D rerio

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|292609380|ref|XP_002660373.1| PREDICTED: chloride intracellular channel 4-like [Danio rerio]
    MAWFDVAAKKLGFPSIELFVKAGSDGESLGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQDLAPGTNPPFMTFNGE
    VLVDVNKIEEFLEERLGPPQYPKLATKHPESNTAGIDVFAKFSAYIKNPRKEANEGLEKALLKSLKRLDEYLQTPLPEEI
    DADSLEDPGASTRSFLDGDELTLADCNLLPKLHIIKIVARKYRGLEIPAEMSGIWRYLNKAYQREEFINTCPADREIQFA
    YLDVAKKIK

    >gi|94158182|ref|NP_001035331.1| protein disulfide-isomerase-like protein of the testis [Danio rerio]
    MKVDVTLRLIVCLFLHQTLAESQSNSIVEDKDVLVLTKSNFHRALKQHEQLLVHFYAPLSGQSLGSILEFREAAGALKEA
    DSDVKLGGVDVKKEKELAESLNITTLPSIRLYLSGDKNNPVYCPVLKSSASILTWLKRRAGPSADIISNVTQLENFLRRD
    ELVVLALFKDLEEGAVKVFYETAADVADLPFGVTRHHEVFSKFEISRDSVLLIRKSKLDQQFEMESSTVKTDLVHFIRLY
    EMELVTEYNGVTASKILNSVILNHLLLFISKTEGGFEEIYNAYETTAERFRGKVLFVLIDVSELRNGRMMEYFHVRSEEA
    PQVRMVNLSNNLQYQLPSDQFDTHTLMEFCLNYLDGKVKPKMQSEPVPANWDTQPVKELVGMNFEKVAFNHNNNVIVLFY
    APWNSE
    CRALFPLWEELADHFSQTQDVVVAKIDITANDIHLHLGEKYPSIKLFPALYSERVIPYSGKRKLKPIVTFMKIE
    IEKAKTDKAKEEQRRKKYLEDQKAAQKEEL

    >gi|292609479|ref|XP_002660409.1| PREDICTED: malate dehydrogenase, cytoplasmic-like [Danio rerio]
    MAKFVLAGKADCPYYAKAELLADVLQRNLPDFHIHKIPVPPDDWKKWLEDTCASIGWKHSSSPLVWRELIDRGGKGMLLG
    GFSDFLEHAQGYYNITSDMNSDLMLKIAEENQATKELCMEEEVHRLKSLRPLHIWISSALNPVCYSLIPHLFTPGLFSGL
    PIFSLHLMDTSGSEEMLQALKMETVDLAIPRLHEPAGEYNDEQNDKDQVAEHFHRYGQLIETNAQKDVRVLVAGDFFINM
    KCSLLIENAPSIDPRNFVAMTTQLEYEARTQLAQKLSVKTSDITNVIVWGNISGSFHIDLQRAKVFRYDGAIRGPDGFSQ
    HVMEMIYDWKWLKTDFRSLLHKHRATISSKTNKATAISTTNAILAILKAWNNAESPEEVFSLGVLSTGQFGIPAGLVFSM
    PVSFTDGHWSVRSDVIVTDELRVNLDACADELRMERDMAAKTLKNDA

    >gi|41054920|ref|NP_957342.1| protein disulfide isomerase family A, member 2 [Danio rerio]
    MRFLHILALGLLVCGLCARADEENTEEKSEEKAEDNSEEDTEPEKPEKTDEITEDKDVLILHSVNFDRALSENKYLLVEF
    YAPW
    CGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTLKFFKEGNRQNATTFFGKRTLKGIKRW
    LEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVKTDSLVLFKK
    FDERRADMPLSDETKLDKGEMISFIHSNSMRLVVPFNE

    >gi|66472628|ref|NP_001018396.1| tumor suppressor candidate 3 [Danio rerio]
    MLAEKVEQMMEWSSRRSVIRMNGDKFRRFVKAPPRNYSVIVMFTALQPQRQCSVCRQANEEYQVLANSWRYSSAFSNKLF
    FTVVDYDEGADVFQQLNMNSAPTFMHFPAKGKPKRADTFDLQRIGFASEQLAKWIADRTDVQIRVFRPPNYSGTIALALL
    VSLVGGLLYLRRNNLEFIYNKTGWAMAALCVVFAMTSGQMWNHIRGPPYAHKNPQNGQVSYIHGSSQAQFVAESHIILLL
    NAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK

    >gi|125803426|ref|XP_695755.2| PREDICTED: ubiquitin-activating enzyme E1-like [Danio rerio]
    MKQSIHFWHKSTLIVSEQDLKEEHLDTPSPLPTMADSMDIDDSLYSRQRYVLGDSAMHQMAQSTVFVSGMGALGVEIAKN
    IVLAGVKAVTLHDSKRCEVWDLGTNFFIREEDVNNQKKRVEAVHSRVAELNPYVQVTMSTDVLDESTDLSFLKRYQCVVL
    TETKLTLQKRINHFCHTQQPPIKFIGCDVFGICSRVFCDFGETFEVSDPTGEESKEIFIQNISQGSPGVVTCMDSRTHGL
    QTGQSVCLKEINGMTELNGTMHQITVLSPYTFAIGDTSSFQPYTHGGFFRLVKIPKTFSFEKMEQQLSDPRLLTPDFSKP
    EVPLQLHAIMLALDAFLEQHARLPNIGCLQDSELLLKYTEEISKTLKNKVCINPDLVRCVSRCARGCLFPLAATVGGIAS
    QEVLKALTGKFSPLQQWFYLDALEVVQPLQSLPAEEFSPRGDRYDALRACIGQSLCLKLHKFQVFMVGCGAIGCEMLKNL
    ALLGVGLSRFLGEICITDPDLIEKSNLNRQFLFRPHHIQKPKSTTAAEASLEINPELQIHAHLHKVCPATEDIYSDDFFS
    RLNVVVTALDNVEARRYVDSRSVSNQKALLDSGTMGTKGHTEIIVPNLTESYNSHRDPPEEEIPF
    CTLKSFPAVTEHTIQ
    WARDKFESAFAHKPSMYNMFWQSHSSAQSVLQRMMGGESMEGSFQVIKLLSRRPTQWDHCITLARLKFDKYFKRKALQLL
    HSFPLDTRLKDGSLFWQSPKRPPSPIDFDLSDPLHFGFVVSAARLFAGIYNIPYSEEQLSYEDVSRVLAEVDVPEYKPAE
    KHIETDETVKKPDQLKITVSSEEEREAISQLQEAINSNLVTPERLCMSPLFFEKDDDTNGHMDFVASASALRARMYAIEA
    ADRLQTKRIAGKIIPAIATSTAAVAGLVSMELIKIAGGYGFELFKNCFFNLAIPVVVLTETAQVKRTQIRDDISFSIWDR
    WTIFGREDFTLSDFISAVREKYGIEPTMVVHGVKMLYVPVMPGHNKRLKLTMHKLIKPSSGRKYVDLTVSFAPEVDGDED
    LPGPPVRYYFSGENESSETA

    >gi|89886347|ref|NP_001034928.1| arsenite methyltransferase [Danio rerio]
    MADAARDRTVTSVYNDVKEYYGKTLKQKSDLKSNACVPSAKPVSAYVRKVIAEIHPDVVAKYYGCGLVVPECLEGCRVLD
    LGCGSGRDCYMLSQLVGEKGHVTGIDMTEAQLEVARNYIDYHMQRFGYKNPNVNFVQGYIEALVEAGLEDKSYDIIISNC
    VVNLSPDKSSVLREAYCVLKDGGELYFSDVYSDARIPEHLKANKTLWGE
    CLSGALWWEDLIRLAEEVGFCKPRLVSASII
    TVGNTELESILGDYKFVSATYRLFKLQKGLEKKPCLVMYNGDITDSEESFEFDAQYAFKVDKVMEVDGDVANILRNSRFS
    EEFTFQPQGVNTASSGGCWAKPNAVSVNPFELVQQLGSASVSPSTGGCCAGQESCCN

    >gi|41053339|ref|NP_956317.1| hypothetical protein LOC336637 [Danio rerio]
    MIVVIEDQDGFDKALAGAGDKLVVVDFTATWCGPCQSIAPFYKGLSENPDYSNVVFLKVDVDDAQDVAQSCEIKCMPTFH
    FYKNGKKLDDFSGSNQTKLEEMVKQHKN

    >gi|50539996|ref|NP_001002468.1| peroxiredoxin-2 [Danio rerio]
    MSAGNAKIGQPAPQFKATAVVDGQFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSERAAEFRKIGVELIAASTDSH
    FSHLAWINTPRKQGGLGSMNIPLVADLTQSISRDYGVLKEDEGIAYRGLFVIDDKGILRQITINDLPVGRSVDETLRLVQ
    AFQHTDKYGEVCPAGWKPGSDTIVPDVQKSKEFFSKQ

    >gi|292610375|ref|XP_002660719.1| PREDICTED: thioredoxin domain containing 11-like [Danio rerio]
    MLRRVRAELRQAVNQMARRPVKILCCGAVLLTCALLLPITLTCGRVKSVVSPARPPMRFFPAEAPVLDLFLGQLEEADRL
    REEADVSVLFFYAPWCAHSITARQHVQQVALRLADQVQFLAVNCWWHQGRCRKQKSFFQYPVIHLYYRRFGPIEYRGPVR
    SDYLESFILRVCAPLVYLPTAGALHSFLTQHQQGVVGYFRFSWSPQPAGYLTFLLSALHALRRDHQGAVRFAVVTNQAVA
    EGVSLREDESVYLHRRLNSSLVFPRAQRNFTAQAVSDWVLENKESVVYWIQPTRAKSYSLEAELQKGPALLTFLPHNPLT
    ANQLLDQVSAVALLYQSGCGSSAPRLCCQCVPVCASSGVCEVCVQRSVCSGLHQSLQRLQSSASCWSVQSSYTPSGRLSV
    CCGASVCRGGASVCSGASISGLQCRSNRTLRFYMLDAELHRPLAHRLGARGGLHRPFITIINLRDETHHVLEPSGTLEGF
    IQNFSVPYSPLRRHLVGQEAPQQTQSLVQEVTSDSFLQTVMDSQRDVLLLYYSAW
    CGFCSVLNHVFLQLGRLFRGNRALT
    VARVNVGRNDLPWEFMVDHLPTVLFFPRHRKQMSVKFPENTPMTVPNLLRFVLQHTGHAPWEEQQSGEGEEPVRGEESVS
    LLGAELRALQQEVFSLHRVRERVSQQLDVLWRENRRLTLHTHTLQSQNQELQAQIHQLEALYREKTHQLTHTVHRLQELA
    DASEELLKENTLLKVLLTALSDADHRQTTEDRQTTDHRQATEEHDENTHAEDESS

    >gi|61806512|ref|NP_001013489.1| peroxiredoxin-1 [Danio rerio]
    MAAGNAHIGKPAPDFTAKAVMPDGQFGDVRLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDAAEGFRKINCEIIGASVDS
    HFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLV
    QAFQFTDKHGEVCPAGWKPGKDTIKPDVNQSKDFFSKQN

    >gi|119672905|ref|NP_001018660.1| thioredoxin domain-containing protein 12 [Danio rerio]
    MPSSVLNIALVSFIQFFIASHFVEVSADGNGRGFGDHIHWRSLEDGKKEAEASGLPLMVIVHKTWCGACKALKPKFAESK
    DISELAHNFVMINLEDEEEPKDEAFSPDGGYIPRILFLDPTGKVHSEITNKNGNPNYKYFYSNADQVVASMKEAQEKLTG
    DAFRTAHVGDEL

    >gi|292610633|ref|XP_682823.4| PREDICTED: phosducin a [Danio rerio]
    MSESPEIEELPATQTGPKGVIHDWRKFKLESEDHESIPSNKRELLRQMSNPKSSDDPREKVNRKMSVQEYEMIQEEDEQC
    LRKYRKQCMQDMHERLSFGPKFDSVFDLESGEAFLDVIENEHRLTLVVVHIYEDGIRG
    CDALNNCLTCLAAEYSTVKFCR
    IRASATGAGERFSEDVLPTLLVYKAGEMLGNFLCVTKHMNEEFFATDVENFLNEYGLLPEKEFAASPDEEENADVE

    >gi|30231240|ref|NP_840079.1| selenoprotein 15 precursor [Danio rerio]
    MAGEVYLLWLLPLLQGLASYGAELSSEACRELGFSSNLLCSSCELLGQFSLNQLDLPCRQCCQEEAQLENRKLYPGAILE
    VCG
    CKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI

    >gi|54400616|ref|NP_001006057.1| interferon gamma inducible protein 30 [Danio rerio]
    MFGFNLCVVLVAVFSLSKCSARFVYSCKYPPSQWCSSEDIAAECGVLEQCMKYNSTKAADKVKVSLYYESLCPGCRMFLT
    SQLVPTLIMLQDIMEIDLVPYGNAQETQAQGKYIFTCQHGEDECLGNMIETCMLNKLGLDAVMVIFCMESGNDVLKSAQP
    CLGVYRPDVTWDSIMQCVKGDQGNKLMHENAVKTDALNPPHQYVPWITVNGEHTDDLQDKAMGSLFSLVCSLYKGQKPAA
    CTLGLKKNTNNYCMN

    >gi|66472638|ref|NP_001018393.1| thioredoxin-related transmembrane protein 3 [Danio rerio]
    MRNIILTALLSAIALVSGYVEGLDDKFTEFRQNELWLVEFYAPWCAYCHTFEPVWTEVGAELKSLGSPVNVGKIDTTAHT
    SIATEFNIRGYPTIKLFKGDLSFDYKGPRTKDGIIEFTNRVSGPVVRPLSSVQLFQHVMSRHDVIFVYIGGESLLKKEYY
    KAATEFIVHTYFFTASEEILPKAVTLQDVPAVAVFKDGTYYIYNEFIDGDLSSWINRERFLSYFQIDSYSLYQMGELSKL
    VALAVVDEKNPSEESIRYKTLMERVSTEYRDHYKSDFQFGYVDGNEYVNGLIMGELAMPSIIVLNMSIDGYYIPESSTET
    IEDLLQFLNSVLDGSTTLLGGNGFWQCAKRIFYKGKNTVMSMVETAPVFSCFVLGLPVGVVVLVIYATCTAVPADDEKPE
    EEATASPALDTHGKKAIESQPESTEKTSEAKKED

    >gi|45387703|ref|NP_991204.1| hypothetical protein LOC402938 [Danio rerio]
    MAFRLLARRVSRISVKDVRVLVLPSSSSSRSSFSSCFRAAPPLLSRSIPRLPYITSRSVSFNVQDHDDFTERVINSELPV
    LIDFHAQW
    CGPCKILGPRLEKAIAKQKGRVTMAKVDIDEHTDLAIEYGVSAVPTVIAMRGGDVIDQFVGIKDEDQLDTFV
    EKLIGQ

    >gi|46048169|ref|NP_840073.2| selenoprotein X, 1 [Danio rerio]
    MSFCSFSGGEIYKDHFESGMYVCAQCGYELFSSRSKYEHSSPWPAFTETIHEDSVSKQEERWGAYKVRCGKCGNGLGHEF
    VNDGPKHGLSRF
    CIFSSSLKFIPKVKNEQQ

    >gi|35903099|ref|NP_919398.1| selenoprotein W, 2a [Danio rerio]
    MGVQIKVEYCGGUGYEPRYQELKRVVTAEFTDADVSGFVGRQGSFEIEINGQLIFSKLETSGFPYEDDIMGVIQRAYDGQ
    PVEKITKSQPPCVIL

    >gi|147906196|ref|NP_001082815.1| 3-mercaptopyruvate sulfurtransferase [Danio rerio]
    MAAQTRALVAARWLADAVKSNRVGPNLRILDASWYLPKMKRNPRAEFEQTHIPGASFFDIDECCDKSSEFDHMLPTKGEF
    ADYVGNLGIGNNTHVVVYDASDFGSFSAPRVWWMFRVFGHSSVSVLDGGFKNWLKEGHPVSQQYSKPAPVDFNASFKESW
    VKTYEDVLNNIKTKEFQVVDARANGRFRGVEPEPRANTEPGHIPASLNMPFPSFMDPESGLERPVEELTKLFQQAGVDLQ
    KPFWVT
    CGSGVTACHIALAAHLCGHPGVSLYDGAWSEWFTKAAPEHIISEGKGKQP

    >gi|147901598|ref|NP_001082855.1| FAD-linked sulfhydryl oxidase ALR [Danio rerio]
    MAAAHGSSPHSSAGMEGFPFPVAGKPPEDSTSNDQTTTGETKKKPCRACTDFKSWMKLQKQASSASVQESRPVEELKPVE
    CPLDREELGRSSWSFLHTMAAYYPDAPSTEQQLEMTQFINLFSKVFP
    CDECAEDLRTRLKTNRPDAGSRHKLSQWLCRLH
    NDINIRLGKPEFDCSRVDERWRDGWKDGSCD

    >gi|50344842|ref|NP_001002094.1| methionine-R-sulfoxide reductase B3, mitochondrial [Danio rerio]
    MSGFNLLHLVSQGQPVKLKACGLPSGTCRSKKTWPKTFPEEELRKRLTPMQYHVTQQKGTESAFTGKYVDNKEEGTYHCV
    VCGAPLFMSEKKFDSGSGWPSFFDLINKDAIAQTDDFSYGMHRVETTCSQCGAHLGHLFDDGPRPTKKRY
    CINSASLSFQ
    PKNSATEEVEASGAAGQSSASKNEEL

    >gi|292613542|ref|XP_002661980.1| PREDICTED: peroxiredoxin 4-like [Danio rerio]
    MDVSRCVKTPREWLGVLCALFLLSESVVCDGANGKREQECYNYAGGHVYPGEAFRVPVSDHSLHLSKAKISKPAPHWEGT
    AVINGEFKELKLSDYKGKYLVFFFYPLDFTFV
    CPTEIIAFSDRVHEFQAINAEVVACSVDSQFTHLAWINTPRKQGGLGP
    MKIPLLSDLTHQISKDYGVFLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKP
    GSDTIIPDPAGKLKYFDKLN

    >gi|190358395|ref|NP_001121885.1| apoptosis-inducing factor, mitochondrion-associated, 3 [Danio rerio]
    MGGCLSKPKPVEVKVELTLLDKEKEVDLMSPNGKASPFSECRPNGSLGHCSDEDSMTLRPQRKNRDYIEASVCHIKDLEN
    GQMREVDLGAGRALLIKEHGEFFAMGHKCPHYGAPLVKGVLSKGHVRCPWHGACFNIATGDIEDFPGLDSLPTFQVRVEK
    EKVIIRANKQALQTQRRSKVMSKCSAVINSSTGFSHVLIIGSGPAGLVCAETLRQEGFTDRIVI
    CTTDKHLPYDRPKLSK
    SLESTAEQLQLRSSDFFQMHDIEVLLEKEVVSVDVKTHTVTFRDGFKMEYRKLFIATGSRPKPLSYKGKDVGNVFHLRTP
    EDANSIVTLASSKNAVIIGTSFIGMEVAAALTDKAHSVSVIGIEAVPFRKALGEKVGKALMKLFESNRVKFYMLNEVWEM
    RGHNGQLKEVVLKSGKVLRADVCVIGIGSSPATAFLKQSGVHIDSKGFIPVNKTMQTNIDGVFAGGDVVTFPLGLRSNKK
    VNIPHWQMAHVHGRLAALGIMGKASDIKTVPYFWTAMFGKSIRYAGYGDGFDDVVIQGDLDELKFVAFYTKSEEVVAVAS
    MNYDPIVSRVAEVFGSGKTIRKRDVETGDMSWLIVKGSQ

    >gi|292613662|ref|XP_001338711.3| PREDICTED: im:7135991 [Danio rerio]
    MAAFSRGRQRVKTLCCFRTLILSRNFTAGKFDYDLVVIGGGSGGLACSKEAAQLGQKVAVLDYVEPSLKGTKWGLGGTCV
    NVGCIPKKLMHQAALLGTAVKDARKYGWQIPETLSHDWPTMAEAVQNHVRSLNWGHRVQLQDKKVKYLNMKGTLLDKHTV
    RAVNAQGKEMTVTARNILLATGGRPKYPTHVPGAMEFGITSDDIFWLKESPKKTLIIGASYVSLECAGFLTGIGLDTSVM
    VRSIALRGFDQQMSGLVTDYMETYGTKFHWKCTPKSVEKLPSGHLQVTWMDLNTKEEHQDTFNSVLWAVAQTTYQARKQG
    NKERVVESSREVLINGLWSALEDQDALGPQGHHIPCFVLSLRLFPARLSGQ

    >gi|156671213|ref|NP_840072.3| selenoprotein W, 1 [Danio rerio]
    MTVKVHVVYCGGCGYRPKFIKLKTLLEDEFPNELEITGEGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAI
    EQAMGK

    >gi|157388999|ref|NP_840071.2| selenoprotein M precursor [Danio rerio]
    MWPLIFTALLPSVILTYEVNIEKLSGLARARVETCGGCQLNRMREVKAFVTQDIPLYHNLVMKHIPGADPELVLLNHYYE
    ELDRIPLSEMTRAEINKLLAELGFYKKDHPEDQVPEEFRFSPAKDSPFEGRQSSTAAPETTEPSDSQHTDL

    >gi|68448477|ref|NP_001020349.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor [Danio rerio]
    MSASIARATVRAVSRRKILSTRAALTLTPSAVNKVKQLLDNKPEYIGLKVGVRTRGCNGLTYTLDYTKNKEQSDEEVLQD
    GVRVFIEKKAQLTLLGTEMDFVETKLSSEFVFNNPNIKGTCGCGESFNI

    >gi|189520102|ref|XP_684415.3| PREDICTED: ATP7B-like [Danio rerio]
    MNKLSPFSNLAKFISKSPDNGPVGGEQLCMKDCKPLCHCDPELCVCSLPQNSKDGPTEYKENGSQQEGWIPTKHAFDNFG
    YEPDGLKHNLVHQLPSEEGMVKIQVEGMT
    CQSCVRSIEEQIGRLEGVIGVQVSLSDKEAILRFNPAKVTPEDMRKRIEDM
    GFDALILALQGQIQPLSTDWSEVTLGVEGMHCGSCVKNITETLSGMLGVNSVFVSLEKGSVDLRFDPSLLTLETVKGFLE
    EIPPGNFRVSIPGWSSRLNSASTPTQSVTIGIEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEEL
    RAEIEDMGFEAWLNQDSEICEVSSVSQMPSGLKHLPSQRHPSKPSPSPITKENADGTGERELRKCFVHVTGMT
    CASCVSN
    IERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASVMEEHSVQDGVLDLSVTGMT
    CASCVHNIESK
    LLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKNEGLNNTLDHQEEIRQWKHSFLFSLVFGIPVM
    GLMIYMMVMDSQHKEHGGSMPADQNILPGLSIINLAFFLLCTPVQFLGGRYFYIQAYRSLRHGVANMDVLIVLATTIAYV
    YSFTVLIVAMIEGAKQSPLTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATDATIVSLGPDNTIIREEQVSV
    DLVQRGDVVKVAPGGKFPVDGKVIEGTSMADESLITGEPMPVIKKAGSCVIAGSINAHGALLVEATHVGSETTLSQIVKL
    VEEAQTSKAPIQQLADKLSGYFVPFIVVISILTVTAWLIIGFLDFDVVSKNFPGYNQNISRTEVIVRFAFQASITVLSIA
    CPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVGAVMFDKTGTITNGVPQVTRVLVLWDRARLPLRTVLAVVGT
    AEASSEHPLGMAVAKHCKEELGAETLGFCHDFQAVPGCGISCKVSSVEDLLQNSPKTQETKASAVKQTPLLPASKDNVSP
    SYSVLIGNRQWMLRNGLEVTADVDNAMSSHETKGQTAILVAIDGVLCAMIAVADTVKAESALAVHTLSSMGIEVYMITGD
    NRRTARAIATQVGIRKVFAEVLPSHKVAKVQELQERGLKVAMVGDGVNDSPALAHADLGIAIGTGTDVAIEAADIVLIRN
    DLLDVVASIELSKKTVQRIRINFVFALIYNLLGIPFAAGVFMPLGLVLQPWMGSAAMAASSVSVVLSSLLLRLFKKTSVE
    EYESRAQSHKLSLSPSQVSTHVGLESRRCSPLSDRKRRSRSASGSSSFISGSFHPSTTQPYNTSGRSIV

    >gi|193788703|ref|NP_998529.3| protein disulfide-isomerase [Danio rerio]
    MLKFLIVCALAAMSAAEIAEEEDVLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKV
    DATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFK
    DVESEDSKAFIKTAEAVDDIPFGITSDDSVFAKFEVAKDSVVLFKKFDEGRNTFDGEVSKESLLNFIKANQLPLVIEFTE
    QTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFIDSDVDDNQRILEFFGLKKEECPVIRLITLEE
    EMTKYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPW
    CGHCKQ
    LAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGKEGGAPVG
    DEEDEEADDLDLDDAEEDDSDVEEGHDEL

    >gi|50539990|ref|NP_001002461.1| thioredoxin [Danio rerio]
    MVLEIEDKAAFDNALKNAGDKLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKVDVDDAQDVAALCGISCMPTFH
    FYKNGKKVDEFSGSNQSKLEEKINSHK

    >gi|292616436|ref|XP_002663033.1| PREDICTED: anterior gradient 2 homolog [Danio rerio]
    MLKGLLSVLLVMVALSSALGKPEKTTPKKEKEKRVPQTLSRGWGDQLIWAQTYEEALFWSRSKNKPLMVIFHLEDCPHSQ
    ALKKAFAEDKEIQKLADEDFVILNLVYETTDKHLSPDGQYVPRIIFVDPSMTVRADITGRYSNRMYAYEPADMKLLLSNM
    QRALKFLKTEL

    >gi|169234966|ref|NP_835234.2| selenoprotein H [Danio rerio]
    MATRGKSARKRKADSDEKEKLDDAKKEKLEDKDEETGLRVVIEHCKSCRVYGRNAVVVREALADSHPELKVMINPHNPRR
    NSFEITLMDGERADVLWSGIKKGPPRKLKFPEPAEVVTALKQALEKE

    >gi|292616731|ref|XP_688053.4| PREDICTED: quiescin Q6 sulfhydryl oxidase 2-like [Danio rerio]
    MAAAFCLKISIIVGLLFGRAQPARLYTEEDPVVILSSDSLKQTVLNSSSAWLVQFYSSWCGHCIQYSPTWKALAGDVKDW
    AQAIRIGVVDCAHEKNFDICKEFGIHFYPTFRYFKAHDTTNDFGKTYQGADRELQTVRQLMVNFIQNHTRQDWPVGCPPL
    HPARSEDVLSLMGKKTEHYTAVIVEDGNSYIGREVILDLMPYEGLVVKRALSSDQLLMDKLGISSVPSAYLFQPNGTHTV
    LNVYKKLRFFFSSFLKLLPGVHRKQSTSSLQRPQPGINGQGAQVEWKEFKKSKVYMADLESGLHYLLRVELATHKTLEGE
    ELKTFKDFVTVVAKLFPGHQSVVKLLETLLEWLVSLPLEKIPYDAILDLVNNKMRISGLYLSEQVQWVGCQGSSVALRGY
    PCSLWTLFHVLTVQAANRPDALANTGFEDDPLAVLQTMRRYIGTFFG
    CQECGKHFEEMAQESLNQVKTVDEAVLWLWRKH
    NQVNARLSGSMSEDPMFPKTQWPTPDLCPTCHEEQEGLHVWNEQMVLAFLKQHYSASNISPKYSSSQSEPGPPAPDKPKA
    ITKPNSKIHINQNLKSPEILPKHQKRTDSGGEVEKHSGVQIEARPGMTFLGLGFSSVDMSLCVLLYALSCVFLMFMFFFF
    RFRSKRWKFKNYRPYV

    >gi|190358584|ref|NP_001121836.1| sulfhydryl oxidase 1 [Danio rerio]
    MARRGCGATSCYTTKTKLNSFYSFLCAFITCVSLCPVLCEAGLYTASDQVIVLTPENVDSTLFNNTAALLVEFYATWCGH
    CIAFSPVWKSLARDIKEWKPAVDLAAIDCANESNRKVCTNFGITGYPSIKFFHAYSSIGSRGLEVRGFSRDVRGLRQYII
    ENLELHTEAWPPACPPLETASEAEVHHFFPANNVKYLALVFENKKSYVGREVTLDLLQYENIAVRRVLDTETNLVSRFGV
    TEFPSCYLYDSSGNITRLKVLKEARTFYSYALQRLPGVVRTGKHQTPITELIKNSTLQEWRPFNKSRVYMSDLESALHYS
    LRVELSSHTSISGDDLIALKKYINVLAKYFPGRPSVKSALQAVDSWLQSQKGTEIKYSDFRDVLDNVVQTSDAVLPEGVQ
    WVGCQGSQARYRGYPCAVWTLFHVLTVQAKEMGSTVSEPQEVLLAMRGYVSSFFG
    CRPCATHFEAMAAESMDQVNSLSGA
    VIWLWSRHNRVNNRLAGDLSEDPHFPKIQWPSPELCPSCHGVTIIGDHNWIKDEVPQFLQNYFSSSRILNDYLQDETQAL
    IQQRNRLTAARMEKEAGRGADRRARDIFDNNPADEPQEEEEEEEEEEPTFEEQAVEPYPAGLEGAPGADQAPWEKPQPLS
    SQRKPKIVGMKLREAQEDIVDLDYFVSQHYKAKALRAAAMSGVVRRRSLQKKEDVEDLQFEGGWRVKRDLGSQEENFGIE
    PYPRAQSKHWMSLLSVGFSRLDVSLCVLLYLLSTMCLLAMYMYFKLRIKLRSAKVSLP

    >gi|41053638|ref|NP_956574.1| prostaglandin E synthase 2 [Danio rerio]
    MAAACTRTLGKVGRLVLDTPTCRFTNTAAFVPRTSMRCQGRAYGTGSSGFKSRLLLAAPVRGSGRVLGCAFLLGGGFGLY
    QTIKLTLQHHLAEKESDASDLDTDLKLTLYQYKT
    CPFCSKVRAFLDYHRLPYEIVEVNPVMRQEIKWSTYRKVPILMVNG
    TVQLNDSSVIISALKTYISSKDKKISEILACYPEMKSKNDRGKDVIEFGNKYWVMVHDADADQLYPGKDSRKEEIKWRTW
    ADDWLVHLISPNVYRTPTEALASFDYIVREGKFGSFEGFFAKYFGAAAMWIISKRLKYKHNLQADVRQDLYKAVNDWVAA
    IGKNKQFMGGDEPNLADLAVFGVLRVMEGLQSFDDMMEHTKVKKWYSRMQKATQHVS

    >gi|55925235|ref|NP_001007337.1| methyltransferase like 8 [Danio rerio]
    MRGLVKLTARAVSFIPCRQCGGGRPPAPLGGRILSNPDDVFKHNMWDHVQWTEEEREKARQKAEENSEEKIPVEEQSKYD
    REAHKYWDQFYEMHQNKFFRNRNWLFTEFPELLPPDTGGMLMAEQEQGLQSVNREKHNYKDTYPGHHAAFRILEVGCGAG
    NSVFPIINTIRGSKAFLYCCDFSSRAIELIQKHPDYDPAVCHAFVRDICDATSPFPFPPESLDIILVVFVLSAIHPARAQ
    AVVRGLAGLLKQGGMVLFRDYGRYDLSQLRFKKGQ
    CLSENFYSRQDGTCVYFFTKDEVHDLFSAAGLEELQNLEDRRLQV
    NRGKKILMHRVWMQSKYRKPEK

    >gi|116004569|ref|NP_001070644.1| hypothetical protein LOC569013 [Danio rerio]
    MVEDGTLMKGRVTVYSVPGCPHCTRAKTTLGALGVPVCDVDVNKHREIRALVKELTGHSSVPQIFFNNLYVGNNEDLQNL
    DPKRLEHLLLSVRDEAVPLDALPVPVENCRSETDGGCELSETLRNLILKLYSDHLSENGKTVDYKAMSRSLYFERYCDLA
    VRLQRVELLSMSREEKLAFFINIYNALVIHGNLRLGFPKNIWQRYRFFNYVSYFIGGEVFTLQDIENGVLRGNRKGVGQF
    LKPFSRDDPRLQVALPDVEPLIHFALNCGAKGCPPIKTYTPQDIDGQLRTAAEAFLENDDSCVIDSTGREVKLSQIFKWY
    KGDFGGTDDKVLNWVFDHMRASQKKRKLQALLSTGKVKVSFLPYDWSINSTD

    >gi|41053343|ref|NP_956315.1| thioredoxin domain-containing protein 9 [Danio rerio]
    MASQSMDIVAKALEQQVLQSARMVEEQLDAELEKLERMDEDELELLKERRLEALKKAQKQKQEWISKGHGEYREIPSEKD
    FFPEVKESKSVVCHFYRDSTFR
    CKILDKHLAILAKKHLETKFIKLNVEKAPFLTERLRIKVIPTLALVKDGKTKDYIVGF
    SDLGNTDEFPTEMLEWRLGCSDIINYSGNLLEPPTVGQKTGSKFTKVEKKTIRGKAYDSDSESDED

    >gi|292617677|ref|XP_002663428.1| PREDICTED: hypothetical protein [Danio rerio]
    MAVRLFEGKEHANSYWKYRISPSEELIGKVLQFHRNNEYSSNGLAVDVGCGSGQGTLLLAPHFTRVVGTDISPAQLEMGR
    KHVNIPNVSFRESPAEELPFEDGSVDLVTAMSAFHWFDHSRFLQEADRVLKPHGCLALLNYTLDMELTYGN
    CSEALNLIC
    NEFYAALHPLRDPHLGPSSFELYKRTYDSLQYPVKEWHDMFGVKKAVPLSGYIGMVKSFSTFQTLLKKDPEEARRLSQDI
    EDRLKRAMDVTSSETEVIMGVKYFYFLAQKPAND

    >gi|113677884|ref|NP_001038249.1| hypothetical protein LOC555377 [Danio rerio]
    MAVRLFEGKEHANSYWKYRISPSEELIGKVLQFHRNNEYSSNGLAVDVGCGSGQGTLLLAPHFTRVVGTDISPAQLEMGR
    KHVNIPNVSFRESPAEELPFEDGSVDLVTAMSAFHWFDHSRFLQEADRVLKPHGCLALLNYTLDMELTYGN
    CSEALNLIC
    NEFYAALHPLRDPHLGPSSFELYKRTYDSLQYPVKEWHDLFWVKKAVPLSGYIGMVKSFSTFQTLLKTDPEEARRLSQGI
    EDRLKRAMDVTSSETEVIMGVKYFYFLAQKPAND

    >gi|165972419|ref|NP_001107048.1| protein disulfide-isomerase A5 [Danio rerio]
    MASWNRHGRRRRLVEMFIFLSLVAVTSALQAVKVSPLIEKVNDHKDFKKLLRTRTNVLVLYTKSASSGDAHLKLLSDVAQ
    AVKGQGTIAWVNCGDSEGRKLCKKVKVDPSSKTKGVELLHYKDGTFHTEYNRPATFKSMVAFLKDPAGAPLWEENPEAKD
    VVHIESEKDFRKLLKREERPILMMFYAPW
    CGVCKRMQPIFQQAATETKGKYVLAGMNVHPAEFDGVKQEFSVKGYPTFCY
    FEKGKFLHHYENYGATSKDITDWLKNPQPPQPKTPEVPWSESGSAVFHLTDDSFDSFLEEHPSALIMFYAPW
    CGHCKKMK
    PEYDDAAETLNKDPNSPGVLAAVDTTIHKSTGERFKISGFPTVKYFEKGEEKYTLPHLRSKDKIIEWLKNPQAPPPPEKS
    WDEMPSSVSHLGAEDFRESLKKKKHALVMFYAPW
    CPHCKNAVPHFTTAAEMFKEDRKIAYAAVDCTKGQNHELCKQEGVE
    GYPTFNYYNYGKFSEKYNGERGEAGFTGFMRNLRGRDQEKVGKRKEEL

    >gi|149944695|ref|NP_001092702.1| hypothetical protein LOC335309 [Danio rerio]
    MIIHHLEDCPHSIALKKAFSEHRSIQRMAKSEFIMLNLVHETTDTHLAPDGFYVPRIMFVDPTLTVRADIVGKYANRMYT
    YEPDDIDFLAENMIKAKILLKEEHEEHDDL

    >gi|156231016|ref|NP_001035093.2| retinol saturase-like [Danio rerio]
    MWWILLFLEWFVDWARGTFWYLFGRRSGLCKGTISPQGPLVVDQEKKDKVLQKEYALNEVPDNLDVIVIGSGIGGLTAAA
    VLARLGKKVLVLEQDKQAGGL
    CKTFTEKGFEFDCGFYYVGQLHENSFLKIALDLITDGQVHFAEQGSHVETVVIGKGPEC
    KEYTIYNGKKQMEARLKKQFPNDAKAVEEFFKIMKICSEKVRLLCMLKMVPLWFARFILRTGIADFISPILKYSRTSISE
    VVKSLTSNQDLLTVFSKTFCGVPPKNSSCMIDALILHHSKRGVYYPQGGASEIPYHIIQVLEKHGGKVLVNAPVSRVLVD
    EQQNAYGVAVKTGDEDIEIKAPVVVSNAGVFTTFQKLLTPEIQADPQVQEYLKALKPGKGFFQVFAGFNATMEELGISST
    DMRLYKGNNVDEMMEEYFASDKQDAPDNVPMMYLSFPSAKDPTSITRFPGQSRMVIHTLVNPKWFEQWENVNEAERGEEY
    ENYKMRFANHLFDWACVRFPQSKEKVALLHAVTPINMHGLGASYCSMSAEHNLERYQPLNIATIRCNTPVKNLYLSGQDI
    FTAGYSGALHGGFLCASTVMDRCLHIDLLLQQKKLKSKSVKKLE

    >gi|134133218|ref|NP_001077016.1| dnaJ homolog subfamily C member 10 [Danio rerio]
    MEMILNHLTPSRKSLLFAFIAVWLFVSISSDEDYYKLLGISREASTRDIRQAFKKLALTMHPDKNPNDETAHDKFLKINR
    AYEVLKDEDLRKKYDKYGEKGLQDEQQGGRYESWNYYRYDFGIYDDDPEITTLDRGDFDAAVNSGEVWFVNFYFPR
    CSHC
    HDLAPTWREFAKEMDGVIRIGAVNCGDNGMLCRSKGINSYPSLYVFRAGMNPEKYFNDRTKSSLTKFAMQFVKSKVTELW
    QGNIYSEIERAFAERIGWLITFCADTGDCLESQTRRKLAGMLDGLVNVGWMDCTKQADLCESFEINTSTTALFPPGSSLT
    QKGSVLFIQSLDTKEIYAQVLQHLPDLEILTKSSFEHKLAHHRWLVSFSFGRNDLASHEYKKLNALLKNSHIQVGKVDCI
    SDSELCSSLYIHKPCVAVFKGVGIHDFEIHHGKDALYNVVAFAKESVNAHVTTLRPENFPNHEKEPWLVDFFAPW
    CPPCR
    ALLPELRKASIQLFGQLKFGTLDCTIHEGLCNTYNIHAYPTTVIFNKSSIHEYEGHHSADGILEFIEDLVNPVVVTLGPE
    SFQELVKRRKSSETWMVDFYAPW
    CGPCQALLPEWRRMARMLSGIVNVGTVDCQKHHSFCQSESVRAYPEIRLFPQNSNRR
    DQYQTYNGWHRDAFSLKAWALSSLPRASVDLSPEDFKRKVLGGKDHWVLDFYAPW
    CGPCQQFAPEFEVLARMMKGTVRAG
    KVDCQAHYQTCQSAGIKAYPTVRFYPTLGTTRRDQGGEHINSRDATVIADILRQRLQQLALQGKSKLKDEL

    >gi|147898395|ref|NP_001082944.1| thioredoxin domain-containing protein 3 [Danio rerio]
    MAAKKKEISLQININNDEQWSEALALKGLLVVDVYQQWCGPCRAVVGLFRKIKNELGDELLHFATAEADGIEALEMYRGK
    CEPTFLFYAGGELVSVLRGPNAPLLQKTIQEELSNEKNVLEHGGARRAVKDEGLTEEEEVNDDTEDHPHDEDVTVPTDKS
    YTVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCE
    DVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFPNFSFSVWDSRPEEEPVERTLALV
    RPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSGLVLALALVKEGAVEHWRNILG
    PKDPIKAKNEQPDSLRAQFSVENSSINQLHGSSSSEEAEKEISFFFPPEDTLAVIKPDTQHKEEILEEIQAQGFTISQLK
    DTILSREMAEEFYKEHREKPFFSQLVDYMCRNRGEFCRAQKSTIFKISFIR

    >gi|46391102|ref|NP_991284.1| phosducin-like protein 3 [Danio rerio]
    MQDPNADTEWNDILRKKGILPPKETPVEEEEDEQLHLQSQSVVKTYEDMTLEELEENEDEFSEEDEHAMEMYRLKRLAEW
    KANQMKNVFGELKEISGQDYVQEVNKAGEGIWVVLHLYKQGIPL
    CSLINQHLAQLARKFPQSKFLKSISSTCIPNYPDRN
    LPTLFVYRDGEMKAQFIGPLVFGGMNLTCDELEWRLSESGAVKTDLEENPRKQIQDQLMTSIRCSANTHRDGEEDSDED

    >gi|56693336|ref|NP_001008630.1| hypothetical protein LOC494087 [Danio rerio]
    MVEVFSGRTLVNKEGDLVEPEEALRNKVVGLYFSAGWCPPCRDFTPLLCDFYTELVEETEPPAQFEIVFISSDKSTEDMV
    EYYHDMHGDWLALPWTDPYKHELKKRYNITAVPKLVIVKENGQVITDKGRKQIRDQGLACFRSWIEVAEIFQNFKG

    >gi|125828982|ref|XP_693944.2| PREDICTED: Gamma-interferon-inducible lysosomal thiol reductase-like [Danio rerio]
    MNTLVLFVFHVLFLGVHKIQCKSHPKPSCGYPPSQWCRSLEIAIECEVQKQCMELNASRLDPVVPPVEISLYYESLCSGC
    RAFLTEQLFPTWTLLKDIMKVNLVPFGNAKEVPEENSFSCQHGEPECYANMVEACVLYEATHAAFPVIHCMESSADVTQS
    AKPCLQLYAPFIKWETIESCTRGELGHSLMHQNAVKTQALKPAHTHVPWITINGKYTSELEDKAMSTLFNLVCSLYKGIK
    PPVCTGALKKLDRSFC

    >gi|47087337|ref|NP_998632.1| NEDD8-activating enzyme E1 catalytic subunit [Danio rerio]
    MAEGEEPEKKRRRIEELNEKMVVDGGSGDRSEWQGRWDHVRKFLERTGPFTHPDFEASTESLQFLLDTCKILVIGAGGLG
    CELLKDLALSGFRHIHVVDMDTIDVSNLNRQFLFRPKDVGRPKAEVAADFVNDRVPGCSVVPHFKKIQDLDETFYRQFHI
    VVCGLDSVIARRWMNGMLLSLLIYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPM
    CTIAS
    MPRLPEHCVEYVRMLLWPKEKPFGDGVVLDGDDPKHIQWVYQKSLERAAEFNITGVTYRLTQGVVKRIIPAVASTNAVIA
    AACATEVFKIATSAYVPLNNYLVFNDVDGLYTYTFEAERKENCSACSQVPQDMQFTPSAKLQEVLDYLTENASLQMKSPA
    ITTTLDGKNKTLYLQTVASIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLKFIS

    >gi|47086953|ref|NP_998478.1| hypothetical protein LOC406605 [Danio rerio]
    MSSVNLTSLGANQLKNTTTGEMVEIGSLWREQAVVLFFLRRFGCQVCRWMAAEVSKLEKDLKAHGIALVGIGPEETGVKE
    FKDGGFFKGDIYIDEMKQCYKDLGFKRYNAINVVPAAMGKKVREIASKASAEGIQGNFSGDLLQSGGMLIVAKGGEKVLL
    HFIQKSPADNPPLEEITKALGISANVQAGEKPQCNEDVCTR

    >gi|292619476|ref|XP_001920588.2| PREDICTED: wu:fj02d07 [Danio rerio]
    MMLMRLSSAWSTSPTTIKHISQAKLFTRSLRKDNHHTLTKNRCARLPHDYWFGQKSVPVSTRLSWDSFRFSGVFFFSMAS
    GSDSPDRLKTPKYTNRLSQEKSSYLLQHAHNPVDWYPWGQEAFDKAKCEDKPIFLSVGYST
    CHWCHVMERESFEDEEIGK
    ILSDNFVCIKVDREERPDVDKVYMTFVQATSGGGGWPMSVWLTPDLKPFIGGTYFPPRDSGRRPGLKTVLLRIIEQWQTN
    RETLESSGERVLEALRKGTAISASPGETLPPGPDVANRCYQQLAHSFEEEYGGFREAPKFPSPVNLKFLMSFWAVNRSSS
    EGAEALQMALHTLRMMALGGIHDHVAQGFHRYSTDSSWHVPHFEKMLYDQGQLAVAYITAYQVSGEQLFADVARDVLLYV
    SRDLSDKSGGFYSAEDADSFPTVESTEKREGAFCVWTAGEIRELLPDIVEGATGGATQADIFMHHYGVKEQGNVDPAQDP
    HGELQGQNVLIVRYSVELTAAHFGISVNRLSELLSEARAKLAEVRRARPPPHLDTKMLASWNGLMLSGFARVGAVLGDKA
    LLERAERAACFLQDHLWDEDGQRILHSCYRGNNMEVEQVYDVALLHFEETLSPGEKTENEQGGNGKILKEPVITVQIAPD
    TCCHKNSKVFSFPRRLALRKHGAPDCLVTHLQRCPWDSLAREWRLSWVTRVYESPLFRFKSTTGIYQKMLRDRRGVLRAE
    GGVGIASRAGASPITGFLDDYAFVVCGLLDLFEATQKFRWLQWAEELQLRQDQLFWDSQGSGYFCSDPSDPTLLLALKQD
    QDGAEPSANSVSAMNLLRLSHFTGRQDWIQRSEQLLTAFSDRLLKVPIALPDMVRGVMAHHYTLKQIVICGLPDAEDTAS
    LISCVNSLFLPHKVLMLADGNTEGFLYDKLPILSTLVPQDGKATAYVCENFVCALPVTCPQELRRLLME

    >gi|54400406|ref|NP_001005950.1| glutaredoxin 3 [Danio rerio]
    MANFTDAASLQQFDELLKNNSKSLTVVHFHAPWAPQCSQMNDVMAELAKEHKHTMFVKLEAEAVPEVSEKYEITSVPTFL
    FFKGGEKIDRLDGAHAPELTNKVQRLGSGGGGAVGAGDVPKEDLNQRLKRLINAAPCMLFMKGSPQEPR
    CGFSRQIIQIL
    KDHNVQYSSFDILSDEEVRQGLKTYSNWPTYPQVYVSGELIGGLDIVKELVESGELENTFPKTVSLENRLKSLINKSPVM
    LFMKGNKEAAK
    CGFSRQILEIMNNTGVEYDTFDILEDEEVRQGLKTYSNWPTFPQLYVKGDLIGGLDIVKELLEGGELVS
    VLKGEN

    >gi|65301457|ref|NP_001013478.2| thioredoxin-dependent peroxide reductase, mitochondrial [Danio rerio]
    MAATIGRLLGASARRAAVCGLKTLVPRNGVSVIRAPQPLACIAAQKACFSISAARWAPAVTQAAPHFKGTAVINGEFKEI
    SLGDFKGKYLVLFFYPLDFTFV
    CPTEIVAFSDKANEFHDVNCAVVGVSVDSHFTHLAWTNTPRKSGGLGKIQIPLLADLT
    KQVSRDYGVLLEGPGIALRGLFIIDPNGIVRHMSVNDLPVGRSVGETLRLVKAFQFVETHGEVCPASWTPKSPTIKPTPD
    GSKEYFEKVN

    >gi|50540310|ref|NP_001002621.1| hypothetical protein LOC436894 [Danio rerio]
    MAASQKCLGKGSPAPGPVPKDHIRLYSMRFCPFAQRTRLVLNAKGIKYDTININLKNKPDWFLEKNPLGLVPVLETQSGQ
    VIYESPITCEYLDEVYPEKKLLPFDPFERAQQRMLLELFSKVTPYFYKIPVNRTKGEDVSALETELKDKLSQFNEILLKK
    KSKFFGGDSITMIDYMMWPWFERLETMNLKHCLDGTPELKKWTERMMEDPTVKATMFSTETYMVFYKSYMEGNPNYDYGL


    >gi|55925189|ref|NP_001007373.1| hypothetical protein LOC492500 [Danio rerio]
    MASSPKCLGKECSAPGPVPNGQIRLYSMRFCPFAQRTRLVLTAKGVKHDIININLVSKPDWFLKKNPFGTVPVLETSSGQ
    VIYESPITCEYLDEVYPEKKLLPSDPFERAQQKMLLELYSKVIPYFYKISMGKKRGEDVSTAEAEFTEKLLQLNEALANK
    KTKYFGGDSITMIDYLIWPWFERAEMMGVKHCLAKTPELRKWIELMFEDPVVKATMFNTDVHKVFFDSYMDGKPNYDYGL


    >gi|169636432|ref|NP_001108605.1| thioredoxin domain containing 1 [Danio rerio]
    MACGDPRRVRGMTAGACVLSILAACVVAQPEAPKAGQLRVLTDGDWQEVLTGEWMIEFFAPWCPACQQLEPVWTEFAGWG
    DDLGVNIAKVDVTEHPGLSGRFIIMALPTIYHCKDGVFRRYQGDRSKEDFLSFIEEKKWQSIEPVSSWFGPSSFLMNIMS
    ALFKLSVFIRHCHNYLTEQMGFSVWESYGIFACATIVAGLFLGLVMVFVADFVFPSRRFSPDYHHRKLPARQVCCQHQFE
    YEQEADGEEEDDEYEYGGALDTLPRMDATDAHRRRPVHLREEDT

    >gi|41054399|ref|NP_955994.1| magnesium transporter protein 1 precursor [Danio rerio]
    MLHKLLIVVFLVVCLHDMRLNGQKKKETLLSEKVSQMMEWVSKRAVVRLNGEKFKRLVRAHPRNYSVIVMFTALQPQRQC
    GVCRQADEEYQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRADTYELQVRGFAAEQLA
    RWVADRTDVHIRVIRPPNYAGPLMLGLLLAFIGSLAYLRRNNLEFLFNKNVWAFSALCFVLIMTSGQMWNHIRGPPYAHK
    NPNTGQVSYIHGSSQAQFVAETHIVLLFNAAVTIGMVLLHEAATSGLDIVKRKIMCVAGIGLVVLFFSWLLSVFRAKYHG
    YPYSFLFG

    >gi|111955341|ref|NP_001036185.1| copper-transporting ATPase 1 [Danio rerio]
    MALSTNLCRVTLGVEGMTCGSCVQSIEGRIGGLPGVIHIQVSLEQNNATVTYDHTQHTPQSIADAIEDMGFESSLTNATS
    TPVQTETKVFSKAGCSADSVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPKE
    GSTSRSFSGVEAVKMRIEGMV
    CLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYIITVDEIVKQIEVAGFKATVKS
    KPRQLKLSASEVERLLSAPKQTEEKLSEPPADSTVTTLFQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHN
    PKQVSVVELQKAIEALPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHQGT
    FEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSPSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIG
    GMT
    CASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGSDGSLELVVRGMTC
    ASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASLVKKDRPGSHLDHSREIRQWKRSFQ
    ISLFFCVPVMGMMIYMIVVDHMIDKYHQHHNATAEDRAKYHSTMFLEKQLLPGLSIMNLISFLFCVPVQFIGGRYFYCQA
    YKAVKHRTANMDVLIVLATTIAFTYSVVVLLVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSL
    QATEATVVTLNEDMSVLSEEQVDVELVQRGDVVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSIN
    QNGSLLIKATHVGTDTTLSQIVKLVEEAQTSKAPIQQFADKISSYFVPFIVVISVLTLLAWIIIGFVNFSLVQTYFPGYD
    KSISEAEAVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIQSVVFDKTGTITYGAPK
    VVQVKMLAEGNRLPRSKLLAIVGTAENSSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGIRCLVSNTENLLKREDS
    DSEENQHNAVLIQISDARAHSTEHPLIMDPQPLTVVQTASYTVLIGNREWMRRNALQVRADVDEAMTEHERRGCTAVLVA
    VDNELCAMVAIADTVKPEAELAVHVLSAMGLEVVLMTGDNSKTARAIAAQVGIRKVFAEVLPSHKVAKVEQLQQAGKRVA
    MVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALMYNLVGIPIAAGVF
    MPVGLVLQPWMGSAAMALSSVSVVLSSLLLKCYTKPTVEKLKRRLGDVRTHGSLSDVSVHIGMGELRRPSPKLSLLDRFV
    NYSRASINSLRSDKHSMNSMALSEPDKHSLLVGDDHCDNEIV

    >gi|292620801|ref|XP_691720.3| PREDICTED: hypothetical protein [Danio rerio]
    MASSDNDISYSDLKSLLAKGSVVLVDVRTNEEVARGTIPGSIHIPVGNIGQDLSLDAAEFQSKFGVGKPPLDCTELVFFC
    QLGRRGAAATEKAKSLGFKNARNYAGAYKEWSEKEGK

    >gi|50540188|ref|NP_001002561.1| chloride intracellular channel protein 2 [Danio rerio]
    MALRPDSDKEPRIELFIKAGHDGENVGNCPFCQRLFMVLWLKGVKFTVTTVDMRKKPDELKDLAPGTNPPFLLYNGTLKT
    DFIKIEEFLETTLAPPRYPHLSPRYKESFDVGAGIFAKFSAFIKNSPNNAFHEKALLREFKRLDDYLNTPLQDELDQNIS
    VSKRKFLDGNRLTLADCNLLPKLHVIKVAARKYCNFDIPTQFTGVWRYLQSAYEREEFSQTCPADIEIEKAYLSVVKRN

    >gi|66472640|ref|NP_001018390.1| glutathione reductase, mitochondrial [Danio rerio]
    MASGSVSRFDFLVVGGGSGGLAGARRAAELGATTAVIESHRLGGTCVNVGCVPKKVMWNTSTHAEYLHDHEDYGFEGAKA
    HFSWQIIKHKRDAYVSRLNQIYRSNLEKGKIEFIHGYARFTDDPEPTVEVNGKKYTATHILISTGGHPSTVSEDDVPGSS
    LGITCDGFFELESCPKRSVIVGAGYIAVEMAGILSTLGSKTSIIIRQGGVLRNFDALISSNCTKELQNNGIDLRKNTQVK
    SVKKNGKGLSITLVTKDPDDKDSQEKFDTINDVDCLLWAIGREPNTAGLNLSQIGVKLDERGHIVVDEFQNTSRPGVYAV
    GDVCGRALLTPDEAVKTYGKDKVKVYTTSFTPMYYAITSRKSQCIMKLVCAGENEKVVGLHMQGFGCDEMLQGFAVAVNM
    GATKADFDRTIAIHPTSSEELVTLR

    >gi|66472560|ref|NP_001018431.1| nucleoredoxin [Danio rerio]
    MSEFLVNLLGERLVNGEKAEVDVQALGSRLSLLGLYFGCSLNGPCKQFNASLTEFYSKFKKSSEHKDKLEIVFISSDQDQ
    KQWQDFLQEMQWPALPFKDRHKKMKLWNKYKVTSIPSLVFIDAATGKVVCRNGLLVVRDDPKGLEFPWGPKPFAEVVSGP
    LLRNNRQTTDSTALEGSYVGVYFSAHW
    CPPCRSLTRVLVESYRKVKETGQKFEIVFVSADRSEESFTQYFSEMPWLAVPY
    SDEARRSRLNRLYGIQGIPTLILLDTEGHMITRQGRVEILNDPDCGLFPWHPRPVLELSESNAVQLHEGPCLVLFVDAEE
    EGELDPAKELIQPIAEKIMAKYKAKEEETPLLFFVAGEDDMSDSLRDYTNLPEAAPLLTILDMSARAKYVKDVEEITPAV
    VEQFVSGFLAEKLKPEPI

    >gi|292621956|ref|XP_002664824.1| PREDICTED: hypothetical protein [Danio rerio]
    MSSINLTSLGANQLKNTTTGEMVEIGSLWREQAVVLFFLRRFGCQVCRWMAAEVSKLEKDLKAHGIALVGIGPEETGVKE
    FKDGGFFKGDIYIDEMKQCYKDLGFKRYNAINVVPAAMGKKVREIASKASAEGIQGNFSGDLLQSGGMLIVAKGGEKVLL
    HFIQKSPADNPPLEEITKALGISANVQAGEKPQCNEDVCTR

    >gi|41053774|ref|NP_957186.1| endoplasmic reticulum resident protein 44 [Danio rerio]
    MKLSSIIPVPELHYFTLLLVTGLYNPGRGEITSLDSGNIDDILNGAGVALVNFYADWCRFSQMLHPIFEEASNIVREEYP
    DATQVVFGRVDCDQHSDLAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADFIRQQKVDPIKEIENLEEISTVDRSR
    RTIIGYFEKRDSDNYRTYEKVANILRDDCAFLAAFGEVSKPERFSGDNIIYKPLGENAPDMVYMGSLTNFDLSYAWTQDK
    CVPLVREITFENGEELTEEGIPFLILFHQKDDTESLEKFQQEVARQLISEKGSINFLHADCDKFRHPLLHIQKTPADCPV
    IAIDSFRHMYVFPEFSDLAVPGKLRQFVLDLHSGKLHREFHHGPDPTDSTPGQQEENREVPSNPPESSFQKLAPSETRYT
    ILRDRDEL

    >gi|47086229|ref|NP_998070.1| hypothetical protein LOC405841 [Danio rerio]
    MRLPCFIICAVLTVWLAEGSDVLELGDSDFDRSAGMHDTLLVEFFAPWCGHCQRLAPEYEAAATKLKGTLALAKVDCTVN
    SETCERFGVNGYPTLKIFRNGEESGAYDGPRTADGIVSYMKKQAGPSSVALLKEADLDGFVDNYEASVVGFFSGEDSAQL
    AEFLKASSALRDSYRFAHSTDVGAGLKYGVDGECVLLFRPPRLSSKFEDNVVKYTEHLSVSSLHKFVKDNILGLCPHMTM
    ENRDTVRESDLLTAFFNVDYLRNPKGTNYWRNRIMKVATQFQDRGLTFAVADRQEFQDELEEEFGVSSSEGGDVPLVTIR
    TRAGQKYSMQEEFTRDGKSLEKFLEDYFAKRLKRYVKSEPIPESNDGPVKVLVADTFDAIVNDPEKDVLVEFYAPW
    CGHC
    KNLEPKYKELGEKLSGNPNIVIAKMDATANDVPPNYDVQGFPTIYFVPSGQKDQPRRYEGGREVNDFITYLKKEATNPLI
    LDDSRDEL

    >gi|55925309|ref|NP_001007386.1| chloride intracellular channel 5 [Danio rerio]
    MTSNEEGKDPDIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTPPPFLTFNGEVRTD
    VNKIEEFLEEMLAPPKYPKLAAKNKESNTAGNDIFAKFSAYIKNTKPEANASLEKGLLKVLKKLDSFLNSPLPDEIDAES
    TGEEKSSNRKYLDGNELTLADCNLLPKLHVVKVVSKKYRNFEIPSDLSGVWRYLQNAYSRDEFTNTCAADREIELAYQDV
    AKRLGK

    >gi|41054814|ref|NP_956644.1| ERO1-like protein alpha precursor [Danio rerio]
    METCVLLLGLFLTSVHVTTAGSAAHRCFCQVTGTLDDCACDVETIDKFNNKDIFPKLQKLLSSDYFRFYKVNLNNGCPFW
    TDHSQ
    CGLKYCAVKPCSPDEVPEGLKSSSYKYSEKASHDTEECEKAEKLGAVNGSLSDETRQALEEWKKYDDESDRFCML
    DDEDSPESQYVDLLLNPERFTGYKGAEAWRIWNSIYEENCFKPYSVNRPLNPLASNSGDDGQGFYRWLEGLCVEKRAFFR
    LISGLHASINIHLSARYLLDENWFEMKWGHNVSEFQQRFDEDLTKGEGPKRLRNLYFLYLIELRALAKILPYFERSTFQL
    YTGQDTQDDQNKKLLLELLHVAKSFPLHFDETALFAGNNKEAMKLKEDFKLTFKNISRIMDCVECFKCRLWGKLQTQGLG
    TALKILFSERQIEAMPNKQHQSIISAQSAGNCVFVQRFRKNLHKCQRVEELQIVVVETQTVTVKMFQERATVQTDMHKHM
    TFPMFGYIQ

    >gi|125841844|ref|XP_684479.2| PREDICTED: Mgmt protein isoform 2 [Danio rerio]
    MSASGACVLCAVTLTSPVGEILLRGCEKGVHTIDIKLNTDKEESVHPVVLSEMSSELQRCVDWLQCYFMNPESISALPLP
    ALHHPLMQSDSFKAQVLKTLLKEVGVGKTVSYKQLAEMIGNPNAVRAVGSAMKQNPVPLIVP
    CHRVLLSSGHTGSYMGGK
    GDDIKVWLLTHERKAVELNPSQSGKSI

    >gi|292623121|ref|XP_002665218.1| PREDICTED: Mgmt protein [Danio rerio]
    MSASGACVLCAVTLTSPVGEILLRGCEKGVHTIDIKLNTDKEESVHPVVLSEMSSELQRCVDWLQCYFMNPESISALPLP
    ALHHPLMQSDSFKAQVLKTLLKEVGVGKTVSYKQLAEMIGNPNAVRAVGSAMKQNPVPLIVP
    CHRVLLSSGHTGSYMGGK
    GDDIKVWLLTHERKAVELNPSQSGKSI

    >gi|157389007|ref|NP_001004294.3| selenoprotein N [Danio rerio]
    MAADVDKTPAGEQKDDHEDRGTPSSRRARSRFTHISSLFIIAAIPVIGFCIKYCLDIQFVKRHEAGLKALGADGLFFFSS
    LDTDHDLYLSPEEFKPIAEKLTGVAPPPEYEEEIPHDPNGETLTLHAKMQPLLLESMTKSKDGFLGVSHSSLSGLRSWKR
    PAISSSTFYASQFKVFLPPSGKSAVGDTWWIIPSELNIFTGYLPNNRFHPPTPRGKEVLIHSLLSMFHPRPFVKSRFAPQ
    GAVACIRATSDFYYDIVFRIHAEFQLNDVPDFPFWFTPGQFAGHIILSKDASHVRDFHIYVPNDKTLNVDMEWLYGASET
    SNMEVDIGYLPQMELSAEGPSTPSVIYDEQGNMIDSRGEGGEPIQFVFEEIVWSEELKREEASRRLEVTMYPFKKVPYLP
    FSEAFSRASAEKKLVHSILLWGALDDQSC
    CGSGRTLRETVLESSPVLALLNQSFISSWSLVKELEDLQGDVKNVELSEKA
    RLHLEKYTFPVQMMVVLPNGTVVHHINANNFLDQTSMKPEDEGPGLSFSAGFEDPSTSTYIRFLQEGLEKAKPYLES

    >gi|41393129|ref|NP_958894.1| chloride intracellular channel protein 4 [Danio rerio]
    MSLSVPQNGLKGDNEPVIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLQNLAPGTHPPFITFN
    GEVKTDVNKIEEYLEDILCPPKYSKLGARHPESNTAGMDIFAKFSAFIKNSKPDANEALERGLLKTLQKLDEYLCSPLPD
    EIDHNSMEEVKASTRMFLDGEEMTLADCNLLPKLHIVKVVAKKYRGFEIPKDLTGIWRYLNNAYKREEFTNTCPSDKEIE
    IAYADVAKRLVK

    >gi|292623223|ref|XP_002665242.1| PREDICTED: chloride intracellular channel 4-like [Danio rerio]
    MGNCGSFDPDDEFSYHPDEWCDQCNCPKPPVSQTCHGDNGAEVKLLFITERKKVHEQETPVGCLDGEKKLIQISLLFIEA
    GSDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLQNLAPGTHPPFITFNGEVKTDVNKIEEYLEDILCPPKYS
    KLGARHPESNTAGMDIFAKFSAFIKNSKPDANEALERGLLKTLQKLDEYLCSPLPDEIDHNSMEEVKASTRMFLDGEEMT
    LADCNLLPKLHIVKVVAKKYRGFEIPKDLTGIWRYLNNAYKREEFTNTCPSDKEIEIAYADVAKRLVK

    >gi|292623291|ref|XP_001922306.2| PREDICTED: hypothetical protein LOC503993, partial [Danio rerio]
    MAPARAYLFPQAGAHAATILITFFVLQLGLCVVVAQLEMANKSVLPTKERALKGREEKVVVAAKHAANGNTTVEPFPDGM
    EMIMFGMG
    CFWGAERRFWKITGVFSTQVGYAGGFTSNPTYHEVCSGLTGHTEVVRVVFSPKDVSLEKLLKVFWESHDPTQ


    >gi|189531092|ref|XP_001922511.1| PREDICTED: hypothetical protein [Danio rerio]
    MSFARRLLVSAPKTASFHLLNLLSVRSCAAPLTSTSSNTEHQNTSSTDAEVHLSQSCVKRLAEIMEKGQYLRIAVEGGGC
    SGFQYKFSVDSVKNEDDRVFEKNGVGIVVDQDSLEFVKGSTVDFSQELIRASFQVLKNPQAEHGCSCGSSFSVKL

    >gi|41056017|ref|NP_956421.1| adenylyltransferase and sulfurtransferase MOCS3 [Danio rerio]
    MDDTIVSLKSQLLEREREVATLKKKLDQIEKGNSTLPELQEKVTSLSPLRLNTSLNNDDIMRYSRQLLLPELGVKGQIAI
    SNISVLVVGCGGLGCPLAQYLAAAGIGRLGLLDYDVVELSNLHRQVLHTELTQGQPKALSAAQAISRMNSTVQCVPYHLQ
    LSRENAIQLIQQYDIVADCSDNVPTRYLVNDACVLTSRPLVSASALRMEGQLTVYNYRGGPCYRCLYPIPPPPETVTN
    CS
    DGGVLGVVPGIMGCLQALEVLKIASGQECSFAQQLLMFDGEQTRFRSIRLRSRQKECVVCGEKPTITELQDYEHFCGSAA
    TDKCRRLHLLSREQRVSVQDYKGILDHSTPHLLLDVRPKVEVDICRLSNSLHIPLASLEDKKPEHITLLKEAISDLQEHL
    NNQSPVQVFVVCKLGNDSQKAVQLLEKMSGAEVEAMTVKDIGGGLMAWAKKIDYCFPQY

    >gi|50540032|ref|NP_001002481.1| maleylacetoacetate isomerase isoform 2 [Danio rerio]
    MSATVARLIKPVLYGYYRSSCSWRVRIAFALKGIEYEQKPINLIKDGGQQLTDQFKAINPMQQVPAVSIDGITLSQSLAI
    IQYIEETRPEPRLLPADPMQRAHVRIICDIIASGIQPLQNLYVLQKIGEDKVQWAQHFINRGFQALEPVLKETAGKYCVG
    DEISMADICLVPQVYNADRFKVDMTQYPTIRRLNQTLVEIEAFKASHPSRQPDTPDDLRL

    >gi|71834680|ref|NP_001025442.1| maleylacetoacetate isomerase isoform 1 [Danio rerio]
    MAAQAKPVLYGYYRSSCSWRVRIAFALKGIEYEQKPINLIKDGGQQLTDQFKAINPMQQVPAVSIDGITLSQSLAIIQYI
    EETRPEPRLLPADPMQRAHVRIICDIIASGIQPLQNLYVLQKIGEDKVQWAQHFINRGFQALEPVLKETAGKYCVGDEIS
    MADICLVPQVYNADRFKVDMTQYPTIRRLNQTLVEIEAFKASHPSRQPDTPDDLRL

    >gi|157277985|ref|NP_955995.2| selenide, water dikinase 1 [Danio rerio]
    MSVRESFNPESYELDKNFRLTRFTELKGTGCKVPQDVLQKLLESLQENHYQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKLTEKERDKVMPLVIQGFKDASEEAGTSVT
    GGQTVINPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MLNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLARQQRTEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNTTPGATS

    >gi|47086677|ref|NP_997847.1| chloride intracellular channel protein 1 [Danio rerio]
    MSEEKPEVELFVKAGSDGQSIGNCPFSQRLFMVLWLKGVTFNVTTVDMKRKPEILKDLAPGAQPPFLLYGTEVKTDTNKI
    EEFLEETLCPPKYPRLAACNPESNTAGLDVFSKFSAYIKNSNPQMNDNLEKGLLKALKKLDDYLSSPLPDEIDENSADDV
    ISSTRSFLDGQELTLADCNLLPKLHIVKVVCLKFRGFSIPRSLTSLWRYLDAAYAREEFSSTCPSDEEIYVAYSSVVKAL
    K

    >gi|292624285|ref|XP_002665576.1| PREDICTED: protein disulfide-isomerase A3-like [Danio rerio]
    MMDEMISRGLLCILVCSLSSSAREHSDVLKLTDADFDYLAPEHETLLVKFYAPWCGHCKKLAPEFESAASRLKGTVTLAK
    VDCTANTEICKHYGVNGYPTLKIFRNGHESSSYDGPRSADGIVDYMKKQAGPDSVLLHSELDLEKFINHFDASVVGLFSG
    TDSSQLAEFLKGASLMRESFRFAHTTDLQLGQKYGVTHESILLFRAPRLSSKFEESVVPHTGSLSVTGLRRFIRDNIFGL
    CPHMTKDNKEVLRKRDLLTAYYDLDYLHNPKGSNYWRNRVLKVATKFSSQGMLFSVANRNDFMEELEEEFGLSASDGNEL
    PFVTIRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRYVKSEPVPAINNGVVKVVVADTFEEIVNDPEKDVLIEFYA
    PW
    CGHCKKLEPKYTALGEMLYSDPNIVIAKMDATVNDVPAGYDVQGFPTIYFAAAGRKSEPKRYEGAREVKDFVNFLKRE
    ATKPLILNGVKEEL

    >gi|57526015|ref|NP_001003517.1| protein disulfide-isomerase A3 [Danio rerio]
    MDEMILRGLLCILVCSLSSSAREHSDVLKLTDADFDYLAPEHETLLVKFYAPWCGHCKKLAPEFESAASRLKGTVTLAKV
    DCTANTEICKHYGVNGYPTLKIFRNGQESSSYDGPRSADGIVDYMKKQAGPDSVLLHSELDLEKFINHFDASVVGLFSGT
    DSSQLAEFLKGASLMRESFRFAHTTDLQLGQKYGVTHESILLFRAPRLSSKFEESVVPHTGSLSVTGLRRFIRDNIFGLC
    PHMTKDNKEVLRKRDLLTAYYDLDYLHNPKGSNYWRNRVLKVATKFSSQGMLFSVANRNDFMEELEEEFGLSASDGNELP
    FVTIRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRYVKSEPVPAINNGVVKVVVADTFEEIVNDPEKDVLIEFYAP
    W
    CGHCKKLEPKYTALGEMLYSDPNIVIAKMDATVNDVPAGYDVQGFPTIYFAAAGRKSEPKRYEGAREVKDFVNFLKREA
    TKPLILNGVKEEL

    >gi|60279653|ref|NP_001012499.1| anterior gradient protein 2 homolog [Danio rerio]
    MLKGLLSVLLVMVALSSALGKPEKTTPKKEKEKRVPQTLSRGWGDQLIWAQTYEEALFWSRSKNKPLMVIFHLEDCPHSQ
    ALKKAFAEDKEIQKLADEDFVILNLVYETTDKHLSPDGQYVPRIIFVDPSMTVRADITGRYSNRMYAYEPADMKLLLSNM
    QRALKFLKTEL

    >gi|57526735|ref|NP_998186.1| glutaredoxin-related protein 5, mitochondrial [Danio rerio]
    MNSVFRSTARCLRSATWQYKTAHKNGELSVGRARLMCSSAGQKNLEEMVKKDKVVVFMKGTPAQPMCGFSNAVVQILRMH
    GVDNYASYNVLDDQDVRQGIKTFSNWPTIPQVFFNGEFVGGCDILLQMHQSGDLVEELQKLGIRSALLDQEKESK

    >gi|41387146|ref|NP_957099.1| peroxiredoxin-6 [Danio rerio]
    MPGILLGDVFPNFEADTTIGKIKFHEFLGNSWGILFSHPRDFTPVCTTELARAAKLHEEFKKRDVKMIALSIDSVEDHRK
    WSEDILAFNQDKACCPMPFPIIADDKRELSVLLGMLDPDERDKDGMPLTARCVFVVGPDKRLKLSILYPATTGRNFDEIL
    RVVDSLQLTATKKVATPVDWKPGQEVMVIPSLSDEEANKLFPAGFTLKEVPSGKKYIRYTKP

    >gi|41282163|ref|NP_922915.2| protein disulfide-isomerase A6 [Danio rerio]
    MRALLGVLACSLTVLSAYGLYTSSDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKSLAPEWKKAATALKGIVKVGA
    VDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGRTNQAIVDAALNALRSLVKDRLGGKTGGSDYSRQSGGGAGNKK
    DVVELTDDNFDRTVLESDDVWLVEFFAPW
    CGHCKNLEPEWTAAATEVKEQTKGKVRLAAEDATVHQGLASRFGIRGFPTI
    KVFRKGEEPEDYQGGRTRSDIVARALELYSDNIPAPELQEVLNEGILKKTCEDYQLCIIAVLPHILDTGASGRNSYLEVM
    KTMAEKHKKKMWGWLWTEAGAQMELEASLGIGGFGYPAMAAINSRKMKFALLKGSFSETGIHEFLRELSVGRGSTATVGG
    GALPKINTVQAWDGKDGELPMEDDIDLSDVDLDDLEKDEL

    >gi|256418974|ref|NP_001020635.2| phosducin 2 [Danio rerio]
    MSDRIVDEDPVTVTHTGPKGVINDWRKFKLESMDQEALPPNKRELLRQMSSPQKPKDSCVGGLNRKMSAQEYELIKEEDE
    KSLRKYRKQCMQEMHERLSFGPKFEGVYDLDSGEAFLEVIEKEHRLTVVVVHIYKDGVPG
    CEALNSSLDCLATEYASVKF
    CRICACDTGAGDRFCDDVLPALLVYKAGELLGNFLAVTQHFSEEFFATDVEAFLNAYGLLPEKECGPGAEEDEADVE

    >gi|130492918|ref|NP_001076362.1| peptide methionine sulfoxide reductase [Danio rerio]
    MVARTSVRLIWRQFIQSRMGEMSSKVQMISPEEALPGREQSIKVSAKHDVNGNRTVPPFPEGLQMVLFGMGCFWGAERKF
    WRQKGVYSTQVGYSGGYTPNPTYEEVCTGKTGHTEVVRVVFEPQKIKFSELLKVFWESHNPTQGMRQGNDVGTTYRSSIY
    TNTQEQLEQALQSREEYQKVLTEEGFGAITTEITMAKEFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPIGLKSKH

    >gi|47086245|ref|NP_998062.1| chloride intracellular channel 5 isoform 2 [Danio rerio]
    MAANVQENIYEQVQEKTENIYEKPYDKTTNAEPKYENHDAGQQSPEEPIYSTLDQPEYTPDYMDTRGTSPDEEDQPSASS
    DREETSDSGVMVASLSNGDGDGYGSGRSSSLENYGDPCDDQPTLAQDDLLMAFSLPEDGSPEPEEIVDYSLKNMESCAAA
    EETTEVADPNQPQVALFVKAGSDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVK
    TDVNKIEEFLEEVLAPPKYPKLAARHRESNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKALKKLDEYLNSPLPDEVDA
    DSMEEEKASNRRFLDGNDLTLADCNLLPKLHIVKVVAKKYRNFDIPSDLTGVWRYLNSAYAQEEFTNTCAADNEIESAYL
    DVAKRLTK

    >gi|147903237|ref|NP_001091668.1| chloride intracellular channel 5 isoform 1 [Danio rerio]
    MGDGQEPDIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNK
    IEEFLEEVLAPPKYPKLAARHRESNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKALKKLDEYLNSPLPDEVDADSMEE
    EKASNRRFLDGNDLTLADCNLLPKLHIVKVVAKKYRNFDIPSDLTGVWRYLNSAYAQEEFTNTCAADNEIESAYLDVAKR
    LTK

    >gi|292624896|ref|XP_002665817.1| PREDICTED: chloride intracellular channel 5-like [Danio rerio]
    MGDGQEPDIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNK
    IEEFLEEVLAPPKYPKLAARHRESNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKALKKLDEYLNSPLPDEVDADSMEE
    EKASNRRFLDGNDLTLADCNLLPKLHIVKVVAKKYRNFDIPSDLTGVWRYLNSAYAQEEFTNTCAADNEIESAYLDVAKR
    LTK

    >gi|292624900|ref|XP_002665801.1| PREDICTED: chloride intracellular channel protein 5-like [Danio rerio]
    MAGNVQENIYEQVQEKTENIYEKPYDKTTNAEPKYENHDAGQQSPEEPIYSTLDQPEYTPDYMDTRGTSPDEEDQPSASS
    DREETADSGVMVASLSNGDGDGYGSGRSSSLENYGDPCDDQPSLAQDDLLMAFSLPEDGSPEPEEIVDYSLKNMESCAAA
    EETTEVADPNQPQVALFVKAGSDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVK
    TDVNKIEEFLEEVLAPPKYPKLAARHRESNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKALKKLDEYLNSPLPDEVDA
    DSMEEEKASNRRFLDGNDLTLADCNLLPKLHIVKVVAKKYRNFDIPSDLTGVWRYLNSAYAQEEFTNTCAADNEIESAYL
    DVAKRLTK

    >gi|41053764|ref|NP_957432.1| thioredoxin-like 1 [Danio rerio]
    MVGVKVIGNDSDFQAELSGAGSRLTVVKFTMSGCRPCVRIAPAFNMLSNKYPQVVFLEVDVHVCQATAAANNISATPTFL
    FFRNKVRVDQYQGADASGLEEKIKQHVENDPGSNEDSDIPKGYMDLMPFVNKAGCECLNESDDCGFDSCLIKDATYLESD
    CDEQLLITMAFNQPVKLFSMKLLSADFAQAPKSVKIFINLPRSMGFDDAERSEATQSLDLSEEDYKDDGLIPLRYVKFQN
    VNSVTLFIKSNQGDEETTKINYLTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|54400390|ref|NP_001005942.1| glutaredoxin-1 [Danio rerio]
    MAEFVKAQIKDGKGVVFCKPTCSYCILAKDVLSKYKFKAGHFELIDISARADMGSIQDYLQQITGARTVPRVFIGEDCVG
    GGSDVEGLDRSGKLEGMLQAIGCLQ

    >gi|41054774|ref|NP_955818.1| chloride intracellular channel protein 3 [Danio rerio]
    MAEAAKIELFVKASDDGESVGNCPFCQRLFMILWLKGVNFTLTTVDMKRAPEVLKDLAPGSQPPFLIYNGEVRTDTNKIE
    EFLEDTLAPPQYPKLCCRYKESNTAGDDIFHKFSAYIKNPNPGLNDMLEKKFLKSLMKLDQYLLTPLPHELDQNPELSTS
    TRHYLDGNALSLADCNLLPKLHIVKVVCKKYRGFEIPAELKGLSKYLDKAYKEDVFHLTCPKDKEILLAYSSVAKYLNK

    >gi|66773128|ref|NP_001019577.1| peroxiredoxin-5, mitochondrial [Danio rerio]
    MPIKVGQRLPAVEVQEEDPGNSLSMAELFSCKRGVLFGVPGAFTPGCSKTHLPGFIQMAGELRAKGVDEVACISVNDVFV
    MSAWGKQNGADGKVRMLADPTGAFTKAVDLVLNNAQLIPVLGNLRSQRYAMLIENGVVTKLSVEPDGTGLTCSLASNFLA
    EV

    >gi|189534157|ref|XP_001920911.1| PREDICTED: apoptosis-inducing factor, mitochondrion-associated, 3-like [Danio rerio]
    MESLCYERTRGGTEDSVRGRKSSSTGDTVLGRARGESLEAGLDPEEEVTNVVCDDADLRDGEMMEVEVGDHNVLLVRCDG
    VYSAISNQCTHYGAPLSEGVLSGCRVRCPWHGSCFNVKTGDLEEYPGIDCLPCHKVKVENNKVYVSVKKRIRGQPKRVKW
    MGVRDQSVSHTVMLLGGGAACLMCAETLRQENYGGRIIMVSRDDLLPYDKTRLSKVMNAESDSLLMRRMDFFHKHDIEVW
    LKKEALSIDTNKKTVTFDDGLIQSYDQILIATGCRAKGLDCPGANLERVLMLETPEDAR
    CVHYACTGCRTVIVGTSFIGM
    EVAAYLLDTSSSMTVIGSSELPYQKTLGREIGKVTMTMLEEKGVTFYMNDAVAEVQGKNRRVKAVKLKSGITIEADLLIV
    AIGVSPNSEFLKGSRVRMDSKNYVIVDEYMRTNITDVYCAGDLTSFPLKMAKGQKVSLGHWQIAQAHGRIAALNMLCREV
    ELNTVPYYWTVLFGRTIRYAGYGEGYTEMVLKGKFENMKFLALYLKDGEVVAAAGLNVEPAVSVVAERLAEGRVITKAEA
    ESDDLSWLKLEPM

    >gi|148922883|ref|NP_001092245.1| hypothetical protein LOC100073339 [Danio rerio]
    MSSAPRRFRCFALCLCVISGLITLSDVCASEAAAPPDVELQAAAALHSQSAEVQERPGPREPCVEEPQEPLELRPAVSHA
    DTAENQNQSFSEAAKTFKVNCEKRNISAEEQLTVQVPNASQDLMDLLNANSSECSLVLFYTGW
    CPFSASLAPHFNALPRA
    FPSMHFLALDASQHSSLSTRFGTVAVPNILLFQGVKPMARFNQTERTLETLTAFISNQTGFEASVGQCVLPEDHAGPLPA
    VPVRSIDWLFVFSVLFILGFALYAALCTDSIRWLIPGQDHEHQE

    >gi|218751897|ref|NP_001007283.2| glutathione peroxidase 4 [Danio rerio]
    MRFLGSAVVFSLVLQTMSAQLEDWQTAKSIYEFTATDIDGNEVSLEKYRGKVVIITNVASKCGKTPVNYSQFAEMHAKYS
    ERGLRILAFPSNQFGRQEPGTNSQIKEFAKSYNAEFDMFSKIDVNGDGAHPLWKWLKDQPNGKGFLGNGIKWNFTKFLIN
    REGQVVKRYSPLQDPSVVEKDLSKYL

    >gi|50539868|ref|NP_001002404.1| glutaredoxin-2, mitochondrial [Danio rerio]
    MGNFSSSAPGLSSSACGQFVQDIVSSNCVVIFSKTTCPYCKMAKGVFNEIGATYKVVELDEHNDGRRLQETLAELTGART
    VPRVFINGQCIGGGSDTKQLHQQGKLLPLIEQCRPCCLNMTPEGSGNSQNQPHQ

    >gi|47085781|ref|NP_998227.1| ubiquitin-like modifier-activating enzyme 1 [Danio rerio]
    MSSSPLSKKRRVSGSETKTGSHCSSSNSVRTELSHTPANGMAKNGNDAEIDEGLYSRQLYVLGHDAMKRMQSSNVLISGL
    RGLGVEIAKNVILGGVKSVTLHDQGVAEWKDLSSQFYLREEDLGKNRADVSQPRLAELNSYVPVTSYTGTLTNEYLTKFQ
    VVVLTNSSLDEQTRIGEFCHSNGIKLIVADTRGLFGQLFCDFGEVMIVFDTNGEQPLSAMISMITKDSAGVVTCLDEARH
    GFESGDYVTFTEVQGMTELNGCDPVEIKTLGPYTFSICDTSSFSDYVRGGIVTQVKMPKKIAFKSLSSSMAEPEFLLTDF
    AKFDRPGQLHVGFQALHAFEKKHSRLPKPWNQADADELMTLAEEVNAAQTGSAKQEELDQAVIKKLACVAAGDLAPVNAF
    IGGLAAQEVMKACTGKFMPIMQWLYFDALECLPEPEEVILTEEECAPRNCRYDGQIAVFGSKLQELLAKQRYFLVGAGAI
    GCELLKNFAMMGLASGEGEVIVTDMDTIEKSNLNRQFLFRPWDVTKMKSETAAAAVKQMNPSVRITGHQNRVGPDTEKVY
    DDDFFECLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFITESYSSSQDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQPAENALQYLTDSKFMERTLKLPGAQPLEVVESVYKSLVTDRPRNWDDCVTWARNHWQCQYNN
    NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLEFSTNNDLHMDYILAAANLYALSYGLPSCNDRSALTKLLQDIKVPEFT
    PKSGVKIHVSDQELQSANASVDDSRLEELKTLLPSLEASSQFKLCPIEFEKDDDTNFHMDFIVAASNLRAENYDIPPADR
    HKSKLIAGKIIPAIATTTAAVVGLVCLELLKIVQGHKKLESYKNGFMNLALPFFAFSEPIAAPKHKYYEIDWTLWDRFKV
    KGIQPNGEEMTLRQFLDYFKNEHKLEITMLSQGVSMLYSFFMPAAKLKERLELPMTEIVTKVSKKKLGKHVKALVFELCC
    NDDTEEDVEVPYVRYTIR

    >gi|47087632|ref|NP_998181.1| thioredoxin domain-containing protein 5 [Danio rerio]
    MEAPPAYVVKVDCTKDTKFCSSEHGIRGYPTLKLFKPEQEAVKYQGPRDLQALENWMLKTLQEEPEEPQSEPEPPKVPEP
    KQGLYELTATNFKSHIAKGSHFVKFFAPW
    CGHCKAMAPTWEQLASSFEHSDSIKISKVDCTQHYEVCSDNQVRGYPTLLF
    FTDGEKIDQYRGKRDLDSFKEFVDNHVKAAESKDEPEKEEEHTHEIPPSAEPEKQESNVLVLTESNFDETVAKGLSFIKF
    YAPW
    CGHCKNLAPTWDDLSQKEFPGLTDVKIAKVDCTVERTLCNRFSVRGYPTLLMFRAGQQGEEHNGGRDLESLHSFIM
    KQARDEL

    >gi|47086197|ref|NP_998086.1| methionine-R-sulfoxide reductase B2, mitochondrial precursor [Danio rerio]
    MSRFLVRLSTVVSKGATGKSVLPQKRIFAGIRLISSSTGLQSLTRYDQSTDWQRKLSPEQYVVTREKGTEVPFSGIYLNH
    NEVGMYHCVCCDSPLFSSEAKYDAGAGWPSFCEAHGTWEKDESHANIVRRPDNSLGSTGTEVICKHCDAHLGHVFEDGPD
    PTGQRF
    CINSVALNFKPREK

    >gi|41054259|ref|NP_956073.1| protein disulfide-isomerase A4 [Danio rerio]
    MKKITLLLIMLLGVTHFIKPHRCEDDAKDDSAEDLGEEEDDDDDDDDDDDEDADDTEVKEENGVLVLTDANFDTFIEGKD
    TVLVEFYAPW
    CGHCKQFAPEYEKIAQTLKENDPPIPVAKVDATKASGLGSRFEVSGYPTIKILKKGEPLDYDGDRSEHAI
    VERVKEVAQPDWKPPPEATLVLTKDNFDDVVNNADIILVEFYAPW
    CGHCKGLAPEYEKAAKELSNRTPPIPLAKVDATAE
    SDLATRFGVSGYPTLKIFRKGKAFDYNGPREKFGIVDYMSDQAGPPSKQVQTLKQVQELLRDGDDAVIVGVFSSDEDAAY
    EIYQEACNSLREDYKFMHTFNNDVTKFLKASPGQVVMLQPEKFRSKHESASHSLTIKDSTPASEVQDFFKKHILPLVGHR
    RQSNDAKRYTKRPLVVVYYGVDFSFDYRVATQFWRSKVLEVAKDFPEYTFAIADEEDYADELKSLGLSESGEEVNVGIVG
    EGGKKYAMEPEEFDSDVLRSFVMAFKKGKLKPIVKSQPLPKNNKGPVKVVVGKTFDEIVMDSKKDVLIEFYAPW
    CGHCKK
    LEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGKRDVEEFSKFVEKHATKLSH
    KKDEL

    >gi|125853284|ref|XP_001340407.1| PREDICTED: thiosulfate sulfurtransferase KAT-like [Danio rerio]
    MVSFQILRRLGVFALTKPVCHGRILSACGIKTSNINHSHGQPGAVSVVTYEQLKGMLANHSVQLFDVRNPDEFQAGRIPD
    SVNVPLGELEVSLKLPAEKFEEQFKVKAPQKADDNIVFH
    CRSGKRSLTALETAHRLGFSKARHYAGGYIDWEEREKN

    >gi|292627716|ref|XP_002666723.1| PREDICTED: UPF0308 protein C9orf21 homolog [Danio rerio]
    MAAVHPITRQISSSVQDNKQASHNICLSELKNCFIFDRHGDKKSFSSLFEHNKAIVIFVRHFLCYTCKEYVEDLGKIPQH
    VLQDSNVRLVVIGQSSYSHIQGFCSLTGFPHEIYVDPERQIYKRLGLRRGETYMETPSVSPHVKSSMLSGSLKSVWRAMT
    SPVFDFQGDPQQQGGALIVGPGPDVHFAHFDMNRLDHMPINWLLQLAGLPALDFSDSPKIINI

    >gi|47087029|ref|NP_998528.1| SUMO-activating enzyme subunit 2 [Danio rerio]
    MAELVGPLRKQLADSLSSCRVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKES
    VLRFCPSANITAYHDSIMNPDYNVEFFRNFQLVMNALDNRAARNHVNRMCLAADIPLIESGTAGYLGQVTVIKKGQTECY
    ECQPKPTQKTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPADAAARATASDQDGDIKRVS
    TKEWARSTGYDPIKLFNKLFKDDIMYLLTMDKLWKKRKAPLPLEWEEINQLGSQEQVIGSGLKDQQVLGVQGYAQLFQHS
    VETLRSQLKEKGDGAELVWDKDDPPAMDFVTAASNLRMNVFSMNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEALKI
    LNSDFEQCRTIFLNKQPNPRKKLLVPCALDPPNASCYVCASKPEVTVKLNVHKTMVQALQDKILKEKFGMVAPDVQIEDG
    KGTILISSEEGETEANNNKFLSDFGIRNGSHLQADDFLQDYTLLVNVIHSEELEKDVEFEVVGDAPDKAPAPSAPEEGKN
    IANGNKDSAQPSTSSKAAVEDDDVLLVDSDEEPSSSTMDTESSNRKRKHHDAETDDASSKRKRLDQQPADDDDEDIIALD


    >gi|292628121|ref|XP_002666857.1| PREDICTED: ubiquitin-like modifier activating enzyme 2-like [Danio rerio]
    MAELVGPLRKQLADSLSSCRVLVVGAGGIGCELLKNLVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKES
    VLRFCPSANITAYHDSIMNPDYNVEFFRNFQLVMNALDNRAARNHVNRMCLAADIPLIESGTAGYLGQVTVIKKGQTECY
    ECQPKPTQKTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDTADPEAAWNPADAAARATASDQDGDIKRVS
    TKEWARSTGYDPIKLFNKLFKDDIMYLLTMDKLWKKRKAPLPLEWEEINQLGSQEQVIGSGLKDQQVLGVQGYAQLFQHS
    VETLRSQLKEKGDGAELVWDKDDPPAMDFVTAASNLRMNVFSMNMKSRFDVKSMAGNIIPAIATTNAVIAGLIVLEALKI
    LNSDFEQCRTIFLNKQPNPRKKLLVPCALDPPNASCYVCASKPEVTVKLNVHKTMVQALQDKILKEKFGMVAPDVQIEDG
    KGTILISSEEGETEANNNKFLSDFGIRNGSRLQADDFLQDYTLLVNVIHSEELEKDVEFEVVGDAPDKAPAPSAPEEGKN
    IANGNKDSAQPSTSSKAAVEDDDVLLVDSDEEPSSSTMDTESSNRKRKHHDAETDDASSKRKRLDQQPADDDDDDEDIIA
    LD

    >gi|41393167|ref|NP_958914.1| dihydrolipoyl dehydrogenase, mitochondrial [Danio rerio]
    MQSRNHLYRTLATRGQHLPCKLHGATVLSARTYADKAAIDADVTVVGSGPGGYVAAIKAAQLGFKTVCVEKNATLGGTCL
    NVGCIPSKALLNNSYLYHMAHGKDFESRGIEIQGISLNLEKMMAQKSGAVKALTGGIAHLFKQNKVTHVNGFGTITGKNQ
    VTAKTADGEQVINTKNILIATGSEVTPFPGIEIDEDSVVSSTGALSLKNVPEELIVIGAGVIGVELGSVWQRLGAKVTAV
    EFLGHVGGMGIDMEISKNFQRILQKQGLKFKLSTKVMGATKRPDGKIDVAVEAAAGGKNETLTCDVLLVCIGRRPFTGNL
    GLESVGIELDKRGRIPVNGRFQTNVPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWV
    GKTEEQLKEEGVPYKVGKFPFAANSRAKTNADTDGLVKILSHKDTDRMLGAHILGSGAGEMINEAALAMEYGASCEDVAR
    VCHAHPTVSEAFREANLAASFGKAINF

    >gi|148277081|ref|NP_898895.2| thioredoxin reductase 3 [Danio rerio]
    MPPIENDAGREQIRSKIKELIDSSAVVVFSKSFCPFCVKVKDLFKELNVKYNTIELDLMEDGTNYQDLLHEMTGQKTVPN
    VFINKKHIGGCDNTMKAHKDGVLQKLLGEGSEVYDYDLIVIGGGSGGLACSKEAATLGKKVMVLDYVVPTPQGTAWGLGG
    T
    CVNVGCIPKKLMHQTALLGTAMEDARKFGWEFAEQVTHNWETMKTAVNNYIGSLNWGYRVSLRDKNVNYVNAYAEFVEP
    HKIKATNKRGKETFYTAAQFVLATGERPRYLGIPGDKEF
    CITSDDLFSLPYCPGKTLVVGASYVALECGGFLAGLGLDVT
    IMVRSILLRGFDQDMADRAGEYMETHGVKFLRKFVPTKIEQLEAGTPGRIKVTAKSTESEEVFEGEYNTVLIAVGRDACT
    GKIGLDKAGVKINEKNGKVPVNDEEQTNVPHIYAIGDILEGKWELTPVAIQAGKLLARRLYAGATMKCDYVNVPTTVFTP
    MEYGSCGHPEEKAIQMYGQENLEVYHSLFWPLEFTVPGRDNNKCYAKIICNKLDNLRVIGFHYLGPNAGEVTQGFGAAMK
    CGITKDQLDNTIGIHPTCAEIFTTMEVTKSSGGDITQSGC
    CG

    >gi|148226847|ref|NP_001082894.1| peroxiredoxin-4 [Danio rerio]
    MDVSRCVKTPREWLGVLWALLLLSESVVCDGANGKREQECYNYAGGHVYPGEAFRVPVSDHSLHLSKAKISKPAPHWEGT
    AVINGEFKELKLSDYKGKYLVFFFYPLDFTFV
    CPTEIIAFSDRVHEFQAINAEVVACSVDSQFTHLAWINTPRKQGGLGP
    MKIPLLSDLTHQISKDYGVFLEDQGHTLRGLFIIDGKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKP
    GSDTIIPDPAGKLKYFDKLN

    >gi|71834466|ref|NP_001025330.1| hypothetical protein LOC792311 [Danio rerio]
    MQKYDRGFLWISALFLTLAGRGDAQADASNVVTVADANWTLILQGEWMIKFYAPWCPACQHLQADWENLGRQSDSLGISV
    GRVDVTQQPGLSGRFLVTTLPTIFHAKNGDFRKYVSSRTIEDIQAYVVHRKWATVEPVPGWKSPSSLLMSGMAHLFRLSV
    WIRQIHTYLTNTLGIPSWGSYVIFAIITLFMGLVLGLMLVLIADCIWPSRPKRRQDQTVVTVKEDVSEEEEEEKQDLESE
    RVSEESTEEETADADADTDAETTVRRRVQNKSTTEGT

    >gi|115495797|ref|NP_001070106.1| ERO1-like protein beta [Danio rerio]
    MFGERCRFCEASLLALGLFGLLHSEQLTGVLDDCFCDIESIDVFNNFKIYPHIRKLTERDFFRYYKVNLKRPCPFWPDDS
    H
    CSIKDCHVEPCPESKVPVGIKSGNYNKYSHAANTVSEMRECEQAHELGAINSTLSNQSKEAFADWAHHDDAQDHFCGLD
    DEMSPESEYVDLLLNPERYTGYKGPSAWRVWNSIYEENCFKPRSVYRPLNPLAPVRGDDDGEGFYNWLEGLCLEKRVFYR
    LISGLHSSINIHLCAKYLLDEGWGKPVWGPNVHEFRQRFDPAETKGEGTRRLKNLYFLYLIELRALSKVAPYFERSFINL
    YTGNTEEDTSTKQLLLEILNETKAFPMHFDENSMFAGHKIESKTLKEEFRLHFKNISRIMDCVGCSKCRLWGKLQTQGLG
    TALRILFSEKEIKKLPENSPSKGFQLTRQEIVALLNGFSRLSTSIKELHNFRTLLKDHR

    >gi|292630163|ref|XP_002667762.1| PREDICTED: glutathione reductase-like [Danio rerio]
    MPSYDYDLFVIGGGSGGVRSGRVAASMGKKVGIAEEYRYGGTCVIRGCVPKKLFVYASQFHEHFEDSAGFGWTVGETSFD
    WAKLIAAKDREIDRLEGLYRKGLENAKAKVFDSRAELVDAHTVRLTKTGQTVSAEHIVIATGGTPNPHADLPGHEL
    CISS
    NEAFHLEKLPKSILIAGGGYIAVEFANIFHGLGVETTLIYRGKEILSRFDGDLRRGLHNAMTAKGIRIICQDIMTQVSRD
    GEGLVAETKEGETLRVDTVMLALGRDPHTRGLGLEAAGVATDAHGAIIVDEYSRTSVPHIFALGDVTDRVQLTPVAIHEA
    MCFIETVYKDNPTKPDHDLIATAVFSQPEIGTVGLSEETAAERYAEIEVYRAEFRPMKATLSGRQEKMLMKLIVNAADRK
    VVGAHILGHDAGEMAQLLGITLKAGCTKEDFDRTMAVHPTAAEELVTMYNPSYRIRNGERV

    >gi|80751153|ref|NP_001032200.1| thioredoxin-like protein 4B [Danio rerio]
    MSLFLPKLSSKKDIDEAIKSVAEKVLVLRFGRDEDSVCLQIDEILSKTAHDLSNMASIYLVDVDSAPVYSRYFDISFIPS
    TVFFFNGQHMKVDYGSPDHTKFVGSFKSKQDFMDLIEVIYRGAMRGKLIVQSPIDPRNIPKYDLLYHDI

    >gi|54400404|ref|NP_001005953.1| thioredoxin-like protein 4A [Danio rerio]
    MSYMLPHLHNGWQVDQAILSEEDRAIVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY

    >gi|292627324|ref|XP_688223.3| PREDICTED: DnaJ homolog subfamily C member 16-like [Danio rerio]
    MRTVVGLLSVIMLYVLLNDATVESTAEFDPYKVLGVTRSASQAEIKKVYKRLAKEWHPDKNKNPEAEDMFIKITKSYEIL
    TNEEKRASYDRYGQTDDTQPYGHRHHGFRHFHDNFYFDESFFHFPFNNKGGRDFADSKYTLHFNQYVNEVVPDSFKRPYL
    IKITSDW
    CFSCIHIEPVWKETVQELETLGIGIGVVDVGYERRLANHLGAHQTPSILGVVNGKVSFFHYAVVKEHLIQFVD
    DLLPQRLIEKVTDKNNHEFLKSWHELNKPHVLLFDQVPSVPLLYKLTAFAFKDYVQFGYVDQGLSETAELLRKFNINTYA
    PTMLVFKEDVEKPADIIQAKGMKKQIIDEFISNNKFLLAPRLVNQKLFDELCPVKQFHRRRKYCILLITGEDESYIPGNE
    AFLLLASANANDVLRFAYVYHRRQQPLCDILLKDKDDTAPQQVVILERRNGAGKILYKPLLGGWNGSKEDKHKLLEELQR
    LQKDPSILNYNAILPELNNEFASMFLVRWIYTAYDYLSEIIDDLLHNNWREMMPLLSLIFSALFILFGTVVIQAFSDSSE
    EKQPKMKVKETKSENGSPNTSNASSRPPKKNFVEVTELTDITYTSNLVKLRPGHINVVLVLTDGTKNILLSKFAKEVYSF
    TGSLTLHFSFLNVDKHKEWMAAVLEFAQDAMQIDTDEDEMGTRKVDYTGYVLALNGHKKYLCLFKPVYTGEDLDGKAEEE
    GGVSRSRKSTTRSRSTSLQIHHKLDRLGLWMERLMEGTLPRYYVPAWPGLDKITVNK