Dictyostelium discoideum

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|66827821|ref|XP_647265.1| hypothetical protein DDBDRAFT_0202134 [Dictyostelium discoideum AX4]
    MSQNIYDDETFFNNYAKLPRSINGLQGAPEFEYLKSLLPPINSETSIVDLGCGYGWFCREAIKMGSKSVLGIDISKKMIN
    KAKELDTTLDLGSGDGESQSFSKLIKYEIQDLEKLTSITDNQSFDLAYSVFVFHYLLDLEGFLRKVYSSLKKGGTLLFTV
    EHPIYS
    CSKYTNYWIDYQNNAEEKIWPVSHYSFEGERISNWLADGVKKQHRSIGTYINTLINTGFTISHLNEWSPTDQQI
    KNNPSLLIEKERPMILIIKAIKN

    >gi|66828175|ref|XP_647442.1| hypothetical protein DDBDRAFT_0189671 [Dictyostelium discoideum AX4]
    MKFNNILLIFFVTIVTFSFIISNVNCREFDFSEHPNVQVLSSKNINSFISSSKPSVIVYYGKIADQYYEEENNELLFGVL
    DLDTDIKVKNSHLIDSTPTIIYYKKGAEIAEFGGKKTRSTFEKFLENPLAPIKSSTGPGSWSHIESQVAHLNVRNFSSYI
    SNHPEGVLVMFFTAG
    CGHCTKMKPAFGEASQIAIEKNIGSLAAVDCGVSQKVCEKFKIESYPNIYFFKDGKNVDKYNGDR
    SVNSLIEFLENNNNNNNNNNISSNSNKKSKKVKNEL

    >gi|66828217|ref|XP_647463.1| hypothetical protein DDBDRAFT_0189692 [Dictyostelium discoideum AX4]
    MEKYIKEHTLKPNEIERYGRQLITPDIGVSGQMSLCNSSVLIIGAGGLGCPVALYLSSAGIGTLGLVDYDTVEISNLHRQ
    IGHRESSKGISKAVSLSKTISELNSLIKVNTYETTFTSETAMEIIKNYDIVVDASDNVATRYLVNDACVLTGKPLVSGSA
    LKWEGQITCYNYNNGPCYRCIFPTPPPVETVTK
    CSDGGVLGPIVGVIGSLQALEVIKILTNNKEGVLSGRLLIYDGMSAV
    FRTVRIRGKQSGCNVCGDKPTVTQLIDYTQFCQSNYSESAGKVDDRVDKTLIITVEQFNQSIKNNNNNHLLIDVRPKIQF
    DICSLPNSNNIPIEEIDKKESIEIIEKLIKEKVENNNNNNNNNENRDASDELSVYLVCRRGNKSQDAVKILDEKLKEFRD
    KFKLLHIKDGLLGWNESIDDSFPIY

    >gi|66828545|ref|XP_647626.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MTKLKVGNVAPDFEAKNYLGQTVTLKEFKDKSQPIVLYFYPKDNSPVCTKESCEFRDKYQKFIEAGAEVIGVSSDGEDSH
    KSFVSKYSLPFTLLTDKHSKLAKLYGVNGILLPGRKTFIIDKHGIIAGIHDGLLSSTSHIDESLKIIEKLKLQI

    >gi|66827363|ref|XP_647036.1| hypothetical protein DDBDRAFT_0190102 [Dictyostelium discoideum AX4]
    MSNSGKTLKFLANSVWRGSLNGSGMTTSGGNAFKKGLPLEVPSLARGLPDSKQDENKTNPEELVAAAHSACFTMTLSAIL
    GAHKLSPKEIDTKGTLTLEKRPDGFKVSSIHLTCSGNVPGIDENKFKEYANMAKKN
    CPMSKLFNNNCDISLDAKLV

    >gi|66824945|ref|XP_645827.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MTKLKVGNIAPDFEAKNYLGQTVTLKEFKEKSQPIVLYFYPKDNSPVCTKESCEFRDKYQKFIEAGAEVIGVSSDGEDSH
    KSFVSKYSLPFTLLTDKHSKLAKLYGVNGILLPGRKTFIIDKHGIIAGIHDGLLSSTSHIDESLKIIEKLKSQI

    >gi|66824951|ref|XP_645830.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MTKLKVGNIAPDFEAKNYLGQTVTLKEFKEKSQPIVLYFYPKDNSPVCTKDSCEFRDKYQKFIEAGAEVIGVSSDGEDSH
    KSFVSKYSLPFTLLTDKHSKLAKLYGVNGILLPGRKTFIIDKHGIIAGIHDGLLSSTSHIDESLKIIEKLKSQI

    >gi|66824965|ref|XP_645837.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MTKLKVGNIAPDFEAKNYLGQTVTLKEFKEKSQPIVLYFYPKDNSPVCTKESCEFRDKYQKFIEAGAEVIGVSSDGEDSH
    KSFVSKYSLPFTLLTDKHSKLAKLYGVNGILLPGRKTFIIDKHGIIAGIHDGLLSSTSHIDESLKIIEKLKSQI

    >gi|66825157|ref|XP_645933.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MTKLKVGNIAPDFEAKNYLGQIVTLKEFKEKSQPIVLYFYPKDNSPECQKSCEFRDKYQKSIEAGAEVIGVSSDGEDSHK
    SFVSKYSLPFTLLTDKHSKLAKLYGVNGILLPGRKTFIIDKHGFMAVFMMVYSVQLLMSMNL

    >gi|66825193|ref|XP_645951.1| hypothetical protein DDBDRAFT_0190245 [Dictyostelium discoideum AX4]
    MSISNKIIGSAKSIWGKGGFFKGTGTVSSTSSKAFSVGLETPASAKNFILNSPNKYTDNENNTNPEELLCASHSACLAIT
    FSSILGKHKYEATHIEADAKCTMEITPSGFVVTNIDLTLNATIPNIENEKFQELALIAKDA
    CPISKLMNGNVKVSLKSTL
    NN

    >gi|111218599|ref|XP_646096.2| hypothetical protein DDBDRAFT_0190385 [Dictyostelium discoideum AX4]
    MGDFKGEDDNYDYDEGIPLFNQVIFTNSYNNSKVVLDDNQDDIIFITPPSPPPTLQTKKQCEKGCCGEKKSLLTNNDEDR
    DKDEDEEEDDDDGVPKNYKSNSNVGSIVSLDMDSLNSAIIMEPNFQKDYTISSPVVTTTTTTTTTTTSNDNCKKGCCPTP
    SDDEKMITKDDKGSCKKGCCSSSSKTTETNDIGCKKGCCPTEQPKQQVESTKTYCCNICVTGHCCKVDCCKQVCCLTYSV
    GVPNFSFMRSSSSSDDNNNDYNSDQQRKKRIFATMFSKTCGTFGFKVGYSELNEDKVDIEQQEERDNKGLSTNNNVSIEL
    LPITTTNNFKNSTGIKSSQSSTLSKSLEKVELHLMISGMT
    CADCVTTLEQKMKSLSGVNEIQTSLFTGKCKINYSPMIIQ
    PQQILQVIENIGFVGKQVHGQSSNSNQITIEIISLSPTSTLTTILNDQLIENIKLSIDGVLDAIEESGSVNDKLTIVYDT
    DKIGPRNLLKEIQLIFGDNFKIQPNTKLNNNNNSNNKNNNSKDNNNNNLKSLLMFCILLFIPTILISYIFPNIKSVKEVM
    EFEIGKGITMSILLLLSFATPIQFYCGKPLYISAWKTLIYARKCSMDLLVMTSSTIAYFYSLINLILNHFSSLNYNGPIF
    FETCVILLTLIILGRYLEHLAKSKASNVLVEKMKQLDSSNAILLSNNNNKDVGSEQEIMIEKELIEKGDILKVLPFTKIP
    TDGIIIRGNGGYIDESIITGEANHVYKRIDDYVFGGTMNQKGCLIIKVTKHSNDTALSNIIKLVEESQSIKPNFQNYADL
    VASYFVPTILICSIITFIVWFCLIHYNVVIATDNQSAFTFAIKISMSLMVISCPCAISLATPTSIMVGSAIGAKKFGILF
    KGGGQVIELASKVNKVIFDKTGTLTTGEIDINHFSIYDQSISPKQFFFYTASAELSSEHLIGKSIKQYAIQQFTLEKALQ
    EPTNSEVHPGKGIISFINNNKIMVGNQSFIVEQLSNNNNKIDSCQSPLQSSQLINSKSDDCKKGCCLSLPPPPPPPTSIS
    NGSECKKGCCPAAAAPPISTGNGSDCKKGCCPSLPPPPPTSISNSSDCKKGCCPAPPPTSISNGSDCKKGCCSSSSSQLS
    KSQSKEVIINSVIQNDIDKLENQGKTVILVSMNEKIIGLVSLSDKLKPEAKKVISKLKNNGIDVWLVSGDNKRATQSIGE
    QLNINSGNIIGSALPIDKFNIVRKLQGYNTTEDNCCGTDGGDGFNGASVGCSGSDNNSNNGKNKSIVVMVGDGVNDSLAL
    VQSDIGISISNGTDIAIESSSVILLKNDLNDILVCFDLSKSIFKTIKFNLFWAFIYNLLGIPLSSGILYPWFTIPPALAG
    LSELLSSLPVVLFSLTLNNYKYQNKN

    >gi|66826621|ref|XP_646665.1| ubiquitin activating enzyme E1 [Dictyostelium discoideum AX4]
    MSKPMDVEQEPKIDDALYSRQLYALSHETMKKITSTSVLVVGLQGLGIEIVKDLSLAGVKSVTLYDKELVEIKDLSSQFY
    FSPEQVGKVGRADACFQKVVDLNNYVRIDVHNGELSDEFLKKFNVVVLANQPLALQLKVNEFCHANKIHFISVETRGVFG
    QLFNDFGEQFTITDTNGENPNAYMISSISQDKEGIVTVVEEQKLQLLDGDLVTFKEVNGMSALNDLPPQKIKTISPLTFS
    IGDTTNLPPYTSGGYVTEVKQPKVVDFKPLKNILESGENIFITDDFKFTQPTNLLAGFQAIHKFAEKNKHMPRPHNKEDA
    NAVIEIAKGLLKKPDDELDEKMITQLSFGAQGDIVPMQAILGGITAQEVLKACSGKFTPIHQLAFFDSVECLPEDLETLP
    EEEFQPIGSRYDGQIITFGKTLQNKIENLNYFLVGAGAIGCEMLKNFAMMGLGAGPKGLVHVTDMDTIEKSNLNRQFLFR
    SSDIQQLKSQTAANAVRVMNPDLNVKAYSLRVGPDTESHYNEEFFNSLDGVCNALDNVEARLYMDSQCVYYGKPLLESGT
    LGTKGNTQVVVPHLTESYSSSRDPPEKGIPV
    CTLHNFPNAIEHTIQWARDTFEGLFKNNADNVNSYLTNPAYVQSLKTQN
    PFVRLETLASIKASLMDRPLDFNQCIAWARLKFEEYFNNNIEQLLYNFPKDMVTTTGTPFWSGPKRAPTPLKFDVENPLH
    LEFIVAAANLRAFNYGIKAETNIEVIQKQAANVIVPDFTPKKVKIQTSENEPAPSSNTQQAGGDAEDDQCDTILSQLPQP
    SEMAGYKINSIQFEKDDDTNHHIDFITATSNLRATNYAISPADKHKTKGIAGKIIPALVTTTAVVAGFVCIELIKVIQNK
    ALEKYKSTFMNLGIPFFGFVEPIAAPKNKIREGWTWTLWDRFDVDGDITLKEFLDLFEKKHGLDISMLSCKVTLLYALFT
    DKKTKEERLKMKISQLYETLSKKPLPKDKKYLLLEICCNDTETGDDVDVPSVRYKYN

    >gi|66826709|ref|XP_646709.1| hypothetical protein DDBDRAFT_0202012 [Dictyostelium discoideum AX4]
    MLSSKFFSLYSKTKLLKSTTSNFILFNKLKYSSNNQDFEKRFFKMSDNKTTTTTTTATSTSTPTPSTLNDKSTIKTTPIT
    DNNNNNENFKYTNKLINEKSPYLLKHAHNPVDWLPWGEEAFKIARDNDKLIFLSVGYMA
    CHWCNVMERECFENVEIAKVM
    NEYCVNIKIDREERPDIDKIYMTYLTEISGSGGWPMSIWLTPQLHPITGGTYFAPEAKYGRPGFPDLIKKLDKLWRKDRE
    MVQERADSFIKFLKEEKPMGNINNALSSQTIEKCFQQIMKGYDPIDGGYSDAPKFPRCSIFNLLLMTLKEDYSKQVGSLD
    KLVFTLEKMANGGMYDQVGGGFHRYSVTSDWMIPHFEKMLYDNAQLASVYLDAYQITKSPLFERVAKEILHYVSTKLTHT
    LGGFFSAEDADSLNLEINEKQEGAFYVWSYQDIKKAIQDKDDIEIYSFHHGLIENGNVDPKDDPHNEFKDKNVITIVKSL
    KETAAYFKKTQEEIEKSLNQSKEKLFKFREQFKPKPQLDDKIIVSWNGLMVSSFCKAYQLFKDEKYLNSAIKSIEFIKTH
    LYDSVGDDNDYDDEDDKLNNCRLIRNYKDGPSKIHAFTDDYSFLIQALLDLYQVTFDYKHLEWAMKLQKQQDNLFYDLEN
    GGYYSTSGLDKSILSRMKEEHDGAEPSPQSISVSNLLKLYSITYNEAYKEKAKKTLENCSLYLEKAPLVFPQMVCSLYLY
    LNSINTIILSTNSNDNQQKQQLLSILDEIHSNYIPNKLILLNDHSNNSITQFFEKSTSNLNLSLSTPVYDKTTFSLCNPN
    GCTISTNQLQQIKSNLINQIYPKY

    >gi|66826841|ref|XP_646775.1| hypothetical protein DDBDRAFT_0216771 [Dictyostelium discoideum AX4]
    MIRSRNSNPNRLKNLFLNKYSFFLFITIILYYYFSFNIQKTIDHQPITVHSETQPQQKEPINKLQYVQKLIDDNKLIIFS
    KTY
    CGFSKRIKQLFKTIDGVTPMIVELDIIDDGTEIQSILSGISNIRTVPQLFINGKFIGGNDGKFFLFYFWKKKLLLTW
    NFFFFPKNK

    >gi|66824215|ref|XP_645462.1| thioredoxin-like protein [Dictyostelium discoideum AX4]
    MKKSIIIIFTILIIFLINSCISQETEQPQQTQQPNNRPSLKDESLIQQLDTNNIDRILNHGNSVWLLKFYAPWCKHSQEF
    QKTFVEMSHLLKDHLSFGSVDCINDPMLLHRFEITAYPTLKFLYNGQLFEFQGERTIEHIVQFLQAGYKDVVAMPYPLID
    QQEILKRQLELQYSREGMSQEQIDQMEKQIKEKQQEYEIKRNARKYLEVEHDHDEEKEIAEYKERINNRKSNNADNGEVL
    DKEPPKVPGNSTIDSNSINILESILDSKIAYLLFGSISTGLFFIIKKRISKKSKFMKIA

    >gi|66823895|ref|XP_645302.1| hypothetical protein DDBDRAFT_0168810 [Dictyostelium discoideum AX4]
    MAFGNKINQILDEKSHITTPATTENENKNKNKNVEITTIKKASFLSKDITNEDEDDCGTCELLGVTEKKNQMFQMISINN
    NNNNNNNNNNNNGNGNNNNDNKNNEDSKYWEPMPSPPTTIELGNSGWTLLHTIAAYYPEKPSEKKKQDIKEFLQSFSKVY
    P
    CKVCAKDFREIMKETPPILDSQNDFALWLCNAHNNVNLQLGKPTFDCNLINKRWKINNNNEFH

    >gi|66823169|ref|XP_644939.1| glutathione reductase [Dictyostelium discoideum AX4]
    MSSTNHFTYLVLGAGSGGIASARRAAKHLNAKGNGDRIGIVEVTRPGGTCVNVGCVPKKVMWNTSFIKEMINAAPSYGFD
    FGGQQVKFNWPTIKKARDEYIKRLNGIYDSNLAKDNIVRINGYGRFSGPKEIQVNGANGEKYTADHILIAAGGRPTVPDV
    PGKELGITSDGFFELEDLPKSTLVVGAGYIAVELAGVLHSLGSETTMVIRQKQFLRTFDEMLHTTLLKQMTDDGVKFVTE
    ASIKSLERDVDGKRIIATTNAGVKLPPVECVIWAIGRVPNTDDLGIDKAGIQLTEQSGFIKVDEFQNTNVPGVHAVGDIC
    GNFLLTPVAIAAGRRLSERLFNGKSDLKFEYENVATVVFSHPPIGTVGLTEQEAITKYGTENIKCYNTSFINMFYSVQVH
    KVRTSMKLVCLGKEEKVIGLHIIGDGCDEIIQGFAVAVKMGCTKWDLDNTCAIHPTSAEELVTMV

    >gi|66821043|ref|XP_644052.1| peroxiredoxin [Dictyostelium discoideum AX4]
    MTHPHCHKKEQIRIRKPAPAFKGQAVVNGEFKEISLDDYKGKYLYLFFYPLDFTFVCPTEIIAFSNAAEEFKKAGCELVG
    CSIDSPFTHLAWINTPRKEGGLGGINIPLLSDLTHQISKDYGVYIEEDGHTIRGSILIDKEGLVRVITMNDNPVGRSVDE
    AIRTLKALKFTDQFGEVCPANWSEGDKSMKADPKGSKEYFEAVNK

    >gi|66821189|ref|XP_644101.1| hypothetical protein DDBDRAFT_0217531 [Dictyostelium discoideum AX4]
    MNKNFKFIILIFLIVSILFINLNNCQDNDNEEVDMNDNSNSDVIILTDSNFEDLTTSNPNETWMVEFYAPWCFHCKNLKK
    TYDQLSTKLKQQDPNLKVAKIDCVANPKQCKRFSIRSYPTIKVIKGNSVYDMKGEKTLNSLNEFINKGYEKSVDQIKQLP
    ASIILKVVDLTDKTFPSVNDGSWLIYFHIPR
    CIYCEKFMSEFDALPSADFSKSNEKFNFGKINCQTYKEICDLYRVEYFP
    NVKFFENSTNLYYNFNHEPTTSNLKEFAMFYYKHVSPIKRPWNAMFSLFEEAIREFVWLFLLVSFLFGFFICYIFYGMVP
    PSPPPPPPPPSTIQSKNQIQTKMKKSE

    >gi|66821301|ref|XP_644145.1| hypothetical protein DDBDRAFT_0203208 [Dictyostelium discoideum AX4]
    MNSYLFRIGSKTSGFLRSTQFVRSYSKHVKSESYKKALEDVETQVAESPCILYMKGIPERPECGFSNTAVRILQAEGAVF
    TSYNVLKNNDMREAVKEFGDWPTIPQLYVKGQFIGGADILMGLYKSGELSKLLNEAGVVKKDE

    >gi|66820262|ref|XP_643763.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Dictyostelium discoideum AX4]
    MNNKIRKSIENNNNNNDDDDDDNNKKLKIEKEEKEEKEEEIKIINSFILKSPIGALKITADDKSLHGIRLYESKNLDEEC
    KNKTNNKIILQINQELDQYFNGKLQEFKTPINLELGTEFQRKVWTHLRTIPYGSTLSYSSVATQLGLDKKYARAIATSCR
    LNIFLLLVP
    CHRIISSNGKVIGYSGKKGIDKQFILSNIEKANIKT

    >gi|66820504|ref|XP_643858.1| hypothetical protein DDBDRAFT_0167375 [Dictyostelium discoideum AX4]
    MKLINICIFIFAIICIESTFGFYTDNSNVINLTKKNFQQQVLNSQQNWMVEFYAPWCGHCKSLKPEYEKVSNNLKGLVKI
    GAINCDEEKELCGQYQIQGFPTLKFFSTNPKTGKKGQPEDYQGARSASEIAKFSLAKLPSNHIQKVSQDNINKFLTGTSD
    AKALLFTDKPKTTDLYKALSVDFFKTLTLGEARNLNKETLEKFNIDKFPTLLVFTNDDGETFTKFDGKLTHSTIYKFLEP
    FSKKSNNDNNNNNNNNNNEESTKTTTTEKDPASEKFIEIKDEKSFEKSCSTGLCIVALFDQSSIDDKELNEKYLELLNTV
    SQNFIGRMKFVWVDVSVHDKIVPQFDLSGTPNIFVINNSKKRYTPFMGSFSDESLNSFFKSVLSGLKKAIPFTDSPKFNS
    QQKKQKDEL

    >gi|66819631|ref|XP_643475.1| thioredoxin-like protein [Dictyostelium discoideum AX4]
    MANTINTNEEFENILKDNKFLVVMFWADWSKPSTQMRDVFDQLAKQATNQANNKLLFLKVEAEKVHQISGRYNVKSVPTC
    IFLNQGKLVQSVVGANPSELALQTNNFSKTCDTLPLEEQQQQQQSEEIINKIKLDQEQEKKLLNERLEKLVNQSPVMLFM
    KGNPEKPQ
    CGFSNKTVTILKENGFEFGSFDILQDQAVRNGLKEYSNWPTYPQLYINGKLVGGYDIIKDLNEEGELIDLKP


    >gi|66819743|ref|XP_643530.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MLLLQNFNQQQNSNLIIQLIVAGVIIILISKFFILPFLSNKSSSKMTKLKVGDQAPDFTASDKDGKSYSLKDFADKVLVL
    YFYPKDSTPG
    CTKEACSFRDNYEQFTEAGAVVVGVSSDDAESHSKFSAKYRLPFTLLTDNKGEMAKKYGVKKELLLIPGR
    STFIIDKNQKIALIHSSLLNAESHITESLKVIEQLKSQ

    >gi|66819775|ref|XP_643546.1| hypothetical protein DDBDRAFT_0202474 [Dictyostelium discoideum AX4]
    MNYLFNIFEEEKPIKKAPIITEECYRNGYHPSKWELAQVLLNGIWKPYKFKSYMQYKSRERLNLQADTQCPDAILLDDQT
    NQEVSLYDLFNSNNNEKSVQDRPMWVDIYIVYLKEIHPADEWYIGGDEISLCYRQPKTMEDRREIIKDLKEYAPFCTIPF
    LIDKMDNNFNKVYDAVPERLYVLEDKKFKYVGGPGPFGFIPEELREFLTKRYKPHLLDLKNNLSIPPSQ

    >gi|66819343|ref|XP_643331.1| ZZ type Zn finger-containing protein [Dictyostelium discoideum AX4]
    MSRVKVLVDNQLDSELVTAGKRLVVVDFTATWCGPCKMISPYFEQLSSEYKDVIFLKVDVDQCKSTTQSQGVRAMPTFKF
    FIERKQVHEFSGADKNQLKSSIERLQPQLSFASQGNALGGGGGGSGNSRQAYLDNLEKKQQEQQAQYQQQYGNTTTSPTV
    PTPITSSSSSTATKSRPPARATQPDPIMMKDLIDMGFPENRCRKALIMVNNSSSQSAMDWIFENMDSPTIDDPLEGDTGA
    TTTKSESTTTTTPSTTNTDGSTTTTTTTTTTTSEQKEYPTTVHNALCDMCQNQIIGYRYKCKVCPNYDLCQTCKDTNKHN
    PEHEFVAHENDIENYQMTPEEKAEQKKRLEARIQEIRVKKAEEEAKKEIEREINRRQGGKSTQQALTKWQEDQLKREQEK
    DRKEKEADRIAKAKIKAKVEADRLERAAKKNATLNNNVATTTTTTTTTPTPVPVYVPKQNYTESLIQIRLTDGTTIKGTF
    PLSTKLIDVHTFISNNTSQHGKFTLSSTYPRKIYTNDELKSISVQDAGLVPNGTLQVQKL

    >gi|66819395|ref|XP_643357.1| protein disulfide isomerase [Dictyostelium discoideum AX4]
    MKILLFVTLIALAFVALCSAEGNVVVLSPDNFDTVVDGSKTVFVKFYAPWCGHCKKLAPDFEILADTFAPVSNKVVIAKV
    DCDQADNKALCSKYDVSGYPTLKIFDKSTTAKDYNGARSVDELLTYINNHAKTNVKVKKAPSNVVDLSPSNFDSVVLDKS
    KNVLVEFYAPW
    CGHCKKLMPDYEILGNTYANEKDVVIAKIDCDAADNKAICSKYGVTGFPTLKWFGKQSKDGEKYEQGRD
    LDTFINYINKQAGVNRVKGGKLAVGAGRVEQLDTIATEFIAAAAEVRKELVKKAQTVVDSLPEELRTEGSYYVKVMKTIA
    EKSIDFVTTEIARITKLVSGSMSGKKADEFAKKLNILESFKSK

    >gi|66819003|ref|XP_643161.1| hypothetical protein DDBDRAFT_0217823 [Dictyostelium discoideum AX4]
    MTKATFAAGCFWSVELLFQRVAGVTKTRVGYTNGTVENPTYRQVCSGKTGCAEAVELEYDPEKVTYNQLLGLFWSKHDPT
    TLNRQGNDVGTQYRSGIYYHNEEQKNEAIASKEKEQLKYKDPISTEILPAGVFYPAETEHQQYLGNY

    >gi|66814480|ref|XP_641419.1| hypothetical protein DDBDRAFT_0205881 [Dictyostelium discoideum AX4]
    MGIMKIGEIAPEFTLPNKDGKLFNLKDFAGKPLVIFFYPNNIGWVCTREVCYFRDSYEKFIEMGAEIY

    >gi|66814482|ref|XP_641420.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MTRLNVGDQCPLFSVKNKDGKEIKASDYIGKKPFVLFFFPNNIGYYCKSEVCEFRDAYEKFCEFGVEVIGASPNSVESHN
    RFAEKHKIPFNLVVDEGRKLAKTFGVDGFLITDRVTFIIDITGKIVFSHSALLKSTQHIEESLKLVETLSAN

    >gi|66814524|ref|XP_641441.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MTKLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKYQKFIEAGADVIGVSRDDAESH
    SKFTSKYSLPFTLLTDKGGELAKLYGAEGNFLSPGRVTFIIDKNGKVALNHSALLSATSHIEESLKVIEQLK

    >gi|66814210|ref|XP_641284.1| hypothetical protein DDBDRAFT_0206420 [Dictyostelium discoideum AX4]
    MSISGVVKLGKPSKKAIFSMTDSALKRVKEIMNDKKIDNCIGLRLGIKERGCSGMSYTLDFATQKNKFDETVVADKDINI
    IVDSKALLSVIGTEMDYIEEPIKKEFIFINPNATNTCGCGESFTTKDFSIPDLKLPKKN

    >gi|66813684|ref|XP_641021.1| hypothetical protein DDBDRAFT_0204723 [Dictyostelium discoideum AX4]
    MGGVFKNRFLIFSVFLFILLLINNCCLSKEQQSQNQNELSINNNNNINNNNKNENNENNENIIIPTKGNLESIDNNDEMI
    QIKENNPVLDDRYSHLKISKKEQQEQQEQQEQEQEQEQQEKEPSEQEQEEQEEQKEQEQEQEEQEQEEQEKIKQPQIFSS
    EKPQDHEEKKSVEMVVDRNILCDTKLTKEEHDQVIEKVLKSYFGDLATDSLDYQSIATQFSNYISNSICKDFKPTTTDID
    NDDDNNNNNNNSNNDDDNNIDINNEEDDKKKNLNTLQTSAANSAKTPVSLEPTQIVENNLVGDTPVSSSPSSSSSSSSSP
    PSSSSDTSSQDKTTSTSTIKSKTENKKIEWPKESNYILNYSSILELTENNFDRVIKENQFVFVLFYAPW
    CGRSQAMMGEF
    YEAHRIYQQSQFEPKVLFGRVNCHKYPSIRDKQSIGGYPVMELFRRNNGGNLIPRGASSQPTTMISFLRRSTLPSIEVIT
    SFEKFENFSNIVPYGLIGIFPDLNTNKSLIFDSLCRKLAYKFPVAVVINSNLSNIILNHLNLTNQFIEINKIEKQVEIVE
    EKVEEEQEKVEEEKLNEIENEGVILIKPLEKSYKVYDKEFKNSVLLRWLSENYSPIVNELTPDSIHRVVSNKVKQQSFLL
    FLNLTNVTPTMALKDRPFSKELSTLLDQSPKWANQINLYYVDGITFRDFAERLGVTSYPQMVIIDFQSEEFFTSLPNSFE
    ISNFLTQYYNNELKPFKYSQIINISMTATTETATTTSTSTTEEILIPSQKIQSNNIVYNNFNSTVLESKDKNSLIYFNAP
    WCGYCKTMNIYYREAAKILSTQYGDKLQIFTYDVEKNSIPTIMAPIIDTFPYISLFKSNDIYNPISYNLTRNLNSIVEFV
    NLNLNLDDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDKIHDQNIENEKTNNQDKEQTSNNLPQQI
    VENSKKQQVNDIKNDDIIYDFQIHSLDETEKEIS

    >gi|66813720|ref|XP_641039.1| thioredoxin reductase [Dictyostelium discoideum AX4]
    MSTEKIQKVVIIGSGPAGHTAGIYAGRARLEPLMFEGFMAGGVAAGGQLTTTTEIENFPGFPIDISGSELMDKMREQNIK
    CGTTIETKTISKVDLKQRPFTIYVEDEEDKPIKAQSIIIATGATAKRMGVPGETEFWSKGVSA
    CAVCDGALPIYRNKHLV
    VVGGGDTAAEEATFLTHFASKVTLLVRRNVMRASKAMQQKVFSNPKIEVLWDTTLVEIKGEKSVTSVGIYNSETKVSSNL
    DAQGLFYAIGHTPNSAFLNGQLNTDETGYIITQPGSTKTNVEGVFACGDVQDKVYRQAITAAGNGCMAALDCERFLSSL

    >gi|66812604|ref|XP_640481.1| hypothetical protein DDBDRAFT_0218338 [Dictyostelium discoideum AX4]
    MIECTDKIKKRNNNNNNNNNSSSNNIDNKSEYDINSKENYNDIDDDNKNNNKISKPIILKKKRHPLITTLRYVAIFLIFF
    LLTSEYLVQFVHVEAVPLNKGKFSHINSNVSDPRDYNALRIQYSTNYHEITSDHLFNMLNNRSRDITVSSSNDFNNNNNN
    NNNNNNNNNNIIYDENIINNGIDNNKLTSEEKEKEKEKEKEKEKEKEKEIKEKNLKIFREYNLTEDYYTNILNSNTTYIL
    FLYHMD
    CPFSQRLLPIIETLSRTYPNIIFFQSRGFTVILKSHFHTRTTPTLFIRVNDTLVKYKGRKDLVSIGKWISKNSN
    QIPLEVEPNVDIELSKEIRVDRGYLLYFSCIYVSFLIFCSIKRWFKKYQNLKTD

    >gi|66811836|ref|XP_640097.1| hypothetical protein DDBDRAFT_0204808 [Dictyostelium discoideum AX4]
    MSRIQQVNKSILIRSFCTGAPSKSNFSPVGNFLRIGDVVPDFSQDSSVGQINLYKTLGDSWGLFVSHPKDFTPICTTELG
    RLAKLKPEFEKRNCKILALSVDSVKDHLEWMKDIEETQKVKINYPIIADQDRKVADLYGMIHPNADNTFTVRSVFFISPD
    KRLRAQITLPASTGRNFNEIIRILDSFQLTDKYKVATPADWVDGDDCIIVPTVFDEDAKKLFPKGFPKIKSYLRVTPQPN
    K

    >gi|66811094|ref|XP_639255.1| hypothetical protein DDBDRAFT_0185377 [Dictyostelium discoideum AX4]
    MENDERASLINNNYDSAENESDFINESLDNNSNETFEVNGSGRINNYYNLIKTPSISSSPLIESSLSYQKQSPPPQEKPP
    DTQLPSLQEQQQEQQHQQSQEQKQPSQEQEQQLQEQQPTIFKRMWDLFFSSSPPNNNNNNNNNNNNNNNNNNNNNNNNNL
    NNNINNKKTDNSPINRNLNSSMEFVDENQKHMKEQRNDDDEASSSSSASSSSSSRFRQNNNNNNINNSNNRNNSINNSDQ
    EREKDHEQVNRIYDLFFSLSAIGNDEDNDDDDDDDEGEEQDDNRIYKQVNKKNVNRTNIKYNNLKIDDQQQQQQQYINQQ
    QENKNEIKNKDLKQPQKSTENIEQQEQQEDQQEQKEQEEEEEERLKSPIEPKSPIEQPKLVSKSKKEDNKNLFEKSPFFE
    PQRPVIDFSDPVLLEPIESKLPGNLEKNKHLYENVKPSPIPLSVILTGITVCDVTDGKELLLTSLYENKRIVVAIFRRFG
    CLICRLQALDLSALKPKLDKIGIELVGIGFDEEGLEEFQQLKFFAGKIYLDKTRSVYRALNLKRRSKLTTYELFLDPRVM
    VYYRRIKEMGFSSNYRKDGFQLGATMVLGPKPQEAHYDFRPQRYADIFDLKEIWEACLKPYPTKEEILASRKIDLSIPNP
    ITLDLQLNSIKFDLSVYNNNNNNKNDNNNKNDNNNISKNRGNTLSNIFNLPSNQYITNTYNGNDDIDENEVYADYDKGED
    NDGEDDEDYSKSIYSEEDDEEDEEDEEEEDEEEEFYEDEEEDDEEREKIKLPKPSKSSKILLSILNSVQVDPSLFRTDDR
    VIYTVPSLELEVQGDNDSLAPISSVAPSKSSTSQEQEYIDKINSTIYVQSNSFYKPTKSSKFILRDEEDEENPLIYCPYK
    YNG

    >gi|66810776|ref|XP_639095.1| hypothetical protein DDBDRAFT_0185540 [Dictyostelium discoideum AX4]
    MNSNINNNNNNNNNNNNKKIIKINKIGNELKCQICSNYLNDPVQEKQCGKIFCRECLNGRDICPTCEIKTTTTTTKIVNK
    IEISQDFNIGKFNEILVVCDECDDIIPIKRCNNFINYHLKNDCKTQLCSLGCGKLFKNTEINNHITNQCESIIINCKGEN
    VNCKFSSIRSIVSIHEITCPHVLLQSMLINLIESNKEKDLKITKLENDLILANLKLQKLQQEQQQEQQEQLPIPTTKINQ
    IFSKPMFIPQTIPDIVKLSGPQLEPPPGLSQFTMDFLNNKNSKNYTEPKSIDEFENEFSKRNLVMVFLSTLW
    CDKCKECE
    KVLKIYAESQQQIMFIKVDLDKLPNIEVCKNVSGVPCFVTYKNGEKINSYLARILLFLSIFIIISFFFSKTTQTNIKINK
    DNENDDGSGGEYNKRSIFISEKHGSDKFGNGSIINPFKSFCILNETIDQYNENELIINIDYGNYGVVDSLKVNCTILEIN
    DFTHNITFQQYNSNENNENNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNVNIYNINLI
    IKNSIVNFLNLNFFNYLNFDDGDGFSVTENSFVILDNVLFNYEYANNARHLVNKSRVIISNESEFIYNFDIEFLITNNGS
    VEFNSRSKVNSIYFNFGHGSYLSFRENCILYLVNTIIYQLTDVTIVIDNSTVIDPNFGNQGGQLHISNSILEGEEIRDYD
    SQAMIQVFFGEVYITNTTITSNMKDFEGLIMYMNNNASLYLTNVEIKNFNPLYYGFISFNSYIEVNNMTLVNCQVSYLFS
    SYFSKIYFKQVQLIDYFFITFYIEEQSTIVIDQMNIPCSSKFVKFLPFIKINEESNKIGTSNISISNSNLNCVGGLDFKK
    TNVYFYNVSIDTSFQDFFISLSDNSYLELVNCTSISNSENNEGYFIKMYDQSIVLALNVTISYSSSILSATNGSVASFES
    VFINQVESFGNNQIFMIEDSNINFKNSKFSNDYSTQALIINSTRSSINIIDTAFEFTSFKNPILYGLNSMILLDSISIYR
    CQCENNCFKIVNSSIDVSKSKFQNNFGSSFNKFSTSSLIDLRSSRVNINSSTFQENNFDLIFRIVLNSNIILNENIIQNN
    TGAFFMGNEIKINIINLKFNNNNNPPTYLFNFFNSIILINNFYLFENTFMQSSFYSINSIIQLENTELSKNYINQIFILN
    NNNNDNYFKPIRDVVFYFVNCIINFNGLNVNSNSIDMEGIFYFQNSNVTINNAIVNENSLIGSLNKRLFYFNNSILSFTN
    SNITSNNGGTNSLGLFNSFNSSLLFENCNINLNIFFNGNGSFLYFNNNNNQNNYFQILNSNFSSNIASFGLFYFIGFNGS
    CIDTFSSNLKNEFKNNIIKFNRALNQGGSIFTTNFPFSTNSSKILSTNIFEGNYSPYGSNFASFQNEILISNFSVYSGIE
    TIINYKILDYYDSIYSVENGLLLFNVLYLKSNITTIYQSKVYSGYGIVIIEFTGELNDIYTITVENQIFNVSVSGCLPYQ
    YYNEIGTCIYCLDGESFSKSKNECIKCNSNSLLCIEGEVFINQGYYLVNQDVEYIEECPFEMCLQNNTCSSSLSIGNLCF
    SCTFNSDSSSSSNGNELIKSKNGIQCCSMFKPFLLIPIGFFFLIYGLILSIIKYNAFKTPIGYLLIYFQVNSVLLFYFKG
    IYILPLFRGSIDALDGICYFKGMNYLIKCLISFLIIISLFLIGYSDITINILIKFHNYKFSGDQPRYLKNIIKNKKDNIK
    IYNLKSTIWTLFLLLLTPILFNSFSLLLFKKVVNNYYLMVDFSISYSHSIFPWYSIISLFLIILTILLILIMIIFNFATT
    ITTKKTTPPPLPPQSLKEEFKIKNSISNFISNYNNFKFGNKWWDIIIIIKSLLFSGLSISLIFNSSIFFEIVLPIEFFYS
    TLFFLIGPIKNIKLRHSINIINLMQSIVLILANSSLLNSLSPFNQGLTLTLFSFSIIFYFIYLFFISFKLRSKFNTKNIL
    IN

    >gi|66810357|ref|XP_638902.1| hypothetical protein DDBDRAFT_0218542 [Dictyostelium discoideum AX4]
    METMDTSVDLPGRWIDIEKIIKRTGPFASPSFEPDTKASPNIMNGLQNDFKVLVIGAGGLGCEILKNLALSGFRNIDVID
    MDTIDISNLNRQFLFRRKDVGKSKAEVAAAFINSRITGCNVTPHKCRIQDKDEDYYRQFKIVIAGLDSIEARRWINGLLV
    NLVVVNDSGDIEPDTIIPLVDGGTEGFKGQARVILPKISSCFECSLDAFPPQVSYAI
    CTIANTPRVPEHCIQWALLFGLQ
    DATLEKPFDPKQFDNDNPDHMNWLFECAKKRAEKFNINGVTYKLTQGVAKNIIPAIASTNAIIAAACCNEVFKFCTDSSG
    YLNNYMMYNGLNGVYTFTFEYEIKEGCAVCGTNLVTFEIDKSNTLSTFLEKITTDSRFQFKKPSLRSNGRNLYMQGLLHQ
    STVPNLEKTLSELNVQEDDEITITDPALPGNLAVRMRIKYTS

    >gi|66810157|ref|XP_638802.1| hypothetical protein DDBDRAFT_0218552 [Dictyostelium discoideum AX4]
    MVEIKDKEINNNNNYSKKIILAVGGVTVGSIFGYALQKGNVYLPSVIQGQMNFTNFTMLKMFMTASLTSSLAITFLKSQK
    LIVLEKSSTMYKRNIIGGFIMGSGISLTGACPGTVLAQIPQINGTLWTLLGGVVGATLFGFVNSYISKLLPSTQPTSKSS
    TTVYEKFKISMSKATIPFSIMIALVLYLIESKFPWQVDSGVSKSISIFGSISESKVWSPYVAGITIGLLQIPSFLISNTG
    LGCSSAYVTVGSKVCNAVSCTVDYFKSFNTTVRSIYGPLLNLGIIGGAYLASRSNPAPLIEQLNNQSTLNHFLGGFVLLF
    GARLNGG
    CTSNGLTSMGKLEFSSFVTMASMFAGGVLTSYFLNK

    >gi|66809993|ref|XP_638720.1| hypothetical protein DDBDRAFT_0218568 [Dictyostelium discoideum AX4]
    MGDYIQLEVLDKKVEEFPDGASIPKEKKAIFSVQGMTCSSCVGIIESFVSNVEGVISIQVALLQETAEVKFNPLILSEDD
    IVEQISMVGFEAKHLVQAENNTIVLNIGGMT
    CSSCVGIIENYVSNVDGVIECRVNLAMETARVVYDPDLTGVRDIIRNIE
    DVGFTAQIPSQNFDDTKNIQKEEAEKLKKNLIFSTFFTVPVFLIGMVLHKISFFNFLYTNNILHGISYADSIMLCLTTPV
    QFLVGKRFYVNGYKSLKHGGANMDVLVALGTSCAYFYSLMVLLMDYTSEDGGSTVGMKTFFDTSASLITFILLGKYLEVI
    AKGKTSEAIKKLMGLQATKALLLTIDQNEGGGGGGGSDNKTTTTILEEREIDIDLVQRGDYLKVLPGSKVPTDGIVVSGL
    SHIDESIITGESLPVSKKSGDKLIGGTLNQKGVLVMKATRIGGETSLSQIIKLVEKAQTERAPIQSLADKVSGYFVPSVI
    TLGLLTFIVWLIAGSSGVASDYIKASNSSVFQFALRNAISVIVIACPCALGLATPTAVMVGTGIGAQNGILIKGGSHLET
    AHKISAIIFDKTGTLTTGKPIVSNVNIFGNLNNNNNGNNNSGKINKKTFFQMVASAEAASEHPLAGAIVNYAFEVCDVQS
    TTPPLSFESITGSGIRATLAPNNIEIMIGNLKWIKSEGISYDPTLTISPDRSINNNHHHNDDDDDDEGTLSHIEDQVRRL
    ESDGNTVVYVVIDRQLMGYIAISDQLKPEAHATITELNKMGICTWMVTGDNPRTANAIAQQVGIDQVFAEVLPSNKSKKV
    MELKKMGHTVAMIGDGINDSPALAEADVGIAIGAGTDIAIEAADIVLVKSDLRDVITAISLSKTTFNRIRFNYLWATLYN
    ILGIPLAAGLLIPFGISIPPMMAGLAMAFSSISVVLSSLHLKTYQKPDIPIHSRTTEETRQRIHKEQSQLFKKNKIIFES
    SPTISSKSNNKIEKLSLLSDHDNIV

    >gi|66809391|ref|XP_638418.1| hypothetical protein DDBDRAFT_0186206 [Dictyostelium discoideum AX4]
    MIRSIFKKNSSLPYFLKRSFITKPHSIITPIINNNNHNNNNINTPIKNIQSFNFKFFTTTTTSNPIHQQTTTTTTTTPST
    EQQQLSKEAEEINENITKYNITLTDSCVKELNSVQKKSDSTDIFLRVMVDMGG
    CSGYQYIIKVENKLQDDDVLFIRNGAK
    VIIDKISLEMMEGSIIDYETALMRSSFVVASNPNTIKSCGCKISFELKK

    >gi|66811528|ref|XP_639944.1| hypothetical protein DDBDRAFT_0186269 [Dictyostelium discoideum AX4]
    MLKSLNFINRVTVSSLSKTRNFTSQVNKETWDKYVASNKKPVVVDFFATWCPPCKQLEPVLVKAVEDYGKCDLYKYDISE
    EEGFHEKFGIQSIPHVIGFHNNKIVFEFKGAIPASQVKKHLEKFDEHLGEK

    >gi|66809165|ref|XP_638305.1| AhpC/TSA family protein [Dictyostelium discoideum AX4]
    MTKLKVDDQAPDFSGIDQNGKNISLSQFNGKPLVLFFYPKDDSKTCTNEACEFRDKYSSFVNAGADVIGISNDDPESHAN
    FISKNSLPYTLISDKDGEIAKKYGVHKELLFFPGRTTFILNKDHKIIGTHSSLINASSHIQESLKAIDHLKGGTPVH

    >gi|66808687|ref|XP_638066.1| phosducin-like protein [Dictyostelium discoideum AX4]
    MGLGKTEWEDIQIKYGNMEAPPKQLTEDELFDLIKEAAEMATEAEKNEKLENASLKDLKDMEDDEDEDVLEQLRKKRIQQ
    MKVEAELNKFGELKEISEPSYKSEVTECKGVMVVVHLFKNGIPQ
    CQLVNQHLTILAKKFKATKFVKIRSEEAIHNYPDKN
    LPTILVYFNGDIVGQIITLRATGGDATTVNDIEWQLKQAHAIKSDLQEDPRITLARKKSQKSRYSKADSDESDNSDSDD

    >gi|66808689|ref|XP_638067.1| hypothetical protein DDBDRAFT_0218719 [Dictyostelium discoideum AX4]
    MSVKSVIKVGEKVPMDVTLGKALPPVDGVCAMAPKVLSGELFKDRKVVLFAVPGAFTPTCSAKHLPGFIEKSEEIKKKGI
    SEIFCIATNDPFVMSAWGKDVNAGTAVTLLSDGNSEFTKKIGLEMDGKAFLLGEDRSQRYAMILDSGVVKHLAVEEGGKF
    DVSSAEAILKQL

    >gi|66808011|ref|XP_637728.1| hypothetical protein DDBDRAFT_0186950 [Dictyostelium discoideum AX4]
    MNNTSSSSTTKDGISTKPPIHTAGKVEIHQETSTIMKARLIQHILQTYYLLNFIFLLAYPILRLSGLILKPKNELMILYV
    SGFMVVLKILKNKNIDQILTGIIFTLKMSTIILLYYSGETQFKLEYTNKMKSNNIDGSSSSSSEETQEPFKFDNENENSK
    QTLSSTKELGFFGNFLHYGLYYVLVYLFVCMLVYLYKSQPEPKQSNFVHFFNQITFKNSLAFSAQSKELKDKYLLVEFFT
    TWSPP
    CTYLASTFADLSYIYQGINFGKIDIGRWKSIAYEYDIADSVSSKQIPSIILFKNGVEVSRMPYRKNEFKMPYDKK
    TPKDDKLFEPCNLSYDNIRLYFNLDTLLSQVKPSLTNQNQNQNNNNNNNKNGNSNKNTKKNR

    >gi|66807195|ref|XP_637320.1| hypothetical protein DDBDRAFT_0187374 [Dictyostelium discoideum AX4]
    MYKEPKNESEYEAELKNAPVAVVYLTATWCGPCRAIAPVFTNISNAPENSKITFFKVDVDALKKLPVCESLQGVPTFIAY
    RNGEEQERFSGANKVALENMVKKLL

    >gi|111226408|ref|XP_001134530.1| thioredoxin [Dictyostelium discoideum AX4]
    MSKVTNVSINTKLDELLKGDQVIINFGAEWCACKVLEPIFNKLSTQYPLVTFLKVEIDKINVHESTKSITSIPTIMLYQK
    GKKTKEIVSPNETQLRKILDSMK

    >gi|66805669|ref|XP_636556.1| hypothetical protein DDBDRAFT_0188144 [Dictyostelium discoideum AX4]
    MNKKTIICFCIALSILFFSLIIDSHNTVKTKDTVDDCCCKKSNIDKSNDKEINVLLNKIVKTRFFKYFKANLFSECPFWV
    VTAL
    CGSEGCGVCECDDNEIPLPWRIEDTTSDKVDMSPPPPGFQKWKDKKDDMWVVVAGPDSESTYVDLSKTPESNTGYD
    GSSVWSAIYNENCFHRPVDQMCLEERVFYKLISGLHSSITIHIALFYNQDKTLSTYDSNGNEIEPHWEHNSNLFKQRFAN
    HPGRIENLYFTFLFILRSIGKLNHFFTDYQFNTGNQLEDQKTKELVQQLLQTKLMCQPNFDETLLFKDTYDKDNLIGQFK
    EHFQNISSILNCVTCEKCKLYGKVQTMGLGTALKILFDDNIQSIQRNEIIALFNTLRQLSNSIHGIDTLNTPYNQSRLTY
    LYKELIQIWNFIKPLFGIQSFSSSSSNNNNNNRNNKGISGLDGSNSKSDPSSPFSISNNTHKPIASLIILSLILLLSILF
    ITKSLCNKFKSKNNNNNNKKELNFNNNSNNNIDNNYKNKINNNNNNNNNNNNNNNNKLEETKQTKNKKTKKLE

    >gi|66804699|ref|XP_636082.1| hypothetical protein DDBDRAFT_0188545 [Dictyostelium discoideum AX4]
    MTINQLIVIGGGIAGLTCAESYSHLKPNDKVTILSCSPILKTVCNVQKISKVLESFEVFETQFTDIEFKNPNISVIICDV
    DSIDINNRIVKTDKGNFKYDYLSICSGAKPNLVKESPYLIGIRDTETIVDLKNRLSNAKRIVIVGNGGIALELIHEIKNC
    QIIWSIKDKHIGNAFFDKDAADFLFRSKQIIDDDNHDKKNVVKEQQQQQQKDGILLNEDELIAKNQNISSQSNSSLYKSE
    SGSALGPQWYSKYNFKTTDQYNKNNQEKKYNFNENVNIQYSTFLDEIYSNHDKKLNQEIINNNNNGDGDDKEDWPIYVKL
    SNGNLFGCNFIISATGVIPNSTILTKDNNNNNNNKIIKLSNEGAIIVDEQMKTSVDRIYSAGDVCSIEWSESEVWFQMRL
    WSQARTQGRYTAQCIANESVKNTPQQDNLDQICTNFEFELFAHATKFFGFKVIMLGLYNAQGLNLNLDNNNQNEENQDNI
    KIYTREIIGEQYVKVILKNGRLIGSLLIGDTDLEETFENLILNQIDLSGYGAEILNPEIDIEDYFD

    >gi|66804263|ref|XP_635914.1| hypothetical protein DDBDRAFT_0188682 [Dictyostelium discoideum AX4]
    MDKVKALIKAHKLIIFSKTTCPYCISVKDLFKKLKVVPFVVELDLESDGSELQSAAGQISGVRTVPQVFINEKFIGGCDA
    TTKLHSQGKLIPLLQEAGFL

    >gi|66803030|ref|XP_635358.1| hypothetical protein DDBDRAFT_0189260 [Dictyostelium discoideum AX4]
    MKRFLFNLKTTTFQRSFNNRLLFPINNIYISNNNNNICINLNNNNNNNNNNNKRHYCNNKMNLSEDEWRVKLTPAQFKVL
    REKGTERPDSGEYNKNYEKGVYNCAACDTPLFKSEHKFSSGCGWPSFYDSIPGALVLHEDPSLPGRPRTEICCAKCGSHM
    GHVFKGEKFNTPIDQRH
    CVNSISLKFLPKK

    >gi|66802500|ref|XP_635122.1| dihydrolipoamide:NAD oxidoreductase [Dictyostelium discoideum AX4]
    MLRINRISNLRTFGQRFFSTEQQDVVVIGGGPGGYVAGIKAGQLGMKVTVVEKRGKLGGTCLNVGCIPSKALLNASHLYE
    EATTKMSKYGVKCSGVELDLGAMMQYKDKSVSGLTSGIEGLFKKNKVKYDKGFGKITGPNTVEVTLNDGSVKTIETKNIV
    IATGSEVTSLPNVNIDEESIISSTGALALKSVPKKLIVIGGGVIGLELGSVWSRLGSETTVVEFTNRIAAGADGEVAKKF
    QKSLEKQHMKFHLETKVTSVVKKSDGKVTVTVEQVGAGGFTGTLEADAVLVSVGRRPNTSGLGLESVGIPTDKAGRVEVG
    DHFNTKVPSIFAIGDAIRGPMLAHKAEEEGIAIIEQIHNGGGHVNYGAIPSIIYTHPEVAWVGKTEEELQKEGIQYNIGR
    FPFVANSRAKTNDDVEGFVKFLAAKDSDRVLGAHIMGTNAGELIGECVLAMEYGASCEDIARTCHGHPTLSEAVKEAAMD
    AYDKPIHM

    >gi|66802668|ref|XP_635206.1| protein disulfide isomerase [Dictyostelium discoideum AX4]
    MNKFLALLFVLALFANIAFSCEGHPEHDHGDGDHEHDHDESFVKILDSDNFHNSVSEHDVTLVMFYAPWCGHCKTLKPLY
    EEAAKQLSANKKIAIAKVDCTQHEQLCKQNKVQGYPTLVVFKNGKAEPYEGDRTTKSIVQTLEEELKPTISTLESNEDIE
    EFKKQHPISVVGFFDNDHDDRFKLFSELAGNNKKSAKFAVVIDKDFSKEHVESTPNVVLFRSFDEPTVAHKGEFDSESLI
    KFIKGNSVPLLGEINRNTYKKYESIAVPLAYLFIDSTQDNTQVLEDVKKIATSQKGNAVFCWVDMKKFPQQATHMGLSGK
    VVPAISVDSVANKARYNFDEKETFSFDTVSKWIQDVIGGKVSPFVKSQPEPESNDAPVKVAVGTTFKKLVLDSPKDVLVE
    FYAPW
    CGHCKNLAPIYDKLGEYLKDVESVSIVKIDADSNDVPSDIEIRGYPTIMLFKADDKENPISYEGQRNDHMNFVEF
    IQDNAAIEFKLPSSQTDDNVESKKDSSAKHDEL

    >gi|66802330|ref|XP_629947.1| hypothetical protein DDBDRAFT_0184083 [Dictyostelium discoideum AX4]
    MLKSLIININKSSVTSNNISKFSKVNQINRYFSSKMTNVGDRSKLFVSPKWLKENQNNVKIVDASWFMAHEKRDPRKEFV
    DKHIKSAKLFDIDEICDKTVSLPHNLPSEQVFEKEMKRLGITNDDHIIIYDTRAQYVASARVWWTFLIFGHSASKVSLLE
    GGLPAWEREGYPVQSGPIENSNNDESKTYKSTFNNDLVKNKQDILSNLQSKEYQLIDARSADRFWGRVDEPRPGLLRGHI
    PNSLNIPWTDLIEPVANGGHGGFIPNDKVLTTFKEKGVDLSSKIATT
    CGSGTTAAVLSLGLYKLGYPLAPIYDGSWSEWG
    LPVNKLPTSCSNN

    >gi|66801455|ref|XP_629653.1| hypothetical protein DDBDRAFT_0184429 [Dictyostelium discoideum AX4]
    MIYIILSGIQMIKSQREFNCICGDNQNGVAVIGVGFKIPSDQENCLSSPSELYSALLNEFDGVKNDTSTRWSDNYFKNGD
    IVSNSAGLLPLKEIKSFDPTFFGINPSDTDLIDPQQRLLLKCVWNALEDGGIDPISIRSSDTSVYIGCSNIDYYLLNRNL
    IDPHNHGIQTAGYSIPNRISYCFDFRGESLFVDTACSSSLNAVHLGYNSILNSKSKLSIVGGSNLILVFFFSKQQVNGPS
    GKCNSFSEEADGFVRSETVGAIVLKNLKDAIKDGDRIYCVIQGSNSNVDGNYEKLNYISPSKLSQAENITKALKSTNGTV
    NASDIDYFECHGTGTPIGDPIELEGISIALNRTEQSTTLSNPLLIGSIKSNIGHCEASSGMASLIKCCVMFKYRQFLPNI
    NFKTPNPLIKFKEWNLKVVTEPVPFNNNKQTIMAINNFGVSEYKNNNNNNNNNNNNDFKATTNLKSKKFIIPFSPNSSTS
    LDNYKSLLSNLSNETNNFQNFVIKQINNKSTSLNQRSVIIASNWSEFNESSNEIQSNIKKSIISNITIKKKNAVTVFVFC
    GQGSQYNKMVLSLYENEQVFKSTMDELDKELSKHYGYSILEKLRSITDNDLVTIHQPILAIPVNVMVQVSLYELYKHWGI
    KSDIMVGHSFGEIACSYCSGMVDFKTLCYLTYHRSVAQNKTIGSGKMLSINIGAKEYLDSDSTKYPSVEIACYNSETSIV
    IAGNEELLNEISKDLKSKDIFTSMLPSLSAFHTTHQSVIKDDICSLNFKSTLSKIAVFSTVTSNQFGINNNNNNQFNSNY
    LFQNVIQPVKFSETISNIYKYIESNDMGNEIIFIEIAPHQTLQYYLNQMKSQQSEYFNNGEKISIYSVCNKKKNDYNEFL
    KTISTLFVNGYNNINFKSQIINNNNNNNNNNNFNLPLYQWDDNEYYKIHPTWKKANKNGPSINHLGNLNDSSIKSFKTYI
    NTRKPQFQWLKGHSLKGKVVFPGMGYISNLLSVYNMNQDITINEIQFKSAFILVNGVNNCLETSIIPLTKNEFNIKFHFK
    DLKTNKWVLCANANYSLFKHNQNNDNKFDIEKLKSNCNYTIISKDELYNNIRAKCRLTFKGLFQGVKEAFIGNRCSLTVL
    SLNEIENQQEFKHLLENRNFNSLFNTAILDSCLHGSLHSNEQAQFYFDKCEGFKYYSNNINLATSKIDEYKEIYVYNETN
    PVINSTLFASLKIMLPDGTLLIEIQKVVFKSSITIIDSTSVIQPSPKDLHTPYYQPKDSLIKPPQSFKHLHCMKEFTSME
    SDNIEMLNMSIYHLMFRVINARSPTKINLESLENLTLDQFKELLKDCAANIQRSNQFIYECLKLYHTNYSNYKINELEDF
    IKQSEDFNGYNQIIFKAIKIYAKLFPLPDDDPFTDTIQSLFKDDQLESVYFHSKHLYPVNNLLSEIVFQSIKPIINQTST
    FRILEIGAGYGSISQLIFDKLEQLLADNFTSSRIDIEYTFTDISNTFLSKAKERYSKYKRFNIIYKLLDLELPLTEGFQD
    FKPKYYDIVVMSMVLHVVKDINFSTNEIYKVLKQNGQLIFVEPTYKNLYIDTILGIFPQWWSFNDDIRTDRC
    CLEPSKWF
    EFLETINFKDTIILGQDNKEILKNFENPIILVQTRKPSQLELSINNSPSIKQFKSFENIILYTDDNQQRNDCSEIIDLLK
    SFELPIKIINKINQFKQFIKSQSNKNNNTINNNLIIFLKSVNQLNINNYEDITFEYVQINQILVKLELEENYKLILLTNN
    SQSISLKLDIISIDFDTVSIKNHQNVISVINHLLDSKDNSEREYYIINNEINIERYKNESNIKHQLKSKTFQENKDELIV
    QLDSNLEYRLKSKSKQELKSTHVEIQVKAIGINYKDYATYSGLIDSIIEIDKDKEKDENYDPNYPSIGNDFSGIITRIGN
    DVRKFKVGDEVCGLAPKTSASHIIIEEFHLCKKPSNISHSEAASSVTVYTTSFQSIYSIGDLKKNETILIHSGSGGIGLS
    ALEILKWKNHQGYIFATVGSEEKVKYLTDTYGSFITGIYSSRDKNYQDQIKEKLKSLGCDIDHQGVDLILNTLSVEYMDS
    NFKC

    >gi|111219493|ref|XP_001134491.1| thioredoxin [Dictyostelium discoideum AX4]
    MSKVIHVTSNEELDKYLQHQRVVVDFSAEWCPCRAIAPVFDKLSNEFTTFTFVHVDIDKVNTHPIVKEIRSVPTFYFYVN
    GAKVSEFSGANEATLRSTLEANI

    >gi|66800491|ref|XP_629171.1| hypothetical protein DDBDRAFT_0191909 [Dictyostelium discoideum AX4]
    MNKLFTSIFALFLLVCVAFSEEKTTVVQVTSDNSDIIPTGNWLVEFFAPWCGHCKRLAPVYEELAQLYNVDIENSKVKIA
    QVNCVDNQSVCSKYEIKGYPTIKYFSEGEIKDYRGSRDKNSFITYLDSMSKSPILNIESKEQLKEKLKENKVSFIFISSG
    SETKDKEILSGYKIVTKQIQDVDCPNFLVVMDSSIIDGSGGADDHVIPSSSISGKVGEEPILLVYKDNEYQQYQSNNEHG
    LSVNQWVRINQFPLISELTFSNQHMLTVSFKKIVMFVFTKKPTTENIQHMKSIASSKQFKSNPTEFGFTYIVENTFASWI
    SNFKLERTPALLVFPEKMDIYYYEESIDPLDKSSVLQFLSDVNNNKYSLKYLNRLGYYLDRIEEFMVEYLYYIVGLIIVI
    PILLFFVCSGESKEKDQ

    >gi|66800019|ref|XP_628935.1| hypothetical protein DDBDRAFT_0229820 [Dictyostelium discoideum AX4]
    MNCINNYNNNNNNNNNNNKIMIPDLKNNDTGSSADDGRSEGVADYQVYGFYTSCSFKVYFMFEELNIPYQTCLVNIRSGE
    HFKGEFAEMSPNNKIPMLIDNTYSVDSGDDDEPLKIFESGAILLYLAEKYQKFLPPLSKPKERCQVQQWLSWQISEMQPA
    LTSYVYYFMMAPEPVAFGMEKADQDLHKILKVLDKRLDDGRKYICNEFSIADIACFGFGSYFNLNVFKGWNKYENVVRWV
    NTMSSRPSISKLLPIVEQTLRVRKLKRLDNQELVL

    >gi|66799993|ref|XP_628922.1| phosducin-like protein [Dictyostelium discoideum AX4]
    MSENNTNNGLDEDFDDDDELAKIREQRMKQLKEESKLKQSFLSTHGELKEIDEQDFLKEVTGTDNVVVHFYHSDFQRCKI
    LDKSLEILAKTHLGTKFLKVNAEKAQFFTGKLGIRILPTLVFFSNGIAVDRCVGFEEFGGIDSFKIEQLAIRISKAGVLD
    FKHTTGLKIISKQDVKNNKFKEDD

    >gi|66801027|ref|XP_629439.1| phosducin-like protein [Dictyostelium discoideum AX4]
    MEQNILNSILDKFGDGDQERSDIRHNDSGDENDNHSDHEGNHGNNECCEGNEDGDKEYEVDVEDMTDEQYAQFIQEQQEP
    KIKSGGNTGVKGVLSDYAEHREKQKQKYLQKKYETQKMLEKMCFTTRDQPPPTEEENQLDSDDDDLERIRKARMEQWKSK
    QQITSDVKKPEKKVFGYFKQIDSSQYIHEIDNEPPNVFVIIHLFQNYIPE
    CVLLNQQLGQLAVKYRYIKFLKILSKEAKE
    NYHDEALPSLLVYIGGKLLVSFVPLTEELGRNFDQEDLELLLSSYDIIPNPMKAKNSNWETSLSRKRPESDDDNDD