Ailuropoda melanoleuca

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|301753905|ref|XP_002912848.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like, partial [Ailuropoda melanoleuca]
    XXXXXXXXSPLETLPEGAAACKAEGLCLQAPPRKSQAPPVNVSLYYEALCPGCRSFLVRELFPTWLMVLEILNVTLVPYG
    NAQEQNVSGKWEFTCQHGEQECKLNKVEACLWDQLDASLAFLTIVCMEEMDDMEKNLKPCLEIYAPEMSPDTIMECATGD
    RGLQLLHINAQLTDALQPPHEYVPWVVVNGKPLKDLSQLLSLVCHLYQGEKPDVCQPMASSHKEVCFKRPLTSAAGAADV
    AARIPSQEFGENRRIWKATRRRSKIGHLRTGGGTTGGESPA

    >gi|301754197|ref|XP_002912987.1| PREDICTED: protein disulfide-isomerase-like [Ailuropoda melanoleuca]
    MSGWSCPGALEGPMGSGPKGPLLDDKMKWHFLPRQDAAEAPVLDSTCHRGNEGGCPKSERDLAVAARGHTVITSIKVRQL
    QPRRHRLNRRAASTAIPNPGSGASAFGQSENFEGGPWSPPXXXXXXXXXXXXPEEEDHVLVLHKGNFEEALAAHKYLLVE
    FYAPW
    CGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTAAPREYTAGREAEDIVN
    WLKKRTGPAATTLSDGAAAEALLESSEVTVIGFFKDVESDFAKQFLLAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFK
    KFDEGRNNFEGDVTKDKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAERFKGKIL
    FIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKIEEFCHRFLEGKIKPHLMSQELPEDWDKQ
    PVKVLVGKNFEEVAFDEKKNVFVEFYAPW
    CGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFP
    ASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDLEEEDGQRAARDEL

    >gi|301754311|ref|XP_002913009.1| PREDICTED: thioredoxin domain-containing protein 15-like [Ailuropoda melanoleuca]
    MAARDRAHARGSPPPRPPGGRERDARSRAPVLPCGPGGGPGRLQPRAMRLLGWWQVLLWVLGPPAWGLKVAEESGHLPSE
    ERPARALQAGAVSASEEEPLRGPGGQDKSAGEAGTVLGLDADGDHVVMLSVIPGETEDKLSPEPSGGTCGARGEEDSRCS
    LREHLFSLDSSGASFQDREEEYYSEPEVAESDPVPPEDSNNTESLKSPKVNCEERNVTGLENFTLKILNMSQDLMDFLNP
    NGSDCTLVLFYTPW
    CRFSASLAPHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLE
    TLKVFIFNQTGIEAKKNVVVTQADQIGPLPSTLIKSVDWLLVFSLFFLISFIMYATIRTESIRWLIPGQEQEHAE

    >gi|301754365|ref|XP_002913022.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like [Ailuropoda melanoleuca]
    MASREEVLALQAEVARREEELSSLKQRLAAAVLAEQEPERLVPVSPLPPRAALSRDEILRYSRQLVLPELGVHGQLRLAT
    ASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKVFSAAASLRRLNSAVECVPYAQALT
    PATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTN
    CADG
    GVLGVVTGVLGCLQALEVLKIAAGLGPSYSRSLLIFDALRGQFRCIQLRSRRPDCAACGERPTVTDLQDYEAFCGSSATD
    KCRSLQLLSPEERVSVTDYKRLLDSGSPHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAQSLELLGEAIREGRQGTQE
    GAAFPVYVICKLGNDSQKAVKTLQSLTAVQELESLTVQDVVGGLMAWAAKVDGTFPQY

    >gi|301754599|ref|XP_002913171.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin-like [Ailuropoda melanoleuca]
    MVKQIKSKYAFQAGDKLVAVDFCXTCCGPCKMIKPFXHSFSEKCSNVMFLEADVNDDCRDVASECEGKCMPTFQFFKKGQ
    KVGGFSGVNKEKLEEXINLIMFASA

    >gi|301754711|ref|XP_002913199.1| PREDICTED: methionine-R-sulfoxide reductase B2, mitochondrial-like [Ailuropoda melanoleuca]
    MARLLGVLWGLPFREIPLRAVGGRAGSGGAGAGLGDAGSLTKHEPSLTKSEWQKQLTPEQFYVTREKGTEPPFSGAYLNN
    KDSGMYHCVCCDSPLFSSEKKYCSGTGWPAFSEAHGTSGSDERDTGILRRVDTSLGLTRTEVVCKQCEAHLGHVFPDGPG
    PNGQRF
    CINSVALKFKPRKH

    >gi|301754727|ref|XP_002913212.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin-like [Ailuropoda melanoleuca]
    MVKQMESEYAFQEALSGVGDKLAVVDFSVTXCGPCKIRKPFFLLESPFFHYLSEKSSNVVFLQVDVDDSQDVASEYESKY
    RPTFQFFKKGQKVSEFSGANKEKFEATIYELI

    >gi|301754767|ref|XP_002913224.1| PREDICTED: protein disulfide-isomerase A3-like [Ailuropoda melanoleuca]
    MRPRCHALFPGVALLFAAAGVAFASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPL
    AKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFEKFISDKDASVVGFF
    KDLFSEAHSEFLKAASNLRDNYRFAHTNVESLVNKYDDDGEGITLFRPSHLMNKFEDKTVAYIEQKMTSGKIKKFIQENI
    FGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLSFAVASRKTFSHELSDFGLESTA
    GEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNDENKDVLIE
    FYAPW
    CGHCKNLEPKYKELGEKLRKDPNIIIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
    QREATNPPIIQEEKTKKKKKAQEDL

    >gi|301754982|ref|XP_002913330.1| PREDICTED: chloride intracellular channel protein 4-like [Ailuropoda melanoleuca]
    MALSMPLNGLKEEDKEPVIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITF
    NNEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLP
    DEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV
    EIAYSDVAKRLTK

    >gi|301755504|ref|XP_002913612.1| PREDICTED: NHL repeat-containing protein 2-like [Ailuropoda melanoleuca]
    MAAPGARGCSLAGLLPAQTSLEYALLDAVTQEEKDSLVYQYLQKVDGWEQDLSVPEFPEGLEWLNTEEPISVYKDLCGKV
    VILDFFTYC
    CINCIHLLPDLHALEHTYSDKDGLLIVGVHSAKFPNEKVLDNIKSAVLRYNITHPVVNDADASLWQELEVS
    CWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIEVKLYKDSLPLSPLLFPGKVTVDHVSNRLVI
    ADTGHHRILVVWKNGQIQYSIGGPNPGRKDGVFSESTFNSPQGVAIRNNIIYVADTENHLVRKIDLEAEMVSTVAGIGIQ
    GTDKEGGAQGEEQPISSPWDVVFGTSGSEIQRDDILWIAMAGTHQIWALLLDSGRLPKKNELKKGTCLRFAGSGNEENRN
    NAYPHKAGFAQPSGLSLAPDEPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNLFAFGDVDGVGINAKLQHPLGV
    TWDKKRNLLYVADSYNHKIKVVDPKTKNCSTLAGTGDASNVITSSFTESTFNEPGGLCIGEDGQLLYVADTNNHQIKVMD
    LETKTISVLPVFIPDSAVVDGPFLVEKPKTLPKLPKSAPNIRLSPVAASPGQTLQFKLRLDLPSGTKLTEGVSSCWFLTA
    EGNEWLLQGQIPSGEIESISSQPVISLQIPGDCLSLEAVISISVFLYYCSADSNACMMKGIVFSQPLQISSAHQACIAPV
    ELKYGF

    >gi|301755685|ref|XP_002913687.1| PREDICTED: dihydrolipoyl dehydrogenase, mitochondrial-like [Ailuropoda melanoleuca]
    MQSWSRVYCSLAKRGHFSRISHGLQGVSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTC
    LNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLEKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKN
    QVTATKADGSTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
    AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEGASGGKAEVITCDVLLVCIGRRPFTQ
    NLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVA
    WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
    ARVCHAHPTLSEAFREANLAASFGKSINF

    >gi|301755697|ref|XP_002913700.1| PREDICTED: thioredoxin domain-containing protein 3-like [Ailuropoda melanoleuca]
    MAGKKREIQLQAVVNSQSLWDEMLQNKGLTVIDVYQAWCGPCKAMQTLFRKLKNELNEDELLHFVVAEADNIVTLQPFRD
    KCEPVFLFSVNGKIIAQINGANAPLVNQKIINLVNEERKIAAGEMVRPQYHEIVFVDPDADDGGEAPSESVDQFYIIAII
    KPDAVISRKSQEIRQNIIKAGFVIEIEEKRALTERQVRDFYYRIADQPDFEDFVHFMTGGLSHILVLSQGTEEEPALEET
    EPNPEMEAKGIYEDHNAGVTTPMMKKRDSLQEYLERQHISQFCDIEENITDVNHFIDMFFPDFKSMKNLKLEKILALLRP
    ALFQEKKEDVLKIIEDEGFKILMQRQIVLSEEEAQTLCKEYENEDYFEKLIEKMTSGPSLALVLVRDHGLQHWRELIGPG
    SVEKAKEYLPESLCVRFAMEDLPINQLYGSDSLEAARREIQYFFPPQNTLALLKPHVTQEQREEILELIRKTGFEITQMK
    EILLNEEAAEKIYSKITGKDFYQDVLEVLSEGPSLVLVLTKWNAVSDWRRLMGPTDPDEAKLLSPDSIRAQFGRSILKNA
    VHGASNAYEAMESINRIFQEFVPENPEGN

    >gi|301756206|ref|XP_002913939.1| PREDICTED: arsenite methyltransferase-like [Ailuropoda melanoleuca]
    MAAPRDAEIRKDVQNYYGQVLKKSADLQTSACVTAARLVPKHIREALTNVHEEVALRYYGCGLVIPECLENCWILDLGSG
    SGRDCYVLSQLVGETGHVTGIDMTENQVEVAKKYIEYHMEKYGFQTPNVTFLHGYMENLEETGIKNESYDIVISNCVINL
    VPDKQAVLQEAYRVLKHGGELYFSDVYASLELPEEIRTHRILWGE
    CLGGALYWKDLAILAQKIGFCTPRLVTANLITVQN
    KELERVIGDCRFVSATFRLFKLPKTGPAERCQVTYNGGIIGHEKELIFDANFTFKEGEIVEVDEETAAILKNSRFAQNFL
    IRPIGEKLPAHSGYSALGSKGIITDPFKLAGESDNAKPRCSSDVAGGCCP

    >gi|301756242|ref|XP_002913951.1| PREDICTED: glutathione S-transferase omega-1-like [Ailuropoda melanoleuca]
    MSGGSARSLAKGSAPPGPVPEGLIRVYSMRFCPFAQRTLLVLKAKGIRHEIININLKNKPEWFFKKNPFGLVPVLENSQG
    QLIYESAITCEYLDEAYPGKKLLPDDPYEKAYQKMVFELFSKIPSLVASFLRRQNEEDCSGLKEELQKEFSKLEEVLTNK
    KTTFFGGNSVSMIDYLIWPWFERLEVLELNDCADHTPKLKLWMAAMREDSAVSALLTEPKVLRGFLSLYLENSPEACDYG
    L

    >gi|301756244|ref|XP_002913972.1| PREDICTED: glutathione S-transferase omega-2-like [Ailuropoda melanoleuca]
    MEQGGADEGLQAKSSALRVFVQPKSEKWRSALQRGCPRSLGRGERSTLLRRSEIMEDATRALGKGSQPPGPVPEGLIRIY
    SMRF
    CPYAHRTRLVLRAKGIRHEVININLRNKPEWYYTKHPFGQIPVLENSKCQLIYESVIACEYLDDAYPGRKLYPYDP
    YERARQKMLLELFYKVPHLTKECLVALRCGRECGDLKLALRQEFCNLEEILGYQNTIFFGGDRISMIDYLFWPWFERLDV
    YGIADCLNHMPALRLWTAAMKQDPTVCALLIDKNIFLGFLNLYFQNNPDAFDYGLPC

    >gi|301757149|ref|XP_002914425.1| PREDICTED: LOW QUALITY PROTEIN: glutaredoxin-1-like [Ailuropoda melanoleuca]
    MATVEAINGINSANVGSKGGTCLSAWAQEFVNCKIQPGKVVVFIKLTCLYCRRIQELLSHCPXKQGLQEFVDITATSDTI
    KIQDYLQQLTGARIVPWVFINKDCIDGCTNLVEMPQSGELLKXLKQIGALQ

    >gi|301757432|ref|XP_002914607.1| PREDICTED: thioredoxin, mitochondrial-like [Ailuropoda melanoleuca]
    MKPDLTPTSASYGTKLNNYCLLEQLSASSMWYFPRAPTSFLLLFFRTLLYGPPAFSGPSPKATPSSGSDGRSALDWRGGP
    RCASLRSRCREMAQRLLLRRFLASLISRKPPQGWWGPLTCRAPQCSPGDLTVTPNQARSIYTTRVCTTTFNIQDGPDFQD
    RVVNSETPVVVDFHAQW
    CGPCKILGPRLEKAVAKQHGKVVMAKVDIDDHTDLALEYEVSAVPTVLAIKNGDVVDKFVGIK
    DEDQLEAFLKKLIG

    >gi|301757452|ref|XP_002914573.1| PREDICTED: thiosulfate sulfurtransferase-like [Ailuropoda melanoleuca]
    MRRAETMVHQVLYRALVSTKWLAESVRAGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRNAASPYEMM
    LPSEAHFADYVGRLGISNQTHVVVYDGDNLGCFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFK
    ATLDRSLLKTYEQVLENLESKRFQLVDSRSQGRYLGTEPEPDAVGLDPGHIRGSVNMPFMDFLTEDGFEKSPEELRAMFE
    AKKVNLTQPLIAT
    CRKGVTACHIALAAYLCGKPDVAVYDGSWSEWFRRAPPETRVSQWKREKA

    >gi|301757454|ref|XP_002914574.1| PREDICTED: 3-mercaptopyruvate sulfurtransferase-like [Ailuropoda melanoleuca]
    MAPQQLFRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPSAA
    HFAEYAGRLGVGAATHVVVYDASDQGLYSAPRVWWMFRAFGHRAVSLLDGGLRHWLHLGLPMSSGKSRPEPAEFCAALDP
    AFIKTYEDIKENLESRRFQVVDSRAAGRFRGTEPEPRDGIEPGHIPGTVNIPFSDFLTKEGLEKSPEEIHRLFQDKKVDL
    SQPLVAT
    CGSGVTACHVALGAYLCGKPDVAIYDGSWVEWYMRAQPEEVISEGRGKTH

    >gi|301757799|ref|XP_002914742.1| PREDICTED: iron-sulfur cluster assembly 2 homolog, mitochondrial-like [Ailuropoda melanoleuca]
    MAAVCGLSLTAAALRAVAPWARCRLLASSRGPQARRVASSSSLEAGDGQIHLTASCVQRLLEITEGSEFLRLEVEGGGCS
    GFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL

    >gi|301758240|ref|XP_002914970.1| PREDICTED: endoplasmic reticulum resident protein 44-like [Ailuropoda melanoleuca]
    MNPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDDILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEEYP
    NENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQELHDLAEITTLDRSK
    RNIIGYFEQKDSENYRVFERVANILHDDCAFLSAFGAVSKPERYSGDNIIYKPPGHSAPDMVYLGSMTNFDGTYNWIQDK
    CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPV
    IAIDSFRHMYVFGDFRDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDVAPGQQVQDVASSPPESSFQKLAPSEYRYTLL
    RDRDEL

    >gi|301758436|ref|XP_002915054.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial-like, partial [Ailuropoda melanoleuca]
    SLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQDGVR
    VFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

    >gi|301758446|ref|XP_002915084.1| PREDICTED: thioredoxin domain-containing protein 5-like [Ailuropoda melanoleuca]
    MLLAGSQGPSSTPSRSTRAREPDRASSNPSASQRWVLGQAIGTLFKTQLITVLTGKAPHQPVGLAPQESVGDRQESCHRH
    TQRMRSWERASGEEEQKQQHVQGLK
    CGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKLFK
    PGQEAVKYQGPRDFQALENWMLQTLSEEPATPEPEAEPPRAPEHKQGLYELSASNFELHVAQGDHFIKFFAPW
    CGHCKAL
    APTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGQKIDQYKGKRDLESLREYVESQLQSAEPEAPD
    TVQPPEAPAPATEPTAQKGTVLALTEKNFEDTVAEGITFIKFYAPW
    CGHCKNLAPTWEELSKKEFPGLAEVKIAEVDCTA
    ERTICSKYSVRGYPTLLLFRGGQKVSEHSGSRDLDSLHHFVLRQARDEL

    >gi|301758763|ref|XP_002915265.1| PREDICTED: prostaglandin E synthase 2-like [Ailuropoda melanoleuca]
    MAQAARTLWPVGHTLAWRLGGRLPSGLSAQSRAGFAGAAGGWAPRPPXXXXXXXXXXXXALYHTARWHLRAQDLRAQRSA
    AQLSLSSRLQLTLYQYKT
    CPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILLAQEGESLQQLNDSSVIISA
    LKTYLVSGQPLEDIITYYPPMKAVNDQGKEVTEFCNKYWLMLDEKEAQRMYGGKEARTEEMKWRQWADDWLVHLISPNVY
    RTPTEALASFDYIVREGKFGAVEGAVAKYLGAAAMYFISKRLKSRHHLQDDVREDLYEAANKWVAAVGKDQPFLGGQKPN
    LADLAVYGVLRVMEGLEAFDDLMHHSRIQPWYLRMEKAIAEAPQ

    >gi|301759205|ref|XP_002915447.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like isoform 1 [Ailuropoda melanoleuca]
    MAAAVGRFLRASIARHVSAIPWGVSASAALRPAASRRTCLTNVLWSGSGQAKLAFSTSSSYHAPAVTQHAPYFKGTAVVN
    GEFKDLSLDDFKGKYLVLFFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCEVVAVSVDSHFTHLAWINTPRKNGGLGHMNIA
    LLSDLTKQISRDYGVLLEGPGVALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPDSPT
    IKPHPAASKEYFEKVNQ

    >gi|301759207|ref|XP_002915448.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like isoform 2 [Ailuropoda melanoleuca]
    MAAAVGRFLRASIARHVSAIPWGVSASAALRPAASRRTCLTNVLWSGSGQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVL
    FFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCEVVAVSVDSHFTHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLE
    GPGVALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPDSPTIKPHPAASKEYFEKVNQ

    >gi|301759339|ref|XP_002915522.1| PREDICTED: thioredoxin reductase 1, cytoplasmic-like [Ailuropoda melanoleuca]
    MEEREAAEELCSGQCTRETYSPSSLLDAKDHLPSQALPENPATGVSGPSRPSSPRVSDPRAQLRAYIDSHPVVIISKSTC
    KHCAEVKKLFKSMCVPYFLLELDQAEDARGLERALSELTSETEVPVVFVKRRKIGGHGPTLKAYQEGRLQKLLKMNGSED
    LPEAYDYDLIIVGGGSGGLAAAKEAAKYDKKIMVLDFVTPTPHGTRWGLGGT
    CVNVGCIPKKLMHQAALLGQALRDSRNY
    GWDTEETVKHDWNKMTEAVQNHIGSLNWGYRVALREKKVTYENAYGEFVGPHRIKATNNKGKEKIYSAERFLIATGERPR
    YLGIPGDREY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGVK
    FIKQFVPIKVEQIEAGTPGRLRVVAKSTSSDETIEGEYNTVLLAIGRDACTRKIGLETVGVKINEKNGKIPVTDEEQTNV
    PYIYAIGDILEGKLELTPVAIQAGRLLAQRLYAGSNVKCDYENVPTTVFTPLEYGACGLSEEKAVETFGEENIEVYHSFF
    WPLEWTIPSRDNNKCYAKIICNIKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTK
    RSGGSIVQAGC

    >gi|301759909|ref|XP_002915769.1| PREDICTED: thioredoxin domain-containing protein 12-like isoform 1 [Ailuropoda melanoleuca]
    MEPRSHLGATYLLGFSFLLLVTSSDGHIGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAEST
    EISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYISAEQVIQGMKEAQERLTG
    DAFREKHLEDEL

    >gi|301759911|ref|XP_002915770.1| PREDICTED: thioredoxin domain-containing protein 12-like isoform 2 [Ailuropoda melanoleuca]
    MLNRATGMPGSQGRFTRSFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLE
    DEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYISAEQVIQGMKEAQERLTGDAFREKHLEDEL

    >gi|301760329|ref|XP_002915976.1| PREDICTED: protein disulfide-isomerase TMX3-like [Ailuropoda melanoleuca]
    MKAPPPQLVAKPCFGFRFRLLSRQKNFYPPGVFLLDMAFCKGFVEDLDESFKDNRKDDIWLVDFYAPWCGHCKKLEPIWN
    EVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFE
    HVQKRHRVFFVYIGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWIN
    RERFQNYLTVDGFLLYELGDTGKLVAIAVIDEKNTSIEHTRLKSVIQEVARDYRDQFHRDFQFGHMDGNDYINTLLMDEL
    KVPTVVVLNTSNQQYFLLDRQIKNAEDMVQFINNILDGTVEAQGGDSILQRLKRIVFDAKSTVVSIFKSSPLMGCFLFGL
    PLGVISIMCYGIYTADTDGGYIEERYEVSKSEIESQEPTEESKEQDPRSGDTLVPTVQGPKDVLEKKKD

    >gi|301762314|ref|XP_002916571.1| PREDICTED: thioredoxin-like [Ailuropoda melanoleuca]
    MVKQIESKYAFQEALNGAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVAAECEVKCMPTFQFF
    KKGQKVGEFSGANKEKLEATINELI

    >gi|301762644|ref|XP_002916710.1| PREDICTED: peroxiredoxin-5, mitochondrial-like [Ailuropoda melanoleuca]
    MKLFPHRVLSRLPGSLFVRATVVESAVSAASRAGGCRQRGQEWTLGGAHGFRSAASAMAPIKVGDAIPSVVVFEGEPGNK
    VNLAELFKGKKGVLFGVPGAFTPG
    CSKTHLPGFVEQADALKAKGVQVIACLSVNDVFVTEEWGRAHNSGGKVRLLADPTG
    AFGKETDLLLDDSLVSLFGNHRLKRFSMVVEDGIVKSLNVEPDGTGLTCSLAPNILLQL

    >gi|301763150|ref|XP_002916994.1| PREDICTED: peroxiredoxin-6-like [Ailuropoda melanoleuca]
    MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKKNVKMIALSVDSVEDHL
    AWSKDINAYNGQEPTETLPFPIIDDKNRDLAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEI
    LRVITSLQLTAEKRVATPVDWKDGDSVMVLPTIPEDEAKKLFPKGVFTKELPSGKKYLRYTPQP

    >gi|301764062|ref|XP_002917449.1| PREDICTED: anterior gradient protein 2 homolog [Ailuropoda melanoleuca]
    MEKISVSAFLLLVALSYTLAKDITAKSGAKKDTKDSGPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDE
    CPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPSDALLL
    LDNMKKALKLLKTEL

    >gi|301764615|ref|XP_002917723.1| PREDICTED: copper-transporting ATPase 2-like [Ailuropoda melanoleuca]
    MKQSFAFDNVGYEGGLDGACPPQTTSTVSVSGMTCQSCVQSIEGRISSLKGVVSIKVSLEQGSATVTYVPSILSLPQICH
    HIEDMGFEASVAEGKAASWPSRSSSGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLGTQEAVITYQPYLIQP
    QDLRDHVNDMGFEAVIKNRVAPVSLGPIDIGRLQRTNPKTPLASDNQNLNNSETSGHQGSHVVTLQLRIDGMH
    CKSCVLN
    IEENIGQLPGVQSIQVSLENRMAQVQYDPSRVTAGALQRAIEALPPGNFKVSLPDGAEGSGTGSWSSNRVTPAPDPRTQA
    PGVYETVVLAIAGMTCASCVQSIEGLISQREGVQQMSVSLAEGTGVVLYDPAIINPEELRAAVEEMGFETSVISGNCYSN
    HVGNHSAGNSSACPAAGVPASVQEVAPHAGGLPKSHDPGSSSKPPQASTLGAPQKCFLQITGMT
    CASCVSNIERNLQKEA
    GILSVLVALMAGKAEVKYNPEVIQPLEVARLIQDLGFEATVMEDYTGTDGDLELIIMGMT
    CASCVHNIESKLTRTNGITY
    ASVALATSKAHVKFDPEIIGPRDIVRIIEEIGFHASPAQRNADAHHLDHKVEIKQWKKSFLCSLVFGIPVMGLMIYMLVP
    SNEPHESMVLDHNIIPGLSILNLIFFILCTFVQLLGGWYFYVQAYRSLRHRAANMDVLIVLATSIAYSYSLVILVVAVAE
    KAERSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIIKVV
    PGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLINATHVGNDTTLAQIVKLVEEAQMSKAPIQ
    QLADRFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTA
    VMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITYGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGVA
    VTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHSEHPQSKQAAPPNTVGGIPEEIDATPQTFSVLIGNREWM
    RRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMFAIADAVKQEAALAVHTLKSMGVDVVLITGDNRKTARAIATQV
    GINKVFAEVLPSHKVAKVQELQNEGKKVAMVGDGVNDSPALARADVGIAIGTGTDVAIEAADVVLIRNDLLDVAASIHLS
    KRTVWRIRLNLVLALIYNLIGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERYEAQAQGRMKP
    LTASQVSVHIGMDDRRRDSPRATPWDQVSFISQVSLSSLKSDKLSRHSATAEDNGDKWSLLLNDRDEEQCI

    >gi|301764845|ref|XP_002917824.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-like modifier-activating enzyme 1-like [Ailuropoda melanoleuca]
    MSSSPLSKKRRVSGPDPKPGSNCSPAHSVLSQVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGL
    RGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVSAYTGPLVEDFLSGFQ
    VVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDSPGVVTCLDEARH
    GFENGDFVSFSEVQGMVELNGSQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLLASLAEPDFVMTDF
    AKYSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDATELVTLARAVNAQALRAVQQDNLDEDLIRKLAYVAAGDLAPVNAF
    IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEALTEDKCHPRQNRYDGQVAVFGSDLQEKLGRQKYFLVGAGAIG
    CELLKNFAMIGLGCAEGGEIVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIY
    DDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVSWACHHWHTQYSN
    NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLRGSQDRAAVATLLRSVQVPEFT
    PKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPEKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPPADR
    HKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVHGHRQLDSYKNGFLNLALPFFAFSEPLAAPRHQYYNXLWDRFEVQGL
    QPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDE
    SGEDVEVPYVRYTIR

    >gi|301766994|ref|XP_002918911.1| PREDICTED: peptide methionine sulfoxide reductase-like [Ailuropoda melanoleuca]
    MLSATRRASLLFHSLFPGSRMGDSASKIVSPQEAVPGRKEPIPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKF
    WTMKGVYSTQVGYAGGYTSNPTYKEVCSGKTGHAEVVRVVYQPESISFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIY
    PTSTEHMEVALRSKEDYQKVLSQHGYGPITTDIREGQTFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPLGVKK

    >gi|301767626|ref|XP_002919236.1| PREDICTED: phosducin-like protein 3-like [Ailuropoda melanoleuca]
    MQDPNADTEWNDILRKKGILPSKESLKDLEKEAEEEEQRVLQQSVVKTYEDMTLEELEDNEDEFNEEDERAIEMYRQQRL
    AEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPL
    CALINQHFSGLARKFPDVKFIKAISTTCIPNYP
    DRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTDLEENPKKPIEDALLSSVRCSIPTRRGSDSEDD


    >gi|301768000|ref|XP_002919414.1| PREDICTED: phosducin-like protein 2-like [Ailuropoda melanoleuca]
    MQDPNEDTEWNEILRDFGILPPKQEPKDEIEEMVLRLQKEAMVKPYEKMTLAQLKEAEDEFDEEDMRAIEIYREKRLQEW
    KALRKKQKFGELREISGNQYVNEVTNAEKDVSVIIHLYRSSIPM
    CLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNC
    LPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENPKKGIVDVMVSSIRNTSIYDDANSSNSDNDD
    TK

    >gi|301768162|ref|XP_002919496.1| PREDICTED: peroxiredoxin-1-like [Ailuropoda melanoleuca]
    MSSGNAKIGHPAPNFKATAVMPDGQFKDLSLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|301769167|ref|XP_002920002.1| PREDICTED: thioredoxin domain-containing protein 9-like [Ailuropoda melanoleuca]
    MEANASVDMFSKVLENQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLEALRKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKKVVCHFYRDSTFR
    CKILDRHLVLLSKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDYVVG
    FTDLGNTDDFTTETLEWRLGCSDILNYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

    >gi|301769361|ref|XP_002920099.1| PREDICTED: hypothetical protein LOC100464416 [Ailuropoda melanoleuca]
    MSPRRTLPRPLSLCLCLWLATVVARGDAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPG
    IYKCVVCGTPLFKSESKFDSGSGWPSFHDVISSDAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSA
    SLSFSPAGGPGAEGGPAPGGRAELTIEGQFCAIGYFSSSLSQRPRAAVDXIARVGPLKYITKTLVSNNVSCRALDLFLQD
    MERNELRQYGKVDGSDGFPQVSCLSSCSCPSLPMRLVVERRPVLTNQHHLHSGLPFWAEPGPLTHASLGLQDLCGQAQLS
    KSKN

    >gi|301769579|ref|XP_002920204.1| PREDICTED: protein disulfide-isomerase A2-like [Ailuropoda melanoleuca]
    MDGQLLPVLLLLLLGASGPRGQGPGLGGPEEEPPEEDGILVLSQHTLGLALRRHRALLVQFYAPWCGHCKALAPEYSKAA
    ALLAAESTKARLAKVDGPAEMELTKEFAVTEYPTLKFFRDGNRTHPEEYTGPREADGIAEWLRRRVGPSATRLEDEEGAQ
    ALIDGRDVTVIGFFQDLQDEDVATFLALAQDALDMTFGLTDQPKLFQKFGLTKDTVVLFKKFDEGRADFPVDEELGLDQG
    DLSRFLLTHSTHLVMEFNSQTSPKIFAARILNHLLLFVNQTLAPHRELLAGFGEAAPPFRGQVLFVVVDVGAANNHVLQY
    FGLKAEEAPTLRFINIETTKKYAPADGGPVTAASVTSFCHAVLSGEVKPYLLSQEVPADWDQRPVKTLVGKNFEQVAFDE
    TKNVFIKFYAPW
    CTHCKEMAAAWEALAEKYKDHEDIIIAELDATANELEAFPVHGFPTLKYFPAGPGRKVIEYESTRDLE
    TFSKFLDNGGKLPAEEPIAPLPETPANASTEPREEL

    >gi|301769769|ref|XP_002920303.1| PREDICTED: thioredoxin-like protein 1-like [Ailuropoda melanoleuca]
    MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFL
    FFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDMTFLESD
    CDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
    VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|301770231|ref|XP_002920534.1| PREDICTED: hypothetical protein LOC100482682 [Ailuropoda melanoleuca]
    MAEQEGTTNPARRQDYRSCMDFTRVPIFRNRRTCHVPSTALGTEDTAPYGGTEIAHLGWEGRTQASSSTPGDPNPRQATA
    LPQQLSHCLHRNRNRRLEVTPSRRSAERRNPPTAFPNPPGGGPGAXXXXXXXXXXXXXXXGSAEQLDALVKKDKVVVFLK
    GTPEQPQ
    CGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELK
    KLGIRSALLDEKKDQDSK

    >gi|301770347|ref|XP_002920610.1| PREDICTED: ubiquitin-like modifier-activating enzyme 7-like [Ailuropoda melanoleuca]
    MDVLETTKWLDEELYSRQLYVLDLPAMQRIQGAKVLLSGLQGLGAEVAKNLVLMGVGSLTLHDPQPACWSDLAAQFFLSE
    KDLARSRAEASQELVAKLNRAVQVCVHTGDITKELLLDFQVVVLTASKLEEQLKVGAVCRELGICFLVADTRGLVGQLFC
    DFGEDFTVWDPTEAEPVTAAIQHISQGSPGILSLRKEADGRHFRDGDLVTFSGIEGMVELNGCDPRAIRVQGDGTLEIGD
    TATFSRYLRGGAVTEVKRPVAVSHKPLDVALLQPRVVAPSPQAVLRAYCLHQAFRALHQFQHLHGRPPQRWDPDDAEMVV
    DLARSLKPLKGAEGEPLEEQLDEALVRTVALSSAGVLSPMAAMLGAVTAQEALKAISGKFMPLDQWLYFDALDCLPEDGK
    LLPTPEDCAQKCCRYDGQIAVFGIGFQRKLSQQHYLLVGAGAIGCELLKGFALVGLGAAASGGVTVADMDHIERSNLSRQ
    FLFRTQDIGRPKAEVAAEATHRLNSDLKVTPFTYPLDPTTEHIYDDDFFSHVDGVAAALDSFQARHYVAARCTHYLKPLL
    EAGTQGTSGHASVFVPHVTEAYRAPASGLAPEDAAYPV
    CTLRHFPSTVEHTLQWARDEFDGLFRLSAETINRHQEVLTSL
    AEADGPQVLTLLQEVLGVLRERPRTWQDCVAWALGHWQRRFHYDITQLLSRFPPDKVLEDGTLFWSGPKQCPQPLEFDAS
    QDVHLLYVLTAANLYAQMHGLPGSRDQTALRELLKLLLLPRPQPLAPVFPNDLELAGASAEFGPEQLKKLHQVLEVWSGS
    PPLEPLKFEKDNDSNFHVDFVAAAASLRAQNYGIPPANRNQSKRIVGQIIPAIATTTAAVAGLVGLELYKVVGGPRPLGA
    FRHSYLHLAENRFNRWVPRAPANQKLDHLTWTWTCWDRLKVPAGQPEMTLELLLAHLQEQFGLRVKMLLRGKARLYSARW
    SPEKQAQHLALRVTKLVQQVTGRKPKPGQRVLVLELSCEGEEDDTTFPPLHYELCDKTAALSPGSTEPCNPSPQ

    >gi|301770463|ref|XP_002920642.1| PREDICTED: thioredoxin reductase 2, mitochondrial-like [Ailuropoda melanoleuca]
    MEQQERRGRQDYDLLVIGGGSGGLACAKEAAQLGKKVAVVDYVEPSPRGTRWGLGGTCVNVGCIPKKLMHQAALLGGMIR
    DAPHYGWAVQPVLHDWRTMAEAVQNYVKSLNWGHRVQLQDRKVKYFNIKASFVNEHTVCGVAKDGKETLLSAEHIVIATG
    GRPKYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGLGLDTTVMIRSIPLRGFDQQMSSLVTEYMA
    SQGTRFLRGCTPSRVRGLPDGQLQVTWEDLTSGKEDMGTFNTVLWAIGRIPETRSLNLEKAGVNTNPNSQKILVDAQETT
    SVPHIYAIGDIAEGRPELTPTAIMAGKLLAQRLCGQSSDVMDYDNVPTTVFTPLEYGCVGLSEEEAVARHGEEHVEVYHA
    YYKPLEFTVAERDASQCYIKMVCLRKPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMRTVGIHPTCAEEVAKLRI
    SKRSGLDPTVTGC

    >gi|301770853|ref|XP_002920849.1| PREDICTED: sulfhydryl oxidase 1-like [Ailuropoda melanoleuca]
    MRIRSSGPPLSADACRRWLSEPECGCLLSSENRLLKPDFQLPQFPSPSSFTFSPPVEGRSKDLLLLSVPGDLAPXSALYS
    SSDPLTLLQADTVRGAVLGSSSAWAVEFFASW
    CGHCIAFAPTWKALANDVKDWRPALNLAALDCADETNSAICRDFNIPG
    FPTVRFFKAFSKNGSGATLPVAGADVETLRKRLIDALESHGDTWPPACPPLEPARMEEIDGFFARNDEDYLALIFEKEGS
    YLGREVTLDLSQHRGIAVRRVLNTEGDVVSKFGVTDFPSCYLLFRNGSASQVHVLVESRSFYTAYLQRFSRAPRESVPTK
    VVPTTAHTVAPTVWKVADRSKIYMADLDSALHYVLRVEVGKFSVLEGQRLVALKKFMAVLAQHFPGQPLVQNFLHSINDW
    LKRQQRKKIPYSFFKAALDNRKEGTVVAKKVNWVGCQGSEPHFRGFPCSLWILFHFLTVQAARHNLDHSQETAKAQEVLQ
    AIRGYVRFFFG
    CRDCASHFEQMAAASMHRVESLNSAVLWLWSSHNKVNARLAGAASEDPHFPKVQWPPRELCSPCHDELR
    GTPVWDLSNTLRFLKTHFSPSNVVPDMPSARLGPRMVAQRMAAGNFTLGPEKEGIMVGPGTKSPGPTVPDVPAERLRASH
    PQDMLTGLGTAPAEPDQGPPEHIAELQRDKVEAPKGQQHLTKRDTGAVLLAEFLAEKNLPRGPSELRRVGRSSKQLASIP
    EGEPEAGPVRGQDQWLQVLEGNFSHLDISLCVGLYSLSFMGLLAVYTYFRARMRALKGHAGHPAA

    >gi|301770907|ref|XP_002920872.1| PREDICTED: glutathione reductase, mitochondrial-like [Ailuropoda melanoleuca]
    MACVAARLVKSCEIRAWVLAAASWRQGTQRSSFRCWTVEAVKKTSQENQQIRNPGSLRIKPGETSPSKIMKGKPPFLEKL
    EPLATPKAPAREKAGETKEAVHPSSPHQPSETYYIWLMPLGSVEQNCPWKNCSWRGASGVGERDWVNVGCVPKKVMWNTA
    VHSEFMHDHVDYGFQS
    CESKFSWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIHGHAAFTCDPEPTIEVNGKKYTAPHIL
    IATGGVPSRPQESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRNFDSIISSN
    CTEELENSGIEVLKYSQVKEVKQTSSGLELCMITSVPGRKPTLTTIPDVDCLLWAIGRDPNSSGLNLNKVGIQTDDKGHI
    LVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFECKEDSKLDYDNIPTVVFSHPPIGTVGLTEDEAIYKYGK
    ENVKTYSTTFTPMYHAVTKRKTKCVMKMVCATAEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEE
    LVTLR

    >gi|301771219|ref|XP_002921049.1| PREDICTED: peroxiredoxin-2-like [Ailuropoda melanoleuca]
    MASGKAHIGEPAPPFQATAVVDGAFKEVKLCDYKGKYLVLFFYPLDFTFVCPTEIIAFSERAEDFRKLGCEVLGVSVDSQ
    FTHLAWINTPRKEGGLGPLNIPLLADVTRNLSEDYGVLKKDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEVLRLVQ
    AFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

    >gi|301772290|ref|XP_002921563.1| PREDICTED: protein disulfide-isomerase A6-like [Ailuropoda melanoleuca]
    MSCTFFLAANGLYSSSDDVIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVKVGAVDADKHQS
    LGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRGGGYSSGKQGRSESSSKKDVVELTDD
    SFDKNVLDSDDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVREQTKGKVKLAAVDATVNQLLASRYGIRGFPTIKIFQKGES
    PVDYDGGRTRSDIISRALDLFSENAPPPELLEIISEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYK
    KKMWGWLWTEAGAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPAISV
    REPWDGKDGELPVEDDIDLSDVELDDLEKDEL

    >gi|301772698|ref|XP_002921773.1| PREDICTED: thioredoxin domain-containing protein 2-like [Ailuropoda melanoleuca]
    MDKELEAESDGAGALEEPKMSPEKQEEASQGDANESPLLQGLSTHVTPLVPEFLDPPHIQEKALAREVNNIQHMSAKESK
    GPQPKDILPPEWGGSISNASARTVQPKQADIPSFFAKPIMPKPAETPSLSATIIPPKQSDTPNSSAKMILPKQAETPDSP
    EKIIPLKQTDIFNSLAKPISPKQADTSSFVAKIIPPKQGDTPNSPIKTTPYKQADILNFPAKTIPPTQAGTPNFLLKTIP
    LKQADTPNFSAKTIPPKQTDTLNFSAKIIPPKQADTPQSLEKIIPPKQDDILNSSGKTTLPKEDVTSTSSGQNILPKQGG
    TSSPAKPILPKQGNGPKSLAKSILPKGANTPKLPAKTFQSKQVSSPKVLAKTTLSKDSHTSKSSEENILPRERDIKSSIE
    TTESKEGDIPKSSEEAIQPVEGNVLKPSETMELPEVDLVKVILTKEDFELALKEAGERLVAVDFSATW
    CGPCRAIKPLFR
    SLSLKYEDVVFLEVDADECEELVRDLEVICIPTFQFYKKEEKVGEF
    CGAIKEKLEASIAELK

    >gi|301773338|ref|XP_002922085.1| PREDICTED: methyltransferase-like protein 2A-like [Ailuropoda melanoleuca]
    MAGPYPECAPAAVGEKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAERKVRENSIQRVCQEKQVDYEINAHKYWNE
    FYKIHENGFFKDRHWLFTEFPELAPSPNQSDLNDWLSENKRGEVPEGRSKEDGPGLKIEEQHMYSSDSFGCKLQMPPVEE
    DVTQKFSHLEICADEFPGSSASYRILEVGCGVGNTVFPILQTNNDPGLFVYCCDFSSTAVELVQTNSAYDPCRCFAFVHD
    LCDEDTSYPVPRGSLDIIILIFVLSAVVPDKMQKAINRLSRLLKPGGMMLLRDYGRYDMAQLRFKKGQ
    CLSENFYVRGDG
    TRVYFFTQEELDTLFTTAGLEKVQNLADRRLQVNRGKQLTMYRVWIQCKYRKPLLSGAG

    >gi|301774096|ref|XP_002922464.1| PREDICTED: uncharacterized protein C10orf58-like [Ailuropoda melanoleuca]
    MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKSQKATLEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAV
    RRPG
    CFLCREEAADLSSLKPKLDELGVPLYAVVKEQIRTEVQDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFVRLGVWY
    NFFRARNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNPVSVLEAARKIQPQTSAAETK

    >gi|301774404|ref|XP_002922622.1| PREDICTED: protein disulfide-isomerase A5-like [Ailuropoda melanoleuca]
    MVCIEQGLRNTSLPSYKEHEGAGVHPRDLELFKAEGVVLLVQLSSTKVSSLIEKISDPKDLKKLLRTRNNVLVLYSKSEA
    AAESHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDP
    KGPPLWEEDPGAKDVVHIDSEKDFRRLLKKEEKPLLMMFYAPW
    CGMCKRIMPHFQKAATQLRGHFVLAGMNVYPSEFENI
    KEEYNVRGYPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQPPQPQAPETPWADEGGSVYHLTDEDFDQFVKEHSSVLV
    MFHAPW
    CGHCKKMKPEFENAAEVLHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKNGEKYAVPALRTKKNFIEW
    MRNPEAPPPPEPTWEEQQTSVLHLAGDNFRETLKKKKHTLVMFYAPW
    CPHCKKVIPHFTTTADVFKDDRKIACAAVDCVK
    EKNQDLCQQEAVKAYPTFHYYHYGKFAEKYDSDRTELGFTNFIRTLREGDHERLGKKKEEL

    >gi|301774819|ref|XP_002922829.1| PREDICTED: glutaredoxin-3-like [Ailuropoda melanoleuca]
    MACEARFPRPILEGATKAMDMGSLLVVHFWAPWAPQCAQMNDVMAELAKEQPQVSFVKLEAEAVPEVSEKYEISSVPTFL
    FFKNSQKIDRLDGAHAPELTKKVQRHASSGSFPPSGNEHPKEDLSLRLKKLTHAAPCMLFMKGSPQEPR
    CGFSKQMVEIL
    NKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASDELDTICPKAPKLEERLKVLTNKASVM
    LFMKGNKQEAK
    CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKELRDNGELLP
    VLKGEN

    >gi|301774825|ref|XP_002922832.1| PREDICTED: LOW QUALITY PROTEIN: methylated-DNA--protein-cysteine methyltransferase-like [Ailuropoda melanoleuca]
    MDQACEMRYKTMDSPLGKIEISGCEQGLHEIRLCGSKTPDAGPVEAPTLPELLSRPEEMTEPLVQCAAWLDAYFHEPEVL
    PGLPLPAIHHPVFQRDSFTAQVLWKLLEAVKFGDTVSYQQLAVLAGNPKAARAVGGAMRSNPVPVLVP
    CHRVVCSSGAVG
    NYSGGXAHEARLSGKPTYPGVSHPAGTWRGAQAGTPGPQRAGRN

    >gi|301775448|ref|XP_002923145.1| PREDICTED: thioredoxin reductase 3-like [Ailuropoda melanoleuca]
    MGVYKAAEWANQEERIPAGYKSSGVRGLIPPAPLGPECRPFSPRTRTGRPRECSAAGTRDPGPGVMVTHNEDPAQWLGPV
    GTAGEAATLPPPRPSIVKELFSSLGIECNILELDQVDDGANVQEVLSEITNQRTVPNIFVNKVHMGGCDRTFQAHQSGLL
    QKLLQEDSAYDYDLIVIGGGSGGLACAQEAAILGKKVMVLDFVVPSPQGTSWGLGGT
    CVNVGCVPKKLMHQAALLGQALS
    DARKFGWEYHQQVKHNWETMTEAIQNHIGSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNRKGQETYYTAAKFVLAT
    GERPRYLGIRGDKEY
    CITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQEMAEKVGSYME
    QHGVKFLRKFIPVLVQQLEKGSPGKLKVVAKSTEGPETIEEIYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDM
    EQTNVPYVYAVGDILEGKLELTPVAIQAGKLLARRLFAGRLEKCDYVNVPTTVFTPLEYGCCGLSEEKAIEVYKKENLEV
    YHTLFWPLEWTVAGRDNNTCYAKIICNKFDNYRVIGFHVLGPNAGEITQGFAAAMKCGLTKQQLDDTIGIHPTCGEVFTT
    LEITKSSGLDITQKGC

    >gi|301775871|ref|XP_002923357.1| PREDICTED: LOW QUALITY PROTEIN: peroxiredoxin-2-like [Ailuropoda melanoleuca]
    MVLVTGLQQRLCCALTPFRNEAKRPILRPHERNCATARKTRPRQAGDVPIKTGRGKACSPVCWSECPRLAHAALAWPRAA
    RTGKAHPRLAATSVVDVNFEEVKLSDHRAKYFVLFSYPLDLAFV
    CPMDIAFREYAGDSHKLGXVAAGVSVYSQFAHLAWI
    NTPEKEGGWDPLNTPLLTGVTRSLSRDYGVLKEDEGTAYRGLFIIHGKGALHELTLNDLPVGXSMHTALQLARDFQYTDA
    HGEIRPTGCKPGSDTIKPTVHDCKEYFSKHN

    >gi|301775924|ref|XP_002923383.1| PREDICTED: thioredoxin domain-containing protein 6-like [Ailuropoda melanoleuca]
    MGSKKKDIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPMVSLFQKMRIEVGLDLLHFALAEADCLDVLEKYRGK
    CEPTFLFYAGGELVAVVRGANAPLLQKTIREQLEAEKKVLAEGCERQVIRDEALSEEDGCLSHDKDNGEEEDVASSGKTC
    TLAIIKPDAVVHGKTDEIIMKIHEAGFDILANEERTMTEAEMRLFYQHKAGEEAFEKLVYHMCSGPSHLLILTRPEGTED
    VIASWRMLMGPCDPDVARREQPDSLRAQFGTEMPFNAVHGSQDRDAASRELALLFPTFKFSDEVLEASLGHGAEGAVGPT
    EACRFAEDMD

    >gi|301776026|ref|XP_002923433.1| PREDICTED: glutaredoxin-2, mitochondrial-like [Ailuropoda melanoleuca]
    MGNSTSSSLGKSATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVKYKVVELDMLEYGSQFQDALYKMTGERT
    VPRIFINGAFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEF

    >gi|301776817|ref|XP_002923813.1| PREDICTED: protein disulfide-isomerase A4-like [Ailuropoda melanoleuca]
    MRLRKACLLLLLLALAQLLAAASAGGPDEDSSNKEDAIEEEEEEDDDDDDEDDLEVKEENGVLVLNDVNFDNFVADKDTV
    LLEFYAPW
    CGHCKQFAPEYEKIASALKENDPPIPVAKIDATSESALASRFDVSGYPTIKVLKKGQAVDYEGSRTQEEIVA
    KVREISQPNWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPW
    CGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETD
    LAKRFDVSGYPTLKIFRKGKPFDYNGPREKYGIVDYMIEQSGPPSKEVVALKQVQEFLKDGDDVIIIGVFKAESDPAYQQ
    YQDAANNLREDYKFHHTFNTEIAKFLKVSPGKLVVMQPEKFQSKYEPRSHVMDIESSTEGAAIKDHVLKYTLPLVGHRKT
    SNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFPEYTFAVADEEDFATEVKDLGLSESGEDVNAAILDEG
    GRKFAMEPDDFDSDALREFVRAFKKGKLKPVVKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPW
    CGHCKQLE
    PEYTALGKKYKNHKNLVIAKMDATANDITNDRYKVEGFPTIYFAPSGDKKNPIKFEDGNRDLEHLSKFVEEHATKLSRTR
    EDL

    >gi|301778006|ref|XP_002924432.1| PREDICTED: uncharacterized protein C1orf93-like [Ailuropoda melanoleuca]
    MSAVDLARVGACVLKHAVTGEAVELRSLWREQACVVAGLRRFGCSVCRWIAQDLSSLKGLLDQHGVRLVGVGPEALGLQE
    FLDGGYFAGELYLDESKQCYRELGFRRYNGLSIVPAALGKPVRDVALKAKAVGIQGNLSGDLLQSGGLLVVTKGGDRVLL
    HFVQKSPGDYVPQETILQALGISAEGCASESPQWVQMTVSAPPLDPSGLDWVTTAAS

    >gi|301778052|ref|XP_002924443.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Ailuropoda melanoleuca]
    MSHYERNQIGKMGKKDVEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTC
    KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQD
    FNDTFYRQFHIIVCGLDSVIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNAMVILPGMTACIECTLELYPP
    QVNFPM
    CTIASMPRLPEHCIEYVRILQWPKEQPFGEGIPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRII
    PAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLT
    NSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|301778551|ref|XP_002924695.1| PREDICTED: sulfhydryl oxidase 2-like [Ailuropoda melanoleuca]
    MPYSLGCGGPGADLPTPLDRPYWAAAIRVAALDCAAEENHEVCRAYDIHFFPTFRYFKAFTKDFTTGENFKGPDRELQTV
    RRTMIDFLQNHTDGDRPPACPPLDPARPSDVLSLLDSRDGRYVAVLFENSSSYVGREVILDLLPYENIVVKRVLNGDKGF
    LEKFGVSSIPSCYLIYPNGTRGLINVGKPLRSFFSSYLKSLPDVRKKMLSLPEKPNKEENPEIAVWREFDRSKLYAADLE
    SGLHYVLRVELAAHKSLAGAELRTLKDFVTVLAKLFPGRAPVRKLLETLQEWLANLPLDRIPYNAVLDLVNNKMRISGIF
    LVNHIKWVGCQGSRPEFRGYTCSLWKLFHTLTVEAGTHPEALDGTGLEADPQAVLQTIRGYVRTFFG
    CKGCSQHFEEMAK
    ESMDSVKTADQAILWLWKKHNLVNSRLAGHLSEDPKFPKVPWPTPDLCPACHEEIKGLHSWNEDQVLLFLKRHYGGDNLV
    DTYAADQGDTGEGGSPPQGREPERGLASPEKPRGDQRAESLRPPRALPPGPRLSDGSRLGLDGRLQSPSGAEGRREVETA
    VPFLGMGFSSLDMSLCVVLYVASSLFLMVMYFFFRVRSKRWKVRHHRPSV

    >gi|301778947|ref|XP_002924889.1| PREDICTED: phosducin-like [Ailuropoda melanoleuca]
    MEETKSQSLEEDFEGQATHTGPKGVINDWRKFKLESEDGDSVPPSKKEILRQMSSPQNRDDKDAKERFSRKMSIQEYELI
    HRDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKITTIVVHIYEDGIKG
    CDALNSSFTCLAA
    EYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELISNFISVTEQFTEEFFAGDVESFLNQYGLLPEREIHALDQTNM
    EEDTE

    >gi|301779634|ref|XP_002925232.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Ailuropoda melanoleuca]
    MALSRGLPRELADAVAGGRVLVVGAGGSELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQ
    FYPKANIIAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECH
    PKPTQRTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEASWEPTEAEARARASNEDGDIKRISTKE
    WAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYACLF
    SKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEG
    LKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDRPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQI
    EDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAEDA
    AKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNNADISEEERSRKRKLDEKENISAKRSRTEQTEELDDVIALD

    >gi|301780490|ref|XP_002925658.1| PREDICTED: selenide, water dikinase 1-like [Ailuropoda melanoleuca]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|301780502|ref|XP_002925668.1| PREDICTED: chloride intracellular channel protein 5-like [Ailuropoda melanoleuca]
    MNDEENSTIYDTVQKERMYELPDQPEEDEGPLYDNIHEGLRENHVYATELEIHDYDSVSVYVAGGEEENLTSSQPEAADY
    LLPDEVWPESQDLQPAERQEDRDISVEELHSPTPDRKPGPEEPREDGGMMGEDLLSPRNFTIQQSRTFFTNNSAANGLDE
    NERTSTDPEISLFVKAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVN
    KIEEFLEETLAPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTRQQNNAALERGLTRALKKLDDYLNNPLPEEIDANTCG
    DEDKKSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDFPAEMTGLWRYLENAYARDEFTNTCAADKEIELAYADVA
    KRLSRS

    >gi|301781214|ref|XP_002926022.1| PREDICTED: LOW QUALITY PROTEIN: spermatogenesis-associated protein 20-like [Ailuropoda melanoleuca]
    MLGARAWLGRGLPLPRAGPGLATSRRGSSSRDKDRSVTVNSTVPMPVGGKGSRTSCSPSTLQKVPNRLINEKSPYLLQHA
    YNPVDWYPWGQEAFDKARKENKPIFLSVGYST
    CHWCHMMEEESFQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQA
    TSSGGGWXLTPNLQPFVGGTYFPPEDGLTRVGFHTVLLRIREQWKQNKTTLLENSQRVTTALLARSEISMGDRQVPPSAA
    TMNSRCFQQLDEGYDEEYGGFAEAPKFPTPVILNFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGFHRYS
    TDRQWHIPHFEKMLYDQAQLAVAYTQAFQISGDEFYSDVAKGILQYVARNLSHRSGGFYSAEDADSPPERGMRPKEGAFY
    VWTVNEVQQLLPEPVLGATEPLTSGQLFMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVDAVRTLL
    NTGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGLERLITCAINGAKFLKRHMFDVARGRLMRTCYAGPGG
    TVEHSNPPSWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQDTQDRLFWDSRGGGYFCSEAELGAGLPLRLKDDQDGA
    EPSANSVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAHQQTLKQIVICGDPQAKDTKALLQC
    VHSIYIPNKVLILANGDPSSFLSRQLPFLSTLRRLEDRATAYVCENQACSMPITEPNELRKLLHQ

    >gi|301781831|ref|XP_002926330.1| PREDICTED: apoptosis-inducing factor 3-like isoform 3 [Ailuropoda melanoleuca]
    MGGCFSKPKPGWGLTVLPCPPTVELKIEVVLPEKERGKEELSGGKGSPRAYQGNGTARHFHAEERLPAPHPYPGAQDCVE
    AAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLD
    SLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPCAGHSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDR
    HLPYDRPKLSKCLDAQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGK
    EVENVFTIRTPEDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRV
    KFYMQTEVSELRAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSSISLDSRGFIPVNKMMLTNVPGVFAAGDAV
    TFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFY
    TKGDEVIAVASMNYDPIVSKVAEVLASGRTIRKREVETGDMSWLTGKGS

    >gi|301781827|ref|XP_002926328.1| PREDICTED: apoptosis-inducing factor 3-like isoform 1 [Ailuropoda melanoleuca]
    MGGCFSKPKPVELKIEVVLPEKERGKEELSGGKGSPRAYQGNGTARHFHAEERLPAPHPYPGAQDCVEAAVCHVKDLENG
    QMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLDSLHKFQVKIEKE
    KVYVRASKQALQLQRRTKVMAKCISPCAGHSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSKC
    LDAQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPE
    DANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELR
    AQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSSISLDSRGFIPVNKMMLTNVPGVFAAGDAVTFPLAWRNNRKV
    NIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASM
    NYDPIVSKVAEVLASGRTIRKREVELFVLHSKTGDMSWLTGKGS

    >gi|301781829|ref|XP_002926329.1| PREDICTED: apoptosis-inducing factor 3-like isoform 2 [Ailuropoda melanoleuca]
    MGGCFSKPKPVELKIEVVLPEKERGKEELSGGKGSPRAYQGNGTARHFHAEERLPAPHPYPGAQDCVEAAVCHVKDLENG
    QMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNVSTGDLEDFPGLDSLHKFQVKIEKE
    KVYVRASKQALQLQRRTKVMAKCISPCAGHSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSKC
    LDAQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPE
    DANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELR
    AQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSSISLDSRGFIPVNKMMLTNVPGVFAAGDAVTFPLAWRNNRKV
    NIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASM
    NYDPIVSKVAEVLASGRTIRKREVETGDMSWLTGKGS

    >gi|301781951|ref|XP_002926388.1| PREDICTED: maleylacetoacetate isomerase-like [Ailuropoda melanoleuca]
    MQAGKPILYSYFRSSCSWRVRIALALKSIDFETVPINLIKDGGQQFSEEFQALNPMKQVPALKIDGITIAQSLAIIEYLE
    ETRPTPRLLPQDPKKRAQVRMISDIITSGIQPLQNLSVLKQVGQENQLTWAQKAIRPGFNALEQVLWSTAGKYCVGDEVS
    MADLCLVPQVANAERFKVDLTPYPTISRINKTLMALEAFQVSHPCRQPDTPPELRA

    >gi|301782293|ref|XP_002926573.1| PREDICTED: LOW QUALITY PROTEIN: FAD-linked sulfhydryl oxidase ALR-like [Ailuropoda melanoleuca]
    MARVAGADPRDPGPSACRTLLFSFLPGGARSEVMDDLVTDARGRGAGRRDGTASAPTPAPAPTSDPQVAEDXRPCRACVD
    FKTWMRTQQKRDSKFREDCPQDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYP
    CEECAEDIRNRICRN
    QPDTRTRACLTQWLCRLHNEVNRKLGKPDFDCSQVDERWRDGWKDGSCD

    >gi|301782699|ref|XP_002926764.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-like modifier-activating enzyme 6-like [Ailuropoda melanoleuca]
    MEASEEVAAPQGEEASCSSWGAGSSNTNLPIVSESVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLV
    LAGIKALTIHDTEKCQTWDLGTNFFLCEDDVVNMRNRAEAVLQHIAELNPYVHVTSSSVLLNETTDLSFLDKYQCVVLTE
    IQLPLQKKINNFCHSHCPPIKFISADIHGIWSRLFCDFGDEFEVSDTTGEEPKEIFISNITQANPGIVTCLENHPHKLET
    GQFLTFREVNGMTGLNGSTQQITVVSPFSFSIGDTTELEPYLHGGIAVQVKTPKTFCFEPLETQIKHPKCLIADYSKPEA
    PLEIHTAMLALDQFQENYSRKPNIGCQQDSEELLKLATSISETLEEKPEVNADIVHWLSWTAQGFLPPLAAAVGGVASQE
    VLKAVTGKFSPLCQWLYIEAADIVESLDKPEREQFLPRGDRYDALRACIGDALCQKLQKLNIFLVGCGAIGCEMLKNFAL
    LGVGTGKENGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAADTTLKINPQLKIDAHLNKVCPATEAIYNDEFYTKQ
    DIIITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPF
    CTLKSFPAAIEHTIQWA
    RDKFESSFSHKPSLFNKFWQTYPSAEVVLQKIQTGHSLEGCFQVIKLLSRRPRNWSQCVELARLKFEKYFNHKALQLLHC
    FPLDTRLKDGSLFWQSPKRPPSPLKFDLNEPLHFSFLLNAAKLYAAVCCIPFTEEDLSADALLNILSEVKIQEFKPSNKV
    VQTDETARKPDHVPISSEDERNAVFQLEKAISSNKATTSDLQMAVLSFEKDDDRNGHIDFITAASNLRAKMYSIEPADRF
    KTKRIAGKIIPAIATSTAAVSGLVALEMIKVAGGYPFEAYKNCFLNLAIPIIVFTETSEVKRTEIRNGISFTIWDRWTIH
    GKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPSTEKKYVDLTVSFAPDTDGDEDLPGP
    PVRYYFSHDADXQKLS

    >gi|301784346|ref|XP_002927587.1| PREDICTED: peroxiredoxin-4-like [Ailuropoda melanoleuca]
    MEAPLQPLAATSPASGRSRRLLLLPLLLFLLPAGALRGWEAEERPRTREEECHFYAGGQVYPGEASRISVADHSLHLSKA
    KISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFRSINAEVVACSVDSQFTHLAW
    INTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTD
    KHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|301784631|ref|XP_002927729.1| PREDICTED: copper-transporting ATPase 1-like, partial [Ailuropoda melanoleuca]
    VSLEEKNATIIYDPKLQTPKTLLEAIEDMGFDAILHNPNPFPVLTDTVFLTVAASLAVPWDHIQNTLLKTKGVTDIKISP
    QQRTVVVTVIPSIVNANQIIELLPDLSLDIGTLEKKSGTCEEYSMAQAGEVMLKMKVEGMT
    CHSCTSTIEGKIGKLQGVQ
    RIKVSLDNQEATIVYQPHLITAEEIKRQIEAVGFPAFIKKQPKYLKLGAIDIERLKNTPVKSSEGSQQRSPSYTSDSTVT
    FIIDGMHCKSCVLNIESALSTLQYVSSIVVSLENRSAIVKYNASSVTPETLKKAIEAVSPGQYRVSISSEVESTSNSPSS
    SSLQKIPLNIASHPLTQETVINIYGMTCNSCVQSIEGVISKKAGVKSIRVSLANGNGTVEYDPLLTTPEALREAIEDMGF
    DAALSDTNEPLVIIAQTSSEMPLLTSTNEFYTKMMTPIHDVEAKTSSKCYIQVTGMT
    CASCVANIERNLRREEGIYSVLV
    ALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATMIENADEGDGVLELVVRGMT
    CASCVHKIESILTKHRGIFYCSVALAT
    NKAHIKYDPEIIGPRDIIHMVESLGFEASLVKKDRSASHLDHKREIRQWRRSFLVSLFFCIPVMGLMIYMMVMDHHLAAL
    HHNKNMSQEEMTNIHSSMFLERQILPGLSIMNLLSFLLCVPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYS
    LVILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVEL
    VQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKSGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVE
    EAQTSKAPIQQFADKLSGYFVPFIVIISITTLLVWIIIGFLNFEIVETYFPGYNRSISRTETIIRFAFQAAITVLCIACP
    CSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVESNRISRSKILAIVGTAE
    SNSEHPLGAAITKYCKQELDTETLGTCVDFQVVPGCGISCKVINIEGLLHKNNWKIEENNIKNASLVQIDASNEQSSTSS
    SMIIDAQLSNALNAQQYKVLIGNREWMIRNGLVVNNDVDDFMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAVH
    ILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTG
    TDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVV
    LSSLFLKLYRKPTYENYELHARSQMGQKRPSEISVHVGIDDTSRNSPKLGLLDRLVNYSRASINSLLSDKRSLNSIGTGE
    PDKHSLLVGDCREDDDTTL

    >gi|301784985|ref|XP_002927906.1| PREDICTED: glutaredoxin-1-like [Ailuropoda melanoleuca]
    MAQEFVNSKIQPGKVVVFIKPTCPYCRRTQELLSELPFKQGALEFVDITATSDTSKIQDYLETLTGARTVPRVFIGKDCI
    GGCSDLIEMHQRGELLKRLNEIGALQ

    >gi|301786106|ref|XP_002928467.1| PREDICTED: dnaJ homolog subfamily C member 10-like [Ailuropoda melanoleuca]
    MGVWLNKNDYVRDLKRVLLCFLIMYMAILVGTDQDFYGLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLADNQEGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CS
    H
    CHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVSFAMQHVRSTVTE
    LWTGNFVNSIQTAFAAGVGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNLCKSLDITTSTTAYFPPGAT
    LNDKEKSSVLFLNSLDAKEIYLEIMHNLPDFELLSANTLEDRLAHHRWLIFFSFGKHENSNDPELKKLKTLLKNEHIQVG
    KFDCSSAPDICSNLYVFQPCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPW
    CPPCRALLPELRKASKHLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNVHEYEGHHSAEQILEFIEDLMNPSVI
    SLTPTTFNELVKRRKHDEVWMVDFYSPW
    CHPCQVLMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVRRYPEIRFFPP
    KSNNAYQYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVIQGKNHWVVDFYAPW
    CGPCQNFAPEFELLARMIKG
    KVKAGKVDCQAYAQTCQKAGIRAYPTVKFFPYERAKKNIWGEQIDARDAKEIATLIYEKLENLQNHGKRDKDEL

    >gi|301786555|ref|XP_002928689.1| PREDICTED: epididymal secretory glutathione peroxidase-like [Ailuropoda melanoleuca]
    MTARLRAAYLVPLLLVSVTQTNAKLEKMKMDCYKDVKGTIYEYEAFPLNGSEHVQFNQYTGKHVLFVNVATYCGLTAQYP
    ELNTLQEELKPLGLVVLGFPCNQFGKQEPGENSEILPGLKYVRPGKGYVPNFQLFEKGDVNGEKEQKIFTFLKLSCPHPS
    EVLGSFKHISWDPVKVHDIRWNFEKFLVGPDGVPVMRWFHRTPVSTVKSDILEYLKPFKSK

    >gi|301786695|ref|XP_002928763.1| PREDICTED: UPF0308 protein C9orf21-like, partial [Ailuropoda melanoleuca]
    XXXXXXDASGRQVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPKSFLQEADVTLIVIGQSSYHHIEPFCKLTGYS
    HEIYVDPEREIYKKLGMKRGEEIASSGKSPHIKSNILSGSIRSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRD
    RNRLDHKPINSVLQLVGVQHVYFTSRPSVIHV

    >gi|301786769|ref|XP_002928800.1| PREDICTED: thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1-like [Ailuropoda melanoleuca]
    MAGAPTVSLPELRSLLASGQARLIDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLQDENLIFFCQ
    MGRRGLQATQLAQGLGYTGARNFAGAYREWSQKEG

    >gi|301786847|ref|XP_002928837.1| PREDICTED: probable glutathione peroxidase 8-like isoform 1 [Ailuropoda melanoleuca]
    MEPLTAYPLRCSGSKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDVKGRTVSLEKFKGKVALVVNVASDCQ
    LTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSKEVVSFARNNYGVTFPIFHKIKILGSEADPAFRFLVDSSKK
    EPRWNFWKYLVNPEGQVVKSWRPEEPIEVIRPEIAALIRQMIIRKKEDL

    >gi|301787407|ref|XP_002929118.1| PREDICTED: protein disulfide-isomerase-like protein of the testis-like [Ailuropoda melanoleuca]
    MKLLWMSLLLVASCVSTVQGLPEEDIKEASINISQPLHIVEEGNLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAE
    ELGKAVEIVGKGKNGLGFGKVDITVEKELQKEFDVKKAPELKLFFEGNRLEPISCKGVVESTALVVWLRRQISQKAFLFN
    DTQQVIEFVTSRPLVIIGFFQDLEEEVAELFYDMIKDFPELTFGVIPISNAIGRFHVTLDSVLVFKKGKIVKREELINDI
    TNKQVLNQVIKQHLTDFVIEYNIESKDLIYELHILNHMLLFASKRSESFGMIMQHYKLASKEFTNKILFILVDADEPRNR
    HIFKYFRITEVNIPCVQILNLSSDARYKMPSEEITYENLKKFGRSFLNRSAKKHQSSEDIPKYWDQGPVKQLVGKNFNIV
    VFDKERDVFVMFYAPWSEK
    CKALFPVLEELGRKYQNHSTVTIAKMDIMANDIQLMYLDRYPFFRLFPTDSQQAVLYKGEH
    TLEGFSDFLESQIKTRIEDKDELLSVEQSEMTEEEAFAEEKKVPFIKEELPDQKLPELENVTVLEEPAGQKETAQLEEKK
    VAKPKGPPKQEKKLQVKEEL

    >gi|301787787|ref|XP_002929313.1| PREDICTED: ERO1-like protein alpha-like [Ailuropoda melanoleuca]
    MAPSRAEGGLHPHRPLQVMLGRIESCSGRPLSGRDIVKPLLSWKPRKTLMGEEEIRREAVTGKQVCIRSAVLELSVTGDL
    LEPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQ
    CGRRDCAVKPC
    QSDEVPDGIKSASYKYSEVANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPNAEYVDLLLN
    PERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGKSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSA
    RYLLQETWLEKKWGHNITEFQQRFDGTLTEGEGPRRLKNLYFLYLIELRALSKVVPFFERPDFQLFTGNKVHDAENKMLL
    LEILHEIKSFPLHFDENSFFAGDKKEANKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQIQGLGTALKILFSEKLIANM
    PESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH

    >gi|301787977|ref|XP_002929400.1| PREDICTED: uncharacterized protein C17orf37 homolog [Ailuropoda melanoleuca]
    MSGEPGPTSEAPPPGEIEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRFGGTGAFEIEINGQLVFSKLEN
    GGFPYEKDLIEAIRRASNGEPLEKITNSRPPCVIL

    >gi|301788666|ref|XP_002929748.1| PREDICTED: heat shock protein 67B2-like [Ailuropoda melanoleuca]
    MVPPLLLFRSARQAIPGSAEAALWGLKSIKGSCHNFCTAIFKDVTYKELKNLLNSKKIMLIDVRETWEIVEYGKIPGSVN
    IPLDEVGEALQMDPKDFKEKYNEVKPSKSDSLVFS
    CLAGVRSKKALDMAMSLGFNSAQHYAGGWKEWATYEFSEKKHEN

    >gi|301789061|ref|XP_002929942.1| PREDICTED: chloride intracellular channel protein 3-like [Ailuropoda melanoleuca]
    MAESAKLQLFVKASEDGESVGHCPSCQRLFILLLLKGVPFTLTTVDTRRSLDVLKDFAPGSQLPILLYDGEAKTDTLQIE
    EFLEETLGPPEFPSLAPRYRESSTAGNDVFHRFSAFIKNPVPTQDNALYQLLLRALTRLDSYLRAPLEHELAREPQLRES
    CRRFLDGDQLTLADCSLLPKLHIVDTVCTHFRQAPIPAELRGVRRYLDSALQVKEFKYTCPSSAEILAAYQTVVRPR

    >gi|301789279|ref|XP_002930064.1| PREDICTED: chloride intracellular channel protein 1-like [Ailuropoda melanoleuca]
    MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI
    EEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFSIPEVFRGVHRYLRNAYAREEFASTCPDDEEIELAYEQVAKAL
    K

    >gi|301789885|ref|XP_002930352.1| PREDICTED: tumor suppressor candidate 3-like [Ailuropoda melanoleuca]
    MGARAAPSRRRLAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAP
    PRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRP
    KRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
    AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRSKSVLLFL


    >gi|301790867|ref|XP_002930439.1| PREDICTED: thioredoxin-related transmembrane protein 1-like [Ailuropoda melanoleuca]
    MTPCGSPVVPVAVLLLLLWGAPWTHGRRSDVRVITDENWKELLEGEWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNV
    AKVDVTEQPGLSGRFIITALPTIYHCKGGEFRRYQGPRTKKDFINFISEKEWKSIEPVSSWFGPGSVLMSSMSALFQLSM
    WIRTCHNYFIEDLGLPVWGSYTVFALATLLSGLLLGLCMIFVADCLFPSKRRRPQPYPSKKLLPESSQPLQKVEEEQEAD
    EEDVSEEEAGSKERTKKDFAQNAIRQRPVGPSLATDKS

    >gi|301791698|ref|XP_002930816.1| PREDICTED: chloride intracellular channel protein 2-like [Ailuropoda melanoleuca]
    MADPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGANPPFLVYNKELKTDFIKIEE
    FLEQTLAPPRYPHLSPKNKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSAEELTV
    SRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYASVAKQKS

    >gi|301752990|ref|XP_002912404.1| PREDICTED: nucleoredoxin-like [Ailuropoda melanoleuca]
    MELPYKEKHRKVSGAGLVGAPGLVSPSSVYARHRRRTPRCWGSRGNSSLKLWNKYRISNIPSLIFLDATTGKVVCRNGLL
    VIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAGQKFEII
    FVSADRSEDSFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGGHS

    >gi|301772580|ref|XP_002921708.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Ailuropoda melanoleuca]
    MLVPLAKLSCPAYQCFHALKIKKNYLLLCHTRWSSTSVVPRITTHYTIYPRDKDKRWEGMNMERFAEEADVVIVGAGPAG
    LSAAIRLKQLATKHEKDIRVCLVEKAAQIGAHTLSGA
    CLDPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPI
    LPGLPMNNHGNYIVRLGHLVSWMGEQAEGLGVEVYPGYAAAEVLFHEDSSVKGIATNDVGIQKDGAPKTTFERGLELHAK
    VTIFAEGCHGHLAKQLYKKFDLRANCDPQTYGIGLKELWIIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVA
    LGFVVGLDYQNPYLSPFREFQRWKHHPSIQPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGT
    HTAMKSGILAAESIFNQLTSENLQSKTIGLHVTEYEDNIKKSWVWKELYTVRNIRPSCHGILGVYGGMIYTGIFYWIFRG
    MEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLSIYDGPEQRF
    CPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM

    >gi|301776454|ref|XP_002923647.1| PREDICTED: thioredoxin-like protein 4B-like [Ailuropoda melanoleuca]
    MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDRTPVYTHYFDISYIPS
    TVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

    >gi|301765412|ref|XP_002918125.1| PREDICTED: glutaredoxin-like protein YDR286C homolog [Ailuropoda melanoleuca]
    MFWFQGNSMQLAKYSIQLLMRNLSASKNVLPVLTLFTKDPCPLCDEAKDILEPYKNRFILQEVDITLPENSAWYERYKFD
    IPVFHLNGQFLMMHRVDISKLEKQLQKLEQQGAGGRRTPS

    >gi|301769997|ref|XP_002920414.1| PREDICTED: thioredoxin-like protein 4A-like [Ailuropoda melanoleuca]
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY