Cryptosporidium parvum

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|66361930|ref|XP_627929.1| protein disulfide isomerase, signal peptide plus possible ER retention motif [Cryptosporidium parvum Iowa II]
    MNYIIFLHTAYLILARISFGFGEELRLSNSNNFGKNDINNGNNSLYVSNSTNNNSSNNRFTTTTTTTTTVSTLMTANTII
    NKSNEIDVGFQITTPGPKYVQNLLNAGGVSNSESLVKQLGLEDLSEFTKIDSVVLFYVPW
    CVYCRGIMPEFEKAANIFKG
    KKISFGKIDCNEHRKVVLLEQVIRFPTIKIYSEGQSQYYSGLPNSVSIVNFVNSEFNRDISISSLSVLEVFLNTDNSSIK
    AVAIVDHENNDESDSMSLVSSSYSKLSHKYHNIFFAHTLTNNTEVLNFIKNYSKDNNKSRNVINHSNSIKENTLAIFTPW
    DDNSDKQDDFNKNDGNKHGLILIDKVDFSNFENLEKQILKYQYPLITEFDPLIAQKLFLGEKTISFLFVNNDVPNLKLIM
    EKYREIARQFRGEILFVKSGTNLAHERRIAQVLIPEECKLPCISIIKFPSVDEGKMIAPTLPNMPPMKRPQAPLIYRCRF
    SGPDLLKNSNLEHFIQDFVSGRLNPYFKSEEPPSEEDNDGPVRIVVSKTFKKEVIETNLDVLIVFYAPW
    CGHCRKLEPDY
    NVLAQRLRGISDKLKIAKIDGSQNEVENIQILGYPSILLFKSEMKTEPILYNGDRSVANMIEWISKNASFKFDHMQYLNP
    ELAFEDDDLDMAISHEL

    >gi|126644130|ref|XP_001388201.1| SUMO-1 activating enzyme subunit 2, putative [Cryptosporidium parvum Iowa II]
    MNLFENVKKVLGEELFFKIQLAKILVVGAGGIGCELVKDLILSGFSNITIIDMDGIDISNLNRQFFFRRKHVGMNKSTVV
    ALEAKKLFNKCNSDNHKVSNIVGIVGNIMDYNTEFFSQFDVVLNALDNISARSYVNKICIASNIELIDSGSAGYNGQVHP
    IIPRVSRCYECYPPPTQKTFPV
    CTIRSVPDKPQHSIAWSKYLFDIVFGVRHDEKEDSDNILSDISKKVQIDLDSLKQLEK
    NEASEYIENYIVNMFNFLFYSEITLLANNQEMYISNNKKIPIPISWDDIQRKNYIDRVINSEDDLVNSEQKVFSIKENAE
    LFFNSARKIIINRMNEIGTASLCFDKDNKDAMDFVSAASNLRSYNFHIPLQSRWSCQSIAGSIVPAVASTNAIVSGVQIA
    QLLLMLKSKLSSLTNPEAGNSDCSSNNKLLFVNKFVWIRSIPMGRFIICPESLEKCNPKCLICSQVLVKIKIVSFDKWNL
    MEFVKGIICQHLKLSEPSVELNGKCIWDPDLLEDDHFIKYSSQRSLINWKFSDGCIVSITDFSCGEFQCDAIINICDENI
    IKSEKDFQTYEKNGELFTITIESSKTSSNDSCSDYLSSESSDDEILSEFQGNLDNSSIRKRSFNASENVENTPKKRR

    >gi|66358556|ref|XP_626456.1| glutaredoxin related protein [Cryptosporidium parvum Iowa II]
    LKNIDTAMNSIKLLVESFISSGDICVISKSYCPYCIKAINSLKSAGYSPLVMQIDGRVDTKEIQDYCRELTGSGTVPRVF
    VKGRFIGGCDDTLKLLEDGSLSSFVETI

    >gi|126644228|ref|XP_001388233.1| heat shock protein DnaJ Pfj2, putative [Cryptosporidium parvum Iowa II]
    MLCVLFVLRLVLLIVIPVIAGKDYYKILGVPRNANENQIKRAYRKLSLKYHPDKNPGSKEKFMEVANAYEVLVNPETRRK
    YDAFGEEGLKSEGFGGGGDGGFDFGGFGGFGGFGDFGGFKFSAGGNTFHFGGGGPFGFGGGGGGRRQGSNSRSHFESQGS
    SYNNLYSDSKHVTELSTMSAGEIKDKIKSREWIMIVNFYRPG
    CGPCKQLVQAYGNIAKLMSQYDVEFGAVNCDTHFQLCQ
    SYNIEKYPHLSMFIKGKNSQIVFNPSPGSKNPYSESNIGKWITEKMPDHSMRLNSYNQAIQWLRLGKHIPKAVLFTNKDS
    SSPLLKKIAKDFQNRLNLAIVSINNDWLKKIFFASPHMEASKPANPPYILSVDEINESGNKVGGKATESSSITASGEWIS
    LNTISHDVITLTLSRIVGSFRARKQHDINEALKSKVQELTFELVTSKGFCSETDSRFCVILIMEKNDFRMDKRFEDLSFK
    YRNDPINFFWISAFRNGKNSHFLDTFKCHSEFSPSSKTCIAIYRAKRRKFQTFDNLEQLPKFIDGLLDGSHSLSSNIPRS
    TPIPVPAESEPTASYQNDEEDHEYSDSEDSDYGQESSRDEL

    >gi|66358866|ref|XP_626611.1| thioredoxin reductase 1 [Cryptosporidium parvum Iowa II]
    FFVRVMKFTLVTILFLIFMKKAKIVMADLTFMYDLVVIGGGSGGMAAAKEAAKYGKKVALFDFVKPSTQGTKWGLGGTCV
    NVGCVPKKLMHYSALIASSIHHDAQMFGHKTSSSFEWGKLVETLRNHIRMLNFSYRTGLRVGNVEYINALAKLIDPHSVE
    YEDNGQKKTITSRYILLATGGRPSIPETVPGAIQYSITSDDIFFLSKSPGKTLVIGASYIGLETAGFLNELGFDTTVAMR
    SIPLRGFDRQCSEKIVEYMKATGTKFLVGVVPINIEKVNENIKVSFSDGSVEEFETVLYATGRNPDVKGLNLNAIGVEVS
    DSGKIIAPKDATSVPSIFAVGDIVEGRPELTPVAVKAGILLARRLFAGSNEFIDYDFVPTTVFTPIEYGHVGLSSEAAIA
    KYGEDDIEEYLSEFSTLEIAAAHREKPEHLRENEMDFALPLNCLAKLVVVKSQGEKVVGFHFVGPNAGEITQGFSLAVKL
    GATKKDFDDMIGIHPTDAEVFGILEVTKRSGESFVSSGGCGGGKCG

    >gi|66358906|ref|XP_626631.1| glutathione peroxidase [Cryptosporidium parvum Iowa II]
    MGNFLASTKITTDLASKSVYSYTLTTLEGNPFPMESLKGKVVMVTNVASKCGYTKSYYKQMVRIYSVFAPLGLEIIGLPS
    REFMGQEFEDPKEIRKFADSHNVKFPLMEICKVNGPDALEFVQKLKRETPELYDEKSNTLSAIKWNFSRFLIDKNGKVVA
    FRGTRTEPNELIPKIAELLGVSDYQNLFKNYDKLHPESGYDPKDDVCPLKQKQSEQGS

    >gi|126645720|ref|XP_001388054.1| thioredoxin peroxidase-like protein [Cryptosporidium parvum Iowa II]
    MSTLVRKLAPNFTAEAVMADGSFKKVSLSDYRGKYVVLFFYPLNFTFVCPSEILAFNQAQKDFEKLGVQLLAVSVDSQYS
    HAAWRRTPLEQGGIGPVNFPLISDSSHSISKNYGVLLEEEGIALRGLFIIDKEGVVRSEVIYDLPLGRSVEETLRVIDAL
    QFTETYGEVCPANWKKGQKGMSATHEGVSSYLKDSF

    >gi|66357054|ref|XP_625705.1| conserved hypothetical protein [Cryptosporidium parvum Iowa II]
    MWGLNNINRSTTSFILIYITSLLFLLLLFETKHVVSDNTSELNDTLNSNTKFINLSSNKSNKDNTEDLIPFIESHFTSAK
    GIDLEEVIDDNSHVNENITNKIFEIVTIQTDESFENLLANNDYLIILFTAPWCGMSKRAINQIHEMVKYFEHSNDFSIEH
    PNRFFYSKKLLIGLVNVPEFPNLSMKLNVLDYPTIKLVKKEENQKLKIIDFYGNIYHKKVISWIIQQISRLENNPKSQLI
    QLSTIDNIKFFLEISGYSVIYLHEFESQKKYNNTEYLLVVDICKIYDDVIFGEANYNDLKKSLLINKDILDKNEFQFNIT
    DIIENHEKKSKILLFNSGKHVKTINGPFKEEALILNTIDYYKQENIIFLNKDTIGNLIDNGGTILLLIFSGNSENYIEEL
    NKESSIIHQFYNILQRVIAIRNEKADKSNKYLEERPLFVMSGNEGPINRRFMDFLHIDDDLLPSIIMINDLNVSPPKKYH
    LDLPKIYLNNLESNTGIGGITSSNNNAEILSIGKPNESNWIILNNHTSINFSPNIISDFIDEVRSGMVNITYHSQVTPSK
    QNGPVFILVGNTFKEIVYDSTRDVLVLFYTPW
    CGHCKTFDPIYNEVANIVTSKTNVLVAKIDMSANFIPDDQIGRKIFRF
    PTIKLYKKREKANPIDFDGEREVNSILDFIWIHTARDEL

    >gi|66357166|ref|XP_625761.1| possible thioredoxin H-type of possible fungal or plant origin, small protein [Cryptosporidium parvum Iowa II]
    YFFPTIFEFLEYKAYISRQGLVVVDYFATWCGPCNMIAPKLEEFSEQVKDVCFIKVDVDSLPSIADAESVRAMPTFKFFL
    NGKEVKSVVGANFEIIQQAVLANKP

    >gi|66357608|ref|XP_625982.1| hypothetical protein with signal peptide [Cryptosporidium parvum Iowa II]
    MKKVSTIFSAIIISLIAIGVGLVKFNYLNISEYGLLEKLITPQNEIPDDVGPKTMTIQYCDTCGTRNLYQQVQSYLSSRV
    TDPDFQLIAVKYKPSPLYQGLSYAITASQVGLGLSAFLFPSLFTPTDQQGQPQGGPRTHLMMLIFFGGNILRGLFTNSNA
    FEIYLGKDLVYSAIQNNSSGYATPPTLEQVVTILNEHGISVLETLTE

    >gi|66357688|ref|XP_626022.1| thioredoxin domain containing protein [Cryptosporidium parvum Iowa II]
    MIICLGPFCIPVWNIFLFLFALIGPIINFLKRIFLGKKSNIKNRGELTIGNHEKILEEKDLAEIGIESHLFRESYEKILK
    LVESRNVLELENINDWEICKLLGKNLELPILVDYYADW
    CNPCKKISTTFKKLCKEYNGIFIKIDYETHTNFCYDMGVFSL
    PTFHFWILDNNSYILVDKLERSDSKELENLLVKNKFKIIK

    >gi|66357966|ref|XP_626161.1| membrane associated thioredoxin [Cryptosporidium parvum Iowa II]
    MKLKLAVLNLILLLVIGIRGDEINASINGHNRAQRHAKPTASASSYTPQKHHPTVSVNSEKKIQSFVKELNDNNFEHLTQ
    SATGSTTGDWFVLFYLPN
    CQQSQMSLVELDKLSVIARESLNVAKIDVSKNQQLINRFGIVAVPSFRFFRNGKMYTYTGMR
    NAEVIKAFIWNKDYKKLTPQPVPDPLSTLDIIISEIKHTINDINKLIKLAPLVTIIILLIGFFTGIGVTNIFSRNSNRSK
    TTTSNNRVKRDKYSDDECEDHEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
    EAPKQLKTPQRGRRAAENIAKEDDRLNNTYNTSVRRSNRLKKL

    >gi|66475170|ref|XP_625352.1| disulfide-isomerase, signal peptide plus ER retention motif, putative ER protein [Cryptosporidium parvum Iowa II]
    MIGIRSLVSAAFLGFSCLSKVVLGGDEAHFISEHITSLTSSNFEDFIKSKEHVIVTFFAPWCGHCTALEPEFKATCAEIS
    KLSPPVHCGSVDATENMELAQQYGVSGYPTIKFFSGIDSVQNYSGARSKDAFIKYIKKLTGPAVQVAESEEAIKTIFASS
    SSAFVGRFTSKDSAEYAVFEKVASGHREHNYAFIAFFQEGEQKLEVLHKDEEPVSLPMPKTVEELEAKISIMNVPLFSAI
    SAENYSLYMSREGYTAWFCGTNEDFAKYASNIRKVAADYREKYAFVFLDTEQFGSHATQHLLIEKFPGLVIQSVNVPSIR
    YMYGPAKFDSVEPLKEFMKQVSEGKHELSIKSEPIPAEQSGPVTVVVGKTFEEIVFRSDKDVLLEIYAQW
    CGHCKNLEPI
    YNQLGEEYKDNDKVVIAKINGPQNDIPYEGFSPRAFPTILFVKAGTRTPIPYDGKRTVEAFKEFISEHSSFPQEKESRDE
    L

    >gi|66475286|ref|XP_627459.1| thioredoxin; protein disulfide isomerase A6, signal peptide, possible transmembrane domain in C-terminal region [Cryptosporidium parvum Iowa II]
    KEKRIMKLYSVLASLSLLLLNFTIQAESQDYPKNENLINLKEYEFKEKVLDDTTDQIWFVKFYAPWCGHCRHLYPEILKV
    SEHYKGNEKVKIAKVDCSVETKLCKEQNVVSYPTMRIFSKGNLIKQYKRPKRTHTDIIKFIEKGIQPDIIKIQSYDQINE
    LSSDLSAYPILLIMFNSETEINQNLEFLEEIVKKNDFEVTIAVTYAKSVKSRVLENTKDHKFSNTDLCLTSPCITMIGKD
    NFSPSILLVKETEFTLNFMQQYRFPFLNAPSRMEFIEYLNSGNLVVIMGIKENVQINHEISGDFITDFGKVAEKVRREMF
    LPIKFSESETPRGILFAIVDFVSYSSLFREFGITNFNFIQGYEIVVSDGLKYYYNRPDMMKIPVLFETIKLISNQDSKVP
    KLKAYSIFNLNTIRRFFYDLNVIISDIFYKSWIHAIAVTVIAFLIVAGLTVFCCLIFFGDLADSYLLHDDMATIEMQNMA
    PSSEKKVINNKDEKSDNELENSSLSDTVRFSDEEPELEEPRKER

    >gi|66475834|ref|XP_627733.1| glutaredoxin-like protein; 2 thioredoxin folds [Cryptosporidium parvum Iowa II]
    MSTTLNSFVGITDFVLGNCLSAILILSGKEEIDGSLLELENVLQESFSNVKFGKISPSGVNEISAIKQFDVKELPSILLF
    TCQSLKPYKVISGYNPSELHTNLEELIKIQNLSIPSQNEKFKILTNFKSLMVFMKGIKEEPY
    CRFAKGLVSLLDSIKVKN
    YGHYNIFENEETRQGLKEYHNWPTFPQICINGEFIGGLDILNEMHSNGELVNEIPKDAF

    >gi|66363032|ref|XP_628482.1| thioredoxin fold protein related to phosducin [Cryptosporidium parvum Iowa II]
    INFLKALLLERLSLHLINSASKHFIDEILHGVEKKIMDSNSINVIKKVLEESENIIDEEIRAFDNIQNDENELNRLREKR
    IEELRQEFKQKNKFIQFGHGKYDFISDEKEFFDVIKKSENVVCHFFRPSTLR
    CEIFDRHLEIISKKHLEAKFIKINAEKS
    HFVCSNLNINILPTIALIKNSKLIHKIIGFEELSSRDNFTTTQLEELLVRRNMIQEQ

    >gi|66363196|ref|XP_628564.1| protein disulfide isomerase, signal peptide, ER retention motif [Cryptosporidium parvum Iowa II]
    IFFTEDFLESFSIRLKVNTLQMRNLLKLILTLSFAPLFVTCLYDSSSQVKVINGSQLKKLVKENPVVIVEFFAEWCGHCK
    AFAPEYEKAAKALKGIVPVVAIDDQSDMAEYGIQGFPTVKVFTEHSVKPKDFTGPRRAESVLNAALSALKDVTNSRLSGK
    NSGNKGSNKTKESSKKSRKSRVVELTDSNFDDLVINDNENSWFVKFYAPW
    CGHCKSLAPDWEELGSMADGRVKIAKLDAT
    QHTMMAHRYKIQGFPTLLMFPAGEKREITPVNYNGPRTANDLFEFAIKFQSSSASIKQMISQEVFENTCTKGLCVIAFLP
    HIADSSDSEREKYLKIYKDVVSASAAMTIRFLWSEGGSQFDFEEKLNLAFGYPAVVAINNEKQRFSTHRGSFTVESLNSF
    IIALTTGRAPVDPLPKLPKISKVSSWEPKKSKENSNAEENRNKSNRQSDEL

    >gi|66363330|ref|XP_628631.1| phosducin related thioredoxin fold protein [Cryptosporidium parvum Iowa II]
    MSTTNPTEITTQWEDQMVKRGIWAPREQEKKNEELYKERIDALESINLFENAKLEKLIDVEVDKDESFEKELVAIRARRL
    ASLKNRAEENSRFGELYFIRKPDFVKEVTEASKDNTTVVVHLYKESNED
    CQIINRLLSETIAKEYGKIKFVKGISSDIVP
    NYPDKSLPTMIIYRNGTSISQITGSSSFKDKNRKITIKSILKLFVQNNVIKNSEITEHSRFEKGSEYSNNYSSSDDSDSD
    DDNRDNGKCYSSTVFDKMQDRIKYLQKI

    >gi|66363374|ref|XP_628653.1| protein disulfide isomerase, signal peptide plus ER retention motif [Cryptosporidium parvum Iowa II]
    MKISWRILLTLQTVLFFLYFSIVKGGNLTELNKDSFQEFITKNEHCLVIFYTDDCAACVTIIERLEKLNEEIGNIKVNVA
    KINGERNIKILEEYQINDYPTMKFFRNKVAEEYYGGREENEILEWLKEQVAFPVLELEKNMINKEKLENLLLKNDVLYIF
    YGDKNGIERSIFNDVANYNRASGKFYQISKDDLGFGLSKESFINVFQSGIELDSIKNDLKKNSFDPWIVCLRRYENAIPF
    HGSSKQRKEVWDFVKANQIPLFGEISSRNYVKYSEVEYDLIWLLVPMEPGKGEESIKPYVALFTQISQEFADNYRVVWLD
    TSEHSSHLNTVLLVEPEMLPTVAVAKSRPYLLPPNTPIEYLTIKKFLQDIELNKVEPKLRSEPIPVYYDNDTVFKLVGSN
    FNSMVLEDKKNDWLVVLVTPF
    CQPCIDTEEIIRKLHDAISFGNSESKIKFGSFDISENDLPKDEFYSSSIPSIIFFNRKD
    SGNPIHFNAEEISYINIKDYMMNSTSIDSNEISFIDPANATDLVVTIFSDFEQFSDEFPTQEQIEAVEKSIKHDEL

    >gi|66359802|ref|XP_627079.1| Uba3p like ubiquitin activating enzyme E1 [Cryptosporidium parvum Iowa II]
    KFGEFFFVKFLLKLIAPPQLSTFSFIYTPQHGKAIMNSECKTLEKDIGLAYCKVLLVGVGGIGTEILRCLIFSGFRRIDI
    VDYDYVEVSNISRQLFFNLGDEGKSKVHVLAANATNHFKSAKGLEIKPFHSDISDFFSKFNVTPSDYKIILSGLDNIHAR
    RTLNAIVMTQSSPQAYPILLDSGTEGFNGHSRIIIPGETSCYECTMGLNVQDTNFPL
    CEIKEFPRTPIHCIAYANFIYEE
    DEQDNEDFKNHKILKIYQLAQEHAKSFGIQGVTLELTKQIIGNIFPTLLSTNTIIASSVVSQAIKYLRGSGQAKNLKNYF
    MYYGQTGIYSSCFEIHKDENCIFCKI