEENRNNSYPQNAAFAQPSGLAIAGDVLYIADSESSSIRKASMIDGKVMPVVGGDRNPLNLFAFGDIDGRLFSA
    KLQHPLGVTFNDTNNKLYVADTYNHKIKIIDIDSNDISTLQIKSQENTNLILNEPAGLCLDASGRNLLVADTNNHSIHTI
    DLVTLIAQPFGLDFRQIASASEIDAPQDTQKPTENNIVKALPLDLIKPSKIFFNLRLSPRFNFTKEAPQKWIVKTVCQSV
    IVNPTCGNLLDGMCHMQVQATRPDFMCESSQIFTIEFVLNLCLSNCCLVKKITVSIKRDDIQEEYISIHNVNIDIEQ

    >gi|28573937|ref|NP_477310.2| ubiquitin activating enzyme 1 [Drosophila melanogaster]
    MSSGQQLMADSPACSSSDHSPLAKKRRLELLGDGVGAMGMEEEEAGGATSSSSSNNYENHDKAGGVDISGKCQSKTTSEH
    QLELCVSSSTSDTCGVNAAAKRAEKQKLKQSQGSGDDVSTSSAVEKEGSKRPEKRNYLNTTTIESQEASSSASATSNSNN
    NVSSSNNNSNNSTNNRQLEGSSNMAGNSAAAGGDIDESLYSRQLYVLGHDAMRRMANSDILLSGLGGLGLEIAKNVILGG
    VKSITLHDTATCGLHDLSSQFYLTEADIGKNRAEASCAQLAELNNYVRTVSHTGPLTEEFLRKFRVVVLTNSDGEEQQRI
    AKFAHENGIALIIAETRGLFAKVFCDFGESFTIYDQDGTQPISTMIASITHDAQGVVTCLDETRHGFNDGDYVTFSEVQG
    MQELNGCQPLKITVLGPYTFSIGDTSKFGEYKSGGVATQVKMPKTISFKPLAQATEEPEFLISDFAKLDSPATLHVAFNA
    LSCYRKAHNGALPRPWNEEDANSFLEVVRASSNAEVDEKLVLQFAKICSGNTCPLDAAVGGIVAQEVLKACSGKFTPIYQ
    WLYFDALECLPTEGVEEADAQPVGSRYDSQIAIFGKKFQEKLADSKWFIVGAGAIGCELLKNFGMLGLGTGNGQIFVTDM
    DLIEKSNLNRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGKLDGVANALDNVDARIYMD
    RKCIFNRIPLVETGTLGTLGNVQVIVPFATESYSSSQDPPEKSIPI
    CTLKNFPNAIEHTLQWARDAFEGVFKQSAENAAQ
    YIADPQFTERIAKLPGIQPLEILDSIKKALIDDKPKSFAHCVEWARLYWEDQYVNQIKQLLFNFPPDQITSSGQPFWSGP
    KRCPDPLVFDVNDPMHLDFIYAAANLRAEVYGIEQVRNRETIAELVQKVKVPEFKPRSGVKIETNEAAAAASANNFDDGE
    LDQDRVDKIISELLKNADKSSKITPLEFEKDDDSNLHMDFIVACSNLRAANYKIPPADRHKSKLIAGKIIPAIATTTSVL
    SGLAVLEVIKLIVGHRDLVKFKNGFANLALPFMAFSEPLPAAKNTYYGKEWTLWDRFEVTGELSLQEFLNYFEENEKLKI
    TMLSQGVSMLYSFFMPKAKCSERLPLPMSEVVRRVSKRRLEPHERSLVFEICCNDVDGEDVEVPYVRYTLP

    >gi|17975518|ref|NP_523683.1| peroxiredoxin 2540 [Drosophila melanogaster]
    MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVN
    DIKSYCLDIPGDFPYPIIADPTRDLAVSLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTID
    SLQLTDRLKVVATPANWTPGTKVMILPTVTDEEAHKLFPKGFDKVSMPSGVNYVRTTDNY

    >gi|24652434|ref|NP_724931.1| peroxiredoxin 2540 [Drosophila melanogaster]
    MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVN
    DIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTID
    SLQLTDRLKVVATPANWTPGTKVMILPTVTDEEAHKLFPKGFDKVSMPSGVNYVRTTENY

    >gi|24652436|ref|NP_610584.2| CG12896 [Drosophila melanogaster]
    MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVN
    DIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTID
    SLQLTDRLKVVATPANWTPGTKVMILPSVTDDEAHKLFPKGFDKVSMPSGVNYVRTTENY

    >gi|45551086|ref|NP_725084.2| ERp60 [Drosophila melanogaster]
    MMWRLAGVLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKV
    DCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSD
    SDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVG
    HRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEYGYDFVGDKPVVLARD
    EKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPW
    CGHCKKL
    SPIYEELAEKLQDEDVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDR
    SGKPKKTEL

    >gi|20129893|ref|NP_610725.1| CG13186 [Drosophila melanogaster]
    MPPKKPAKKKKDVDWSSDEHFSKDRSMIYIEHTYECPIFQTKADECGTFFTQRIPERKFQLVKNRNGRQVPREGAFEIGF
    SQNARTSEHLLWSGLEKGPPRRDKFPLDYEALVPDVNRILKKFYPDKAVGVDADDGDEEKEDM

    >gi|24653314|ref|NP_610852.1| CG4670 [Drosophila melanogaster]
    MSATHLVILAVALLVDIASAGVPLPRYEALLKQQSPPSDPTLGLYDDGDKVIRLSVDNFNATVLDQNRGALVEFYNTYCG
    HCRRFAPTYKSVAEHLLPWSEVLIVAAIDCAAEENNGICRNYEVMGYPTLRYLGPGFQPGPQHYGQSLHTQDKNEIREIL
    AGMVAAENLTSSHNNSYWPNFHYLTENDSASSLFEGLSSATEYVAVVHEPENTTLGVEVALFMTQWPAVRVRRVIDPAVA
    AKFKIDPTNLPLSLVDRKGEITAYAPESTNGESYAKKLWDVLGKKNITPRPVKVHQPSATPASKIKGQNELIDEVHRNKH
    FVYQADLEQAIRTVLHNEVSKVGEISGEKLLALQRFLAVLQRYNPLGANGHQLVSKLKDYVVQFNDQRLTGSQFEEELKR
    LEAHLSPVYSSNHFVGCVGSSPRLRGFSCSLWTLFHFMTVQAANNEETQDPLEVLQAMHGYIKNFFG
    CTECSEHFQAMAS
    RRKIWSVPNKEEAVLWLWAAHNEVNQRLAGDATEDPEFPKKQFPAPESCNECYRTPVSKSENLEIEWNKDAVLGFLKNIH
    NPQFVSRYGVQREELLHPTADKMRQKRQISSVFTDMDMRMGMLLYAFCIVMMVLAFKLFAFKGYRKKPYGHDLLGKV

    >gi|20129973|ref|NP_610913.1| CG13343 [Drosophila melanogaster]
    MSVHSPNPGLILQSKRFNGLRNILEREGPFCKDGFAASSENLEFLQTKCQVLIIGAGGLGCELLKDLALMGFGNLHVIDM
    DTIELSNLNRQFLFRRTDIGASKAECAARFINARVPTCRVTPHFKKIQDFDESFYQQFHLVVCGLDSIVARRWINGMLLS
    MLRYEEDGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPL
    CTIANTPRLPEHCIEYVKIIQWEK
    QNPFGVPLDGDDPQHIGWIYERALERSNEFNITGVTYRLVQGVVKHIIPAVASTNAAIAAACALEVFKLATSCYDSMANY
    LNFNDLDGIYTYTYEAEKSENCLACSNTPQPLPIEDPNTTTLEDVIKLLCDSPRFQLKSPALTTVMKDGKRRTLYMSGVK
    SIEEATRKNLTQSLGELGLHDGQQLTVTDATSPSAMTLQLKYQSNEVEMV

    >gi|20129985|ref|NP_610953.1| CG8613 [Drosophila melanogaster]
    MFRVRPLLPRIRSSLQTTLKLQADTSQSESESFRRNLRLLHNSCRSRPVSNQKFRTMATGGEASKEVSKEEPAKQGNRLV
    ASKSPYLLQHAYNPVDWYPWGEEAFEKARSENKIIFLSVGYST
    CHWCHVMEHESFENPETAAIMNENFVNIKVDREERPD
    IDKIYMQFLLMSKGSGGWPMSVWLTPTLAPLVAGTYFPPKSRYGMPSFNTVLKSIARKWETDKESLLATGSSLLSALQKN
    QDASAVPEAAFGAGSAIEKLSEAINVHRQRFDQTHGGFGSEPKFPEVPRLNFLFHGYLVTKDPDVLDMVIETLTQIGKGG
    IHDHIFGGFARYATTQDWHNVHFEKMLYDQGQLMMAFANAYKVTRDEIYLRYADKIHKYLIKDLRHPLGGFYAGEDADSL
    PTHEDKVKVEGAFYAWTWDEIQAAFKDQAQRFDDITPERAFEIYAYHYGLKPPGNVPAYSDPHGHLTGKNILIVRGSEED
    TCANFKLEEDRFKKLLATTNDILHVIRDKRPRPHLDTKIICAWNGLVLSGLCKLGNCYSANREQYMQTAKELLDFLRKEM
    YDPEQKLLIRSCYGVAVGDETLEKNASQIDGFLDDYAFLIKGLLDYYKATLDVDVLHWAKALQDTQDKLFWDERNGAYFF
    SQQDAPNVIVRLKEDHDGAEPCGNSVSAHNLVLLAHYYDENAYLQKAGKLLNFFADVSPFGHALPEMLSALLMHENGLDL
    VAVVGPDSPDTQRFVEICRKFFIPSMIIVHVDPSNPEEASNQRLQTKFKMVGGKTTVYICHERACRMPVTDPQQLEDNLM
    AYFFSKRD

    >gi|85726443|ref|NP_611393.2| CG15116 [Drosophila melanogaster]
    MFDKEFLFPGLLVAVALVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYN
    GLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTRHQHDIEWNFV
    KFLVDRKGNIHKRYGAELEPVALTDDIELLLGR

    >gi|28573567|ref|NP_611446.3| CG8517 [Drosophila melanogaster]
    MSSYRRLFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGR
    VRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAVPHPPPEDTEN

    >gi|19922712|ref|NP_611609.1| Grx-1 [Drosophila melanogaster]
    MGTVVSTLQRPTLYVSMDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEM
    TGSRTVPRCFIDGKFVGGGTDVKRLYEQGILQKYFQ

    >gi|20130317|ref|NP_611838.1| CG5554 [Drosophila melanogaster]
    MHSTSYFVAATCAALLLLAATAQSTAAAQSGLQPGGKLIELDEDNWHLMLQGEWMIEFFAPWCPACKNLAPTWERFARVA
    KDVQVQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVKKQQWQSIEPLSAWKKPDTTHMSVLS
    YFFKLSHTLKDFNGRLQEEYGLPTWGSYALFAIATIFVGAALGLLLVCLVDFVYPPKKSQRQSFSESQDNLTEGLEDLAT
    EEIEDDGDAEENDDEQRDSDEEEQEDDDEEEEDSEEQVGDLATKEKEADSEPEKEEKPEPKQAGDAAPEKTEQVRKRKPR
    KGD

    >gi|24580884|ref|NP_608603.1| CG18132 [Drosophila melanogaster]
    MSTFRCIYFLFSLLIWSAQSDKSLSKQSGNVTTITNLSVKARSADQCTPGTILKLRVDNFFETTEDGTFFVKFYEPNCMG
    CHDFETTWTDMAKSFKSKENICFAELNCKFAKTICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNET
    NKSAAKRPYFHTKPIILFGWFLYAGDVISYFA

    >gi|24581278|ref|NP_523463.2| peroxiredoxin 6005 [Drosophila melanogaster]
    MSGKALNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPIALSCDTVESH
    KGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAVFVVDDKKKLRLSILYPATTGRNFDEILR
    VIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDVPKLFPDGIETIELPSGKSYLRITPQP

    >gi|19920720|ref|NP_608897.1| CG3887 [Drosophila melanogaster]
    MERLTGRNVALLVLCLCAGYALVFAEGEKEIPVTKFGQNIAPTMTFLYCYSCGYRKAFEDYVGLLGEKYPQIQVNGGNYD
    PPGLNYYLSKMIFALKIIIIVSVVSAVSPFTFLGLNTPSWWSHMQANKIYACMMIFFLGNMLEAQLISSGAFEITLNDVP
    VWSKLQTGRFPSPEVLFQIIDNHLQFTEKVQENPDFVK

    >gi|24582773|ref|NP_609204.2| CG7830 [Drosophila melanogaster]
    MRLLHKTLLSGLLVVALFAIYAAAQSKSKTGLSLSEKVQNLVDMNAKKPLLRFNGPKFREYVKSAPRNYSMIVMLTALAP
    SRQ
    CQICRHAHDEFAIVANSYRFSSTYSNKLFFAMVDFDDGSEVFQLLRLNTAPVFMHFPAKGKPKGADTMDIHRVGFAA
    DSIAKFVAERTDITIRIFRPPNYSGTVAMITLVALVGSFLYIRRNNLEFLYNKNLWGAIAVFFCFAMISGQMWNHIRGPP
    LVHKSQNGGVAYIHGSSQGQLVVETYIVMFLNAMIVLGMILLIESGTPKAHNKNRIMAMTGLVLLTVFFSFLLSVFRSKA
    QGYPYSFLFK

    >gi|24582879|ref|NP_609240.2| CG13090 [Drosophila melanogaster]
    MMESEVDSERTMLKREIAELRAALNQKEQCLRELDSLFSFATRPEQEVVGNDLESPDVAVHTKLTNDDIARYSRQLILPD
    FGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPH
    CEIQCHSRMLYPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSGSALKMDGQLTVYNYANGPCYRCIFPVPP
    PPEAVTN
    CGDGGVLGAVTGTIGAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNCHMCSAQPLITELIN
    YEMFCGMHATDKNNPMLLLSTDERLSVEDYQQKIQAQPHLLIDVRPTAEFEICQLPEAVNVPLVEILDDSYLKRLGKQLE
    DKELPIVLV
    CRRGNDSQIAVQHLRNRFPTHFVRDLIGGLHAWTNSVDPSFPIY

    >gi|24583090|ref|NP_723475.1| thioredoxin-2, isoform B [Drosophila melanogaster]
    MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVF
    LKNGVKVEEFAGANAKRLEDVIKANI

    >gi|17648013|ref|NP_523526.1| thioredoxin-2, isoform A [Drosophila melanogaster]
    MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVF
    LKNGVKVEEFAGANAKRLEDVIKANI

    >gi|19921242|ref|NP_609641.1| CG6523 [Drosophila melanogaster]
    MPVVNVSAAEEYQKYINADKTTVALFAAEWAEQCGQVKDALEELAKITGEKLQFISLNAEQFPEISMKHQIEAVPTVIFF
    AKGSAVDRVDGVDIAAISAKSKKLAENASSAAATGQTLEERLKALINTAPLMIFMKGDRNGPR
    CGFSKQLIGIVNETNLP
    YETFDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLKG

    >gi|24584105|ref|NP_609645.2| CG9302 [Drosophila melanogaster]
    MWITGQFVFLLLVALVAAKSKTSAVQDDIAEYKDFKKLLRTKNNVLALYVTSAKSAAAELKIFREAAEAIRGTGTMLLLD
    CGQQDRKKLCKKLKVSPDPYAIKHYKDGDFHKDYDRQLSVSSMITFMRDPSGDLPWEEDPAGKDVLHFSDAASFTKHLRK
    DIRPMLVMFYVPW
    CGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGEN
    NKEALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPW
    CGHCKRMKPEYEKAALEMKQK
    KIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLF
    LDDDNFSSTLKRKKHALVMFYAPW
    CGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLK
    TKLDYNGGRTSKDFIAYMNNPPTSADRTEL

    >gi|19921434|ref|NP_609792.1| CaBP1 [Drosophila melanogaster]
    MRQLASILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGS
    VNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIE
    LTEDNFDKLVLNSDDIWLVEFFAPW
    CGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSK
    RASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLG
    EKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKP
    AIVSVDPWDGKDGQLPTEEDIDLSDIDLDKDEL

    >gi|24585130|ref|NP_609942.1| CG10700 [Drosophila melanogaster]
    MEENEYIDPVVVCHKLEVQENEMRQVDASGIPSILLVKQSGILRAVGAMCPHRGAPLAKGVLSRNRVRCPWHGVCFNLET
    GDIENFPGLDSLPCHRVNVDSRGQVLVQVKRSYLLRHARIKSMACRNWQDQRHFVVVGGGPSGAVCVETLRQEGFTGRLT
    LV
    CGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYGIEMQLGVSAERLDTNCNTLHCTNGKTFPYDKIYIATGYSAVT
    PNIPGVHLKNVKVIRNIGDARSIFKMVDKSTQVVCLGSSFMAVEATANLVSRARSVTLVARQNVPFKSTLGELIGQRILK
    LLEENKVDLRMSSGIIRILGNSRGEVVAVKLLDNSRIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQTKVRN
    VYVGGDIANAYILGGFPDRVNISHYGLAQYHGRIAALNMSGHIAKLEAIPFFYTVIFGRAFRSAGYGPFKDVVIDGSLED
    LQFVAYFFDDYDKVTAVASCGRDPMVAQFAELVSQGKELCRCQIVDPKGRNYWLTKLKL

    >gi|45550523|ref|NP_647636.3| methyltransferase-like, isoform B [Drosophila melanogaster]
    MLTTSSSTMLGKYGWQILRRLASKSWEHTRQRKKPSGAGSRVLTDAREVFEFNAWDHVQWDEEQELAAKAAVAKNSTSKM
    EAEQKERFQTDAPKFWDSFYGIHDNRFFKDRHWLFTEFPELAPLAADSAVLQPRSIFELGCGVGNTILPLLQYSSEPQLK
    VFGCDFSARAIEILRSQRQFDEKRCEVFVMDATLDHWQVPFEENSQDIIVMIFVLSAIEPKKMQRVLDNCYRYLRPGGLL
    LFRDYGRYDLAQLRFKSGK
    CMEDNFYVRGDGTMVYFFTEEELRGMMTQAGLQEEQLIVDRRLQVNRCRGLKMYRVWIQTK
    FRKPL

    >gi|21358065|ref|NP_647716.1| CG8993 [Drosophila melanogaster]
    MQRQIINILGQTTRRLASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQ
    AGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVKQAK

    >gi|17864676|ref|NP_525002.1| thioredoxin peroxidase 2, isoform A [Drosophila melanogaster]
    MSKYLSVLLLSAALVGAAKPEDNESCYSFAGGSVYPDQPKGDHQLQYTKAVISKPAPQFEGTAVVNKEIVKLSLSQYLGK
    YVVLLFYPLDFTFV
    CPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYG
    VYLESSGHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAK
    NN

    >gi|24656348|ref|NP_728793.1| thioredoxin peroxidase 2, isoform B [Drosophila melanogaster]
    MSKYLSVLLLSAALVGAAKPEDNESCYSFAGGSVYPDQPKGDHQLQYTKAVISKPAPQFEGTAVVNKEIVKLSLSQYLGK
    YVVLLFYPLDFTFV
    CPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYG
    VYLESSGHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAK
    NN

    >gi|24656767|ref|NP_728868.1| PHGPx, isoform C [Drosophila melanogaster]
    MAGRSIVHFFLGSVAIALGSYIYFTMQIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNN
    YEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGS
    GIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL

    >gi|24656772|ref|NP_728869.1| PHGPx, isoform D [Drosophila melanogaster]
    MSLRQFQNISRQALRCYSMRRTPGPVLELSRGQRQCLRLCTIMLPVSCAATPMNAISSAAQHSTAAAIDMSANGDYKNAA
    SIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASK
    CGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVC
    HLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL

    >gi|24656777|ref|NP_728870.1| PHGPx, isoform A [Drosophila melanogaster]
    MSANGDYKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQ
    MPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMD
    IAKDIEKLL

    >gi|24657303|ref|NP_647865.2| endoplasmic reticulum oxidoreductin-1-like [Drosophila melanogaster]
    MTTRTVQRNLWASAAVVLVLLLLWTDTTGGYFAAIDETETSKNCFCELEGSINDCSCDVDTVDHFNNMKIYPRLQSLLVK
    NFFRFYKVNLRQECPFWPDDSR
    CAMRFCQVENCEEQAIPQGIKDKGEHKEKAAFKYTREAQVGGSACSDGEDFDSSLGFL
    DTSISDQAHREFELWAKHDEAEEDFCIVDDHEEGSQYVDLLLNPERYTGYKGESAHRIWKSIYLENCFGGNNETANKFSN
    YVPHLDLRNVCLEQRAFYRIISGLHSSINIHLCSKYLLSESKDFLDPQGIWGPNVKEFKRRFSPETTSGEGPHWLRNLYF
    IYLIELRALAKAAPYLRREDYYTGIAEEDDEVKLAINDMLSVIENFQSHFDENALFSNGIASIKFKHDYKEKFRNISRIM
    SCVGCDKCKLWGKLQTQGLGTALKILYSEKLNLATESGLWDKPHIEADPIFRLSRTEIVALFNAFGRLSNSIYEMENFRC
    VLR

    >gi|24658597|ref|NP_523938.2| Thioredoxin-like [Drosophila melanogaster]
    MSVRVINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYPKAIFLKVDVDKCQDTAAGQGVSAMPTFIF
    YRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGEDYGQGLMELNTFISKQECECLNEADDHNLKHALASAGGYLQSDC
    DEQLILSITFNQAVKIHSLKFKAPSHLGPKDVKLFINQPRTIDFDMAESMNSVQDLSLAQKELESGVPVNLRYVKFQNVQ
    NIQIFVKNNQSGGDVTQIDYIGFIGSPIMTTKMNDFKRVAGKKGESH

    >gi|24660640|ref|NP_524756.2| Smt3 activating enzyme 2 [Drosophila melanogaster]
    MAAAINGVFPPTLQELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVARE
    SALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQC
    YECTPKDKQRSFPG
    CTIRNTPSEPIHCIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDGGDGNGEPKGDGKEKGEES
    KEEKEAKEDTANGNIMRINTRQWAKDCNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAPVPVQWDTLLPEGSSGDQKDVA
    KQHHKVWSIEECAQVFANSLKELSANFLKLEGDDTLAWDKDDQPAMDFVAACANVRSHIFDIERKSRFEIKSMAGNIIPA
    IATTNAITAGISVMRAFKVLEAKWEQCKAVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKIDTKRMRIKELR
    DEVLVKTLNMLNPDVTVQSNGSILISSEEGETECNDGKLLSELNIVDGVILKCDDFFQNYELSIIISHFDAERDENLFEV
    VADASQLKPKDEDQKEAVKDKEDEPKSAKKRSTNGEGDSKDDGPSTSKRSRPNEVVEEDDDDCLVIEEDEDQADVVVVAT
    DKLSVQSPPKSGSKRKPCEVIEDEDITEILESSDDEPAGPTKCKRSRLDDSNPVAVISID

    >gi|21355779|ref|NP_648234.1| CG6776 [Drosophila melanogaster]
    MSSGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAEKG
    EPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTALDIFEEELTKRGTPYF
    GGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNANYDLL
    A

    >gi|21355775|ref|NP_648235.1| sepia [Drosophila melanogaster]
    MSNGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVREPG
    PPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEPFWSGLDIYERELARRGTEFFG
    GEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYNLLV
    KDA

    >gi|24660979|ref|NP_729388.1| CG6673, isoform A [Drosophila melanogaster]
    MALPQKHFKRGSTKPELPEDGVPRFFSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGKVPALQLTGVK
    DQPTLVESLIIAEYLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENALDVFEVELGK
    RGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGN
    PQYDIAFKGTP

    >gi|21355763|ref|NP_648236.1| CG6673, isoform B [Drosophila melanogaster]
    MALPQKHFKRGSPKPEIPEDGVLRYYSMRFCPYSQRAGLVLAAKKIPHHTVYIDLSEKPEWYIDYSPLGKVPAIQLPNLP
    GQPALVESLVIAEYLDEQYPGEGSLFPKDPLQKALDRILIERLSPAVSAIYPVLFTKNPPADAIKNFETALDVFEQEITK
    RGTPYFGGNKIGIADYMIWPWFERFPALKYTLDEPYELDKTRYQNLLKWRDLVAQDEAVKATALDARIHAKFMKTRHENK
    PDYDVAFQPL

    >gi|21355765|ref|NP_648237.1| CG6662 [Drosophila melanogaster]
    MSNTQHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQG
    NPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELKRRC
    TKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQAD
    YNMLYNEAKRVKLG

    >gi|78706628|ref|NP_001027117.1| heat shock gene 67Bb, isoform A [Drosophila melanogaster]
    MATYEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSPIIFTCRSGNRV
    LEAEKIAKSQGYSNVVIYKGSWNEWAQKEGL

    >gi|78706626|ref|NP_001027116.1| heat shock gene 67Bb, isoform B [Drosophila melanogaster]
    MATYEQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSPIIFTCRSGNRV
    LEAEKIAKSQGYSNVVIYKGSWNEWAQKEGL

    >gi|24664269|ref|NP_648717.1| CG13473 [Drosophila melanogaster]
    MAAMQKKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVN
    SMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVEDSKEHKSKEGGASSATVPKLER

    >gi|17647799|ref|NP_524079.1| protein disulfide isomerase, isoform A [Drosophila melanogaster]
    MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPI
    KLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGF
    FKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDF
    NHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKL
    EEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPW
    CGHC
    KQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADSEP
    VEETEEEEEAPKKDEL

    >gi|24664525|ref|NP_730033.1| protein disulfide isomerase, isoform D [Drosophila melanogaster]
    MNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSK
    SVLVEFYAPW
    CGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFV
    KFLDANGEVADSEPVEETEEEEEAPKKDEL

    >gi|21357347|ref|NP_648759.1| CG6888 [Drosophila melanogaster]
    MRMLNINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCEVLACSTDSHFV
    HCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAF
    QFSDEFGEVCPVNWRPGAKTMKADATGKEEYFKHAI

    >gi|24664627|ref|NP_524085.2| Ecdysone-induced protein 28/29kD, isoform A [Drosophila melanogaster]
    MSLTITSSVTHPELKDLSTVRNEQKELNISPVHDVNVTKATATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYR
    KMGDHTEVLEIDYDPTVISFKELLDLFWNNHEYGLTTPIKRQYASLILYHDEEQKQVAHASKLEEQERRAPEIITTEIAS
    KENFYPAEAYHQKYRLQGHKDLASSLNLSPKLLQTSYVATKLNGYLAGVGGIEQFKAEAETMGLTPTQRQYCYYHVEQNE
    GQGLYC

    >gi|24664631|ref|NP_730047.1| Ecdysone-induced protein 28/29kD, isoform B [Drosophila melanogaster]
    MSLTITSSVTHPELKDLSTVRNEQKELNISPVHDVNVTKATATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTGD
    HTEVLEIDYDPTVISFKELLDLFWNNHEYGLTTPIKRQYASLILYHDEEQKQVAHASKLEEQERRAPEIITTEIASKENF
    YPAEAYHQKYRLQGHKDLASSLNLSPKLLQTSYVATKLNGYLAGVGGIEQFKAEAETMGLTPTQRQYCYYHVEQNEGQGL
    YC

    >gi|24664635|ref|NP_730048.1| Ecdysone-induced protein 28/29kD, isoform C [Drosophila melanogaster]
    MSLTITSSVTHPELKDLSTVRNEQKELNISPVHDVNVTKATATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYR
    KM

    >gi|45553131|ref|NP_996093.1| Ecdysone-induced protein 28/29kD, isoform D [Drosophila melanogaster]
    MGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRKMGDHTEVLEIDYDPTVISFKELLDLFWNNHEYGLTTPIKRQYAS
    LILYHDEEQKQVAHASKLEEQERRAPEIITTEIASKENFYPAEAYHQKYRLQGHKDLASSLNLSPKLLQTSYVATKLNGY
    LAGVGGIEQFKAEAETMGLTPTQRQYCYYHVEQNEGQGLYC

    >gi|24664720|ref|NP_648786.1| CG7650 [Drosophila melanogaster]
    MATLEDKLLGEKLEYYCSSSEGEDNGDEGGDNKGASGKSRCSGLTIDTNPDATPAGGFRQQSSTNTGPKGVVKDWQRFKQ
    LEAERRDETERQRLALAKKLTITATTSAEDEERKRQEELDAELDELMSEDFLQQYQKQRMAEMLRQTGHHQQFGQVQQLT
    SHEEFLACVEQENKHTTIIIHIYERQLAA
    CATLNKCLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVYKAQAVI
    GNFVRLTDDLSDDFFASDVESFLIEHGIIVDRALYN

    >gi|28574565|ref|NP_648847.3| CG5027 [Drosophila melanogaster]
    MSPNSMWIFGLISALLLTLGSTGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALHATNVRVGRL
    DCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQLVTRTESVDMLKGSHTIFFIFVGQQEG
    VVWDTYYAAAEGYQEHGFFYATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLF
    PKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFGWIGEPSIAHSIILDQLPTPH
    LIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIAYGGDTYFVRLNRALFEVRRALRDMWLGNPVLTTVIFGLPL
    GFLSLIMYSIFCGDCLVTEEDPDEDHEKKE

    >gi|24665433|ref|NP_524116.2| suppressor of ref(2)P sterility [Drosophila melanogaster]
    MSCIRLASATVLAGVRPPPAASGGGALRLLTKRNPDAAFARRQFAVAVENGGGRKKPNGTFKLAVLGATVGAATGSVYTM
    YQRWTDGSSHKEHEETKPTRLDGIPAGVRITKRYVNPKDTSGLDIVLFQFQT
    CPFCCKVRAFLDYMGISYAVVEVDAVLR
    QDIRWSSVKKVPMVLIRQQDGKYVQMVDSSAIISLIATHLQDKRTDIGELAQFYPHTSFFDDDGKKKNDILNKYFLMYRE
    HTPKGVSKETDETDRKWRSWADSHLVHLISPNCYQTMGESLETFEWFSQAGEWDVHFPKWERDLMVYCGATAMWAIAKML
    KRRHALSDDVRSHMYDALDQWTTELKKRNTKFMGGKQPSLADLSVFGVLSSMEGCQTFKDCLQNTSIGKWFYDVKALVEK
    NRGQLQRERIENMAAIA

    >gi|24666045|ref|NP_649000.1| CG7484 [Drosophila melanogaster]
    MHKCAIFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQPAAQRTYAKAILEVC
    T
    CKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKWNTDTVEEFFETHLAKDGAGKNSYSV
    VEDADGDDDEDYLRTNRI

    >gi|21358499|ref|NP_649017.1| CG7430 [Drosophila melanogaster]
    MQFTLRHVVSAVAKTPLRTNAAILGALNARCYSSTHEADIVVIGSGPGGYVAAIKAAQMGMKTVSVEKEATLGGTCLNVG
    CIPSKALLNNSHYYHMAHSGDLEKRGISCGSVSLDLEKLMGQKSNAVKALTGGIAMLFKKNKVTQLTGFGTIVNPNEVEV
    KKSDGSTETVKTKNILIATGSEVTPFPGIEIDEEVIVSSTGALKLAKVPKHLVVIGAGVIGLELGSVWSRLGAEVTAIEF
    MDTIGGVGIDNEVSKTFQKVLTKQGLKFKLGTKVTAASRSGDNVTVSVENAKSGEKEEIQCDALLVSVGRRPYTEGLGLE
    AVGIVKDDRGRIPVNATFQTVVPNIYAIGDCIHGPMLAHKAEDEGLITIEGINGGHVHIDYNCVPSVVYTHPEVAWVGKS
    EEQLKQEGVAYKVGKFPFLANSRAKTNNDTDGFVKVLADQATDKILGTHIIGPGAGELINEAVLAMEYGAAAEDVARVCH
    AHPTCSEALREANVAAAFGKPINF

    >gi|24666486|ref|NP_649065.1| CG6852, isoform A [Drosophila melanogaster]
    MGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATIIELDGNPDGNEIQAVLGEITG
    ARTVPRVFIDGKFIGGGTDIKRMFETGALQKYFQ

    >gi|221512876|ref|NP_001137968.1| CG6852, isoform B [Drosophila melanogaster]
    MGAVGSALRSPIVDMSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEVRKLRDLEKSQTVINIFAFQPFKKLNVDATII
    ELDGNPDGNEIQAVLGEITGARTVPRVFIDGKFIGGGTDIKRMFETGALQKYFQ

    >gi|17737741|ref|NP_524216.1| thioredoxin reductase 2 [Drosophila melanogaster]
    MSTIKFLRSSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCV
    NVGCIPKKLMHQASLLGEAVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDKKVEYVNSMATFRDSHT
    IEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAVELGITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPTV
    MVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVERQADGRLLVRYRNTTTQMDGSDVFDTVLWAIGRKGLIEDLN
    LDAAGVKTHDDKIVVDAAEATSVPHIFAVGDIIYGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCV
    GMSEETAIELRGADNIEVFHGYYKPTEFFIPQKSVRHCYLKAVAEVSGDQKILGLHYIGPVAGEVIQGFAAALKTGLTVK
    TLLNTVGIHPTTAEEFTRLSITKRSGRDPTPASC
    CS

    >gi|20128977|ref|NP_570048.1| CG3939 [Drosophila melanogaster]
    MPEYVPARGFKEMENLIKLYENQRSPIYIYFYGEKDKDGRSWCPDCVAAEETIMSAFRNHAPADCMILVVDVGSRESWIG
    KDNMFRKPPYSVEGIPTLIRWKGVERLDGDQLLKSSLLELFFEETDPKKSNFVAQ

    >gi|24644513|ref|NP_731045.1| CG31559 [Drosophila melanogaster]
    MVLATPPVSKGGNAGGLFMDQYQQYAAHCETADSGNGSDLESTGLPTKPDDSEESGPSSLGSDSMHGSSTEYVRQSASQP
    SGQRQRQKSLRVLGALLPDSLLRDIRDRRSTEYVVQFSQPEDEEKIQVPDKIPEKPSPFRLARESLSEDKIEELRAAVER
    ANFVQTGEETLDSIDATSQSLPASSNIGGHRGNINYKYADDQYYSFHINEHENFGARSARSGDEADHSTGAGSEAGSDSG
    ILTEQQDLFAGYRDVRCGASSTQSTIRSAKGTVRGVKNRVRNGIATFLQLQQQPNAKNFKEKDLGKVVLYTTSMGIIRET
    YTK
    CANVKQILRTLLVKFEERDVFMSVEYQAEMRQRMQSGQVRVPQLYVEGQHIGDAETVERMNESGELRQLLKPYKSMA
    STYTCQTCGGYRLLPCPSCNGSKKSVHRNHFTAEFVALKCMNCDEVGLVKCHNC

    >gi|28574924|ref|NP_524032.2| viral IAP-associated factor [Drosophila melanogaster]
    MQDPNEDTEWNDVLRAKGIIGPKAKEAEITEDQIQKLMDDAIQRRTDLPLNEGQRDKKIDDMSLDELDELEDSEDEAVLE
    QYRQRRIAEMRATAEKARFGSVREISGQDYVNEVTKAGEGIWVVLHLYANGVPL
    CALIHHHMQQLAVRFPQTKFVRSVAT
    TCIPNFPEKNLPTIFIYHEGALRKQYIGPLELRGDKLTAEELEFMLGQAGAVPTEITEDPRPQIRDKMLADLEDKSSDFY


    >gi|24641463|ref|NP_572772.1| CG18130, isoform A [Drosophila melanogaster]
    MAKKGGQQQLQADIQTDEELERFMERPGLLVLDVYSEWCGPCQGMVGSLRKIKLDVGGDNLHLAICKSDTITALKRFNKR
    SEPIWLFVTGGRAVNLLFGSDVPKLVSLLVKELEKTMQKSSRPGTYRLDELQPIEVEQQRIKMEAIERAERAEREIKHKK
    QIDYLNHVTDSIMENMPDIGVTVFGPQVNRDMFKKLTEPAEALKMQCKDRRVIQVSTDQFEIVNFACKNPMPPDVIEQLD
    GKELLMCFWKIDESIGTVPNVLMAYAHELTKERVAPPNDDIPEEHVIPPLITTMKLKVEVELKEGETWVEEISSEEEARL
    HQAKSKAKTKSISHEEAHLAEEEAADLDAEEEASEEETVMPEPGGDAMGGLPSMPGFELEIEPVDEAGEDEEEVQEIKEE
    EPSKPLTRTKTVKMPPIWVPNSRRTHAALIYVFFRGQTSGFLPPDPKPEPPHVIMAFDASKRKEIMHVIDRHKDDVPLYG
    FFSSAEPDEAELIATSTDKYESSPHSSGDKIVLKVNKVQSNMMLSLVSYGPSYVSPNVTVGKDEALKFFPEDYKPQEEVV
    VEVEKKKKKSKRATEINQEMEAAAAAAAAAAAHPSEAPAPVEAEAHAAEAPAAVEGDAAPAAAEAPPAGDAAPVAPPPAE
    PAAEGAAPEAPAPAPAPAPAPEAPAAEEAPHEAPKEEAPAAEAPPEPEAEAPAPAPAEPAPEPAAE

    >gi|24649895|ref|NP_651326.1| CG11790, isoform A [Drosophila melanogaster]
    MLHIVSVVIIALSLGCAVGQDLRRVDDTELIQLLTGSSNVVVLFNKNNCQRCVEYENMVTKIRAQLEETLSAIVVQSVDS
    NLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNLEPAVKELSDDNFEHLTQASSGATTGDWFIFFSSAE
    CTV
    CQRLYAVWESVGGKLKRKLNIARMNSLESGISTATRLGVLEAPAFIFLRQGKMYKYSAKQYSPEAFVQFAEKGYTQSHPQ
    PVPAIPSAVNEFLGPLQSYFAAENITSLATLSIFALVALLFVGKKVAKIFSSEPAKTKNKSK

    >gi|24649897|ref|NP_733071.1| CG11790, isoform B [Drosophila melanogaster]
    MVTKIRAQLEETLSAIVVQSVDSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNLEPAVKELSDDNFEHL
    TQASSGATTGDWFIFFSSAE
    CTVCQRLYAVWESVGGKLKRKLNIARMNSLESGISTATRLGVLEAPAFIFLRQGKMYKYS
    AKQYSPEAFVQFAEKGYTQSHPQPVPAIPSAVNEFLGPLQSYFAAENITSLATLSIFALVALLFVGKKVAKIFSSEPAKT
    KNKSK

    >gi|20130157|ref|NP_611429.1| CG11007 [Drosophila melanogaster]
    MTWKKQMALLAKPYYWVNILLAISYLLAKKTQFICTRLFILAGEDEACDLDSREVEILFFLLIVVMIRSRKTGSVTMINY
    LASSFLYTKVANAILWAYADFRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFRNAQVFEEELARDKRTSWLICFYTVWNP
    S
    CVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQKYRISDSSFSRQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSS
    DNVRATFGLNQLYKEAIERLPIAPKEAKKVQ

    >gi|24648862|ref|NP_650997.1| CG6690 [Drosophila melanogaster]
    MVWHFWVPYLTCIILILIVQEGHSKQRCLDEEPPLYSKEDNIHVVVGASLKKILAEPAMGKLVQFLNSYCGNCRRFAHTF
    RKMAVDLQKWNRVLRIYAVDCARLENVKLCRDFRITLTPTIRYYPSKFQRIRHGIGTDIETTIPSEIADQLIESLSENDY
    SESKGVKPIFDPIEPGNKLNDIYEQFDNKVTYILLVHPVDMGIETILNMLPYPDVGVRIIKDAEMFAQFGLKPCKQMVAL
    LNRSGKAQLIKPAGKSSSAYVESVAGLLHQNGHTSMPTLPPAEPEYILSEGYDAFIVDYVLNSTKVLFQADLEQAIYQFL
    HVEIPKTAFISGFKFKALRHIIRLFRRFNVLNRDGRRMLNSLVNHLFEVTEITGEEFRDVVDDLQTRLDPIFAEQQYVGC
    LGSTPHTRRFSCSLWTLFHYFTVLAAQMKVYPPSSVTIGLYGLAKFFYD
    CKDGSMYFVKLAKRMNIAKVRTHDEEILWLW
    EAHNEVNEKLAGDASGDPRFPKVQFPERKHCPDCYTHSGEFDRDEVLKYLKRVYNLSYLSGDAEPHSRRSNECKSKKKYL
    QK