Cryptococcus neoformans var JEC21 uid10698

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|58258147|ref|XP_566486.1| disulfide-isomerase precursor [Cryptococcus neoformans var. neoformans JEC21]
    MRLSISISAALLAFTSLVSASNVVDLDSTNFDQIVGQDKGALVEFFAPWCGHCKNLAPTYERLADAFPTDKVVIAKTDAD
    GVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLETLAAFVTKQSGVKSNIKPPPPPAYTELDASNFDEIALNESKN
    VLVAFTAPW
    CGHCKNMKPAYEKVAKVFSSEPDVVIALMDADEAENKPVAQRYGVSSFPTIKFFPKGSKEPVAYDSGRTAE
    QFVNWINEKSGTHRSVSGLLSETAGRVLTLDTLASEFFSANVPERSEIVKKAQEAVTTVDEKSKATANYYIKAMERITAK
    GEEWLTKEQARLANLLASPSLAPTKLDELKVKINILSAFAAQKAGEAYDSAEEVLEDAWDSAKQIPIQAKDGLDQFADAV
    EEKAKRVRSDL

    >gi|58258323|ref|XP_566574.1| ubiquitin activating enzyme [Cryptococcus neoformans var. neoformans JEC21]
    MAAPMQVDEAVPGDSIDEGLYSRQLYVLGHEAMKKMATSNVLIVGMKGLGVEIAKNVALAGVKTVTIYDPSAVEIADLGT
    QFFLREEDIGRPRAEVTAPRLAELNSYVPIKILPGAGEITPEMIEPYQIVVLTNATVRKQVEIDEYCRQKGIYFIAADVR
    GLFGSVFNDFGKDFACVDPTGENPLSGMIVEIDEDEDAIVTCLDETRHGLEDGDFVTFSEIKGMEGLNGCEPRKISVKGP
    YTFSIGDTRGLGKYKSGGLFTQVKMPKILQFKTLKESLTNPEFFITDFAKWDRPAALHVGFQALSAFYEKAGHLPRPRNA
    ADAEQVISLAKEIHSAAGGEDVLDEKILTELSYQATGDLSPMVAVIGGFVAQEVLKACSAKFHPMQQNMYFDSLESLPAT
    LPSEADVQPLGSRYDGQIAVFGKAFQEKISNTREFLVGSGAIGCEMLKNWSMMGLATGPNGIIHVTDLDTIEKSNLNRQF
    LFRAKDVGKFKAESAAAAVADMNPNLKGKIIAHDDRVGPETENVYGDEFFANLDGVTNALDNVSARQYMDRRCVFYCKPL
    LESGTLGTKANTQVVVPHLTESYSSSQDPPEKSIPS
    CTVKNFPNAIEHTIQWAREAFDSFFVNPPTTVNLYLSQPDFVET
    TLKSSGQHHEHLKQIEKYLVKERPMSFEECIMWARLQYENNYVNEIKQLLFNLPKDQVNANGTPFWSGPKRAPTALAFNI
    DDPLDMEYLIAAANLHAFNYGLKGERDPALFRKVVESMNVPEFTPKSGVKIQINENEPVENNGNDDEDDIEAIVSSLPPP
    ASLAGFRLQPVDFEKDDDSNHHIDFITAASNLRARNYGITLADRHKTKLIAGKIIPAIATTTALAVGLVCLELYKLIDGK
    NKLEDYKNGFVNLALPFFGFSEPIAAAKQKYGETEWTLWDRFEIEGNPTLQQFLEWFQENHKLEVQMVSQGVSMLWSSFV
    PSKKAADRMRMRMSELVEHVGKKPIPPHVKNLLVEVMVNDENDEDVEVPYVLVHI

    >gi|58258897|ref|XP_566861.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MASICTACSRLLPRPAIPSSSRLPASLARLPPPRHFSTLLTPYFQRRVPRSDPKPCRLATTSAYNSSRSGLPDLPPIPSR
    PNIKVSAPSLAAIKEEGFYDDDVKLLPPEEAFLNITPEAVQQLTRITSREPLEVLSQGKLALRVGVESGG
    CHGYQYIMDL
    TEERGVDDYVLQPEGVACIPVVIDLTSFGLLKG

    >gi|58260030|ref|XP_567425.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MANLYEQVNTHYSSIAREDEASNAEHMKKVALSFGYNVEDLACIPDGSNLGVSCGNPLTIAGLKEGETVVDLGCGGGFDV
    FQAARKVGVKGLVIGVDLSDDMLARARANAEKSSTTNVKFVKTPITEIELPSDSTDCIISNCVINLVPHDDKHLVFKEIY
    RLLKAGGRVSVSDLLAKKQITPELQSHLGLYVG
    CISGASLVGEYENWLKEAGFQELILLLRHQDPCLRDEQCSCEHRLQ

    >gi|58260742|ref|XP_567781.1| thioredoxin peroxidase [Cryptococcus neoformans var. neoformans JEC21]
    MSLRLGDIAPDFEADTTHGRIKFHDWLDGSWAILFSHPDDFTPVCTTELSAVALSYADFASRGVKLIGLSANNIASHEGW
    IKDINALKPDAPALEFPIIGDEDRTVSELYGMLDKLDKTNVDKKGIPFTVRTVFVIDPKKQIRLTLAYPASTGRNFPELL
    RVIDSLQLGDKHRITTPANWGIPDPKTGQVEERVIVHPSVQGEEVKQLFGDDVETVYPYLRFTSNPSKKEVTA

    >gi|58260852|ref|XP_567836.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MSKVQLYVYDLSHGLAKSMSLMLTGKQIDGIWHTSVVAFGREIYYGQGVLESKPGATHHGQPLQILDVGETHIDEATFNE
    YLSSLSGMYTPSKYHLIEFNCNHFTADVVGFLTGAEIPAWISSLPSEFLSTPFGQAMKPQIDAMFRGPTAQRPIPDKISS
    ANASPAPSIGSSSAPGGDTAAAGPSLSSTLLQSIAAQATAQTTGQSTAANGSSKQPLNPETSPLTLVSSTANFHSILSQH
    SAVVVNFTNTPS
    CPPCRVIKPVYESIASYHSAVYGAKGARFVEVELGIGQGREIAGTYGVQATPTFMFFKDGKKVGEMKG
    AAKRELENKVEQFLEECYPTHPHRRMYLPAVEGLPKRAITVSNLPNYPALLNKLEGFLADKGKTESFMVLKNEVVPFLEG
    KSLSETELAALLQKWSAATQDLLPALQPTETFPLIDLWRIALQCQPIIPFIGLGLSTASSNAEPITSIISLASNTFSSSP
    EAIPKPFILTVLRLLTNFTSCVELTNLVLAHDGNVSTSEQLISVLVESLLYPDVGVRSAAAGVAFNIGLWRHHNVVEETP
    NVDWELEVVSGLVEALDREEDEDVAHRLLAALALEIYLSPSYEDNVQPMLQVLEASNKIEKRCKVWKRKEVKKVGEEIAR
    KLC

    >gi|58260854|ref|XP_567837.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MISLTVSPRACPLCSLANKLMVSVVAFGREIYYGQGVLESKPGATHHGQPLQILDVGETHIDEATFNEYLSSLSGMYTPS
    KYHLIEFNCNHFTADVVGFLTGAEIPAWISSLPSEFLSTPFGQAMKPQIDAMFRGPTAQRPIPDKISSANASPAPSIGSS
    SAPGGDTAAAGPSLSSTLLQSIAAQATAQTTGQSTAANGSSKQPLNPETSPLTLVSSTANFHSILSQHSAVVVNFTNTPS
    CPPCRVIKPVYESIASYHSAVYGAKGARFVEVELGIGQGREIAGTYGVQATPTFMFFKDGKKVGEMKGAAKRELENKVEQ
    FLEECYPTHPHRRMYLPAVEGLPKRAITVSNLPNYPALLNKLEGFLADKGKTESFMVLKNEVVPFLEGKSLSETELAALL
    QKWSAATQDLLPALQPTETFPLIDLWRIALQCQPIIPFIGLGLSTASSNAEPITSIISLASNTFSSSPEAIPKPFILTVL
    RLLTNFTSCVELTNLVLAHDGNVSTSEQLISVLVESLLYPDVGVRSAAAGVAFNIGLWRHHNVVEETPNVDWELEVVSGL
    VEALDREEDEDVAHRLLAALALEIYLSPSYEDNVQPMLQVLEASNKIEKRCKVWKRKEVKKVGEEIARKLC

    >gi|58262044|ref|XP_568432.1| hypothetical protein CNM02380 [Cryptococcus neoformans var. neoformans JEC21]
    MPMPDEHIHPTATGLAKKVVDAHQDPQDLVFWSGWFCPFNQRIWIALEERKIPYQYHEVNPYKKEEAFLKLNPLGLVPTV
    EIKTAEGSKSLYESDVLVEFLEDLYPPSEEHPSIFPSDPYEKSWVRLNIQHVSKKIIPNYFKLQQSQTESDQVAARKELI
    SALRTYAKRIKGPYFAGEQWTAVDGTLAPFIRRLYILEKHRNFDEKAVGDGWWEYRERLMTRDSLKNTCSEDQYYEEILG
    RYLKNEAQSEVAKATRAGQSLP

    >gi|58262014|ref|XP_568417.1| hypothetical protein CNM02410 [Cryptococcus neoformans var. neoformans JEC21]
    MKFSSKLSLALVAALPNLASVLASDVLDLTESTFQKEIAGEDLALVEFFAPWCGHCKNLAPHYEEAATELKEKNIKLAKV
    DCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGIISYMTKQSLPAISDVTPESHDTFIKSDNVVLVAYGDDAHP
    VPEAFKQYAKGARDSYLFGQYLSNDLPSIPENPSLPAIVLYKDFDEGYAVFPSGEIAHADVDELSEFVKQNSIPLFDEIS
    PENFGSYAEQGIPIAYLFVDPNEASAREKLVEELKPLAKELKGIVNFVYIDAIKFIDHGKSLNLPGDSWPAFVIQDLADQ
    TKFPLTSKATAENIKDFVKKYVVGEISPSIKSEPIPATQGPVYKLVADDWDNVYGDESKDVFAEFYAPW
    CGHCQRLAPIW
    DTLGEKYAGNNNIIIAQMDATENDIPPSAPFRVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVETNRKSDADVAEEEW
    EDEDETPEHDEL

    >gi|58262242|ref|XP_568531.1| glutathione peroxidase [Cryptococcus neoformans var. neoformans JEC21]
    MSDIYSYSVEFPKSTLPLSDLKGKTLLFVNVASKCGLTPQYKDLQALHEKYGDKGLAIIGFPCNQFKAQEPGTDDEVLQF
    CQVNYGVTFPIAKKGDVNGENTQPIWKYLKENAEPPVSDIDWNFSKFLVKDGKITWFPARSTKVSDVEAAL

    >gi|58262588|ref|XP_568704.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MFRSLPRTLKPIIVPFPPQIRPTPRGIYHLRMSSTSATDPTPRLSNVLAKSKSPYLLQHKDNPVAWQEWSPETIALAQKL
    DKPIFLSSGYSA
    CHWCHVLAHESFEDEETAKMMNEWFVNIKVDREERPDVDRMYMSYLQAVSGGGGWPMSIFMTPKLEPF
    FAGTYFPRPNFHQLLNKIHEVWEEDREKCEKMGKGVIEVLKDMSHTGRTSESLSQLLASSPASKLFSQLSTMNDTRYGGF
    TNSGSSTRGPKFPSCSITLEPLARLASIPGGGARNAEIREDAREMGMKMLRSMWSGGIRDWVGGGMARYSVDEKWMVPHF
    EKMLYDQAQLVSSCLDFARLYPVDHQDRLLCYDLAADILKYTLRDLKSPEGGFWSAEDADSAEYKGAKKSEGAFYIWKKT
    EIDEVLGDDAPLFNSFFGVQPDGNVDIIHDSHGEMRGKNILHQHKTYEEVALEFGKREDQAKGIIIQACEKLRLKREERE
    RPGLDDKILTAWNGLMLTALSKASTLLPPSYGIRSQCLPAALGIVNFVKSHMWDSSTRTLTRSYREGKGPQAQTDDYAFL
    VQGLLNLYEATGDESHVLFAEELQKRQDELFWDDHDGGYFASAEDAHVLVRMKDAQDGAEPSAAAVSAHNLSRFSLLLSS
    EFENYEARAEATFLSMGPLITQAPRAVGYAVSGLIDLEKGYREVIVIGSASDEVVKKFLEAARKTYFSNQVIVQIQPENL
    PKGLAEKNEVVKALVNDVESGKEKGASLRVCEGGTCGLPVKDLEGAKNLLKGV

    >gi|58263104|ref|XP_568962.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MVFAKLGLRTLRSLPQSQVARSTTILAQRRFLSAEARKLIDGAVKSNPLVVFMKGTPDAPQCGFSRAVCQILDVQGVPRE
    NLKTYNCLEDQELREGIKEYSEWPTIPQVYIKGEFVGGCDILLSMHQSGELEDLLIKEGLAPPLPEGPEGSA

    >gi|58263162|ref|XP_568991.1| protein-methionine-R-oxide reductase [Cryptococcus neoformans var. neoformans JEC21]
    MSQPAKVQKSDDEWRAILSPEQFRVLRQKGTERPGSHPYDHSNDKGVYHCAGCDAPLYTSNTKFQSGCGWPAFYDTIPGA
    VNRHEDRNFGMTRTEITCANCGGHLGHVFKGEGFPNPVDERH
    CVNGISLNFKNE

    >gi|58264258|ref|XP_569285.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MHFDEPISPRSQPSNLPGFLPGFESRRAFSLPSITMPFNNYGNNNAPLLPLTRHSFSGHSSRRSAARRLSYGIKNRASQY
    PYSVTIGGILTLALFFFVYTSPGSDLGRYNSAASRLHIRTPNEDILPLPTSERVIHRPDSKMDNGVMLLTVDENELIAED
    DLFWDTYTEAEPLSAEEAAAEAELQAHKQNVQAQNVAQSLRALVWWLAEGGVLPNDFEVPSKSHLKKIGSSGFEKLLSSI
    DAGEEDEIIFEDGWADFANKRYRIVVFSKTY
    CPYSKNAKSILGKYHLSPAPFIIELNQRSDMEALQGLLQRFTNRRTVPN
    VLLDFISIGGSDDITLLHSEGGLHRKFEEMGAFPGLVRRATSLLPDSEENRRDEFEDHEDRS

    >gi|58264294|ref|XP_569303.1| dolichyl-diphosphooligosaccharide-protein glycotransferase [Cryptococcus neoformans var. neoformans JEC21]
    MRFTSLLAAVPFLSLVALAADPAHWSKLAAKSRDGVIKLDSKTYDDILALDREYSVTVLLTAIPAQYKCQPCQVFDPSYS
    QVADSWARLPKSQRDQHFFARLDFADGQAIYNQLGLTSAPTVMYHPPLAGPRRNNKLSVINYDLNRNGLSAPPLHSWVSG
    LTPSPFELHTPLNPWPFIFVPLSLIAIGVSAYSLRSILVPLIQSRIVWGTASIILILTFTSGYMWNKIKNAPYIAAGRDG
    KVQWIAAGYQNQLGLESQVVGAIYGLLAFSIVALSVLVPAQTSAVKQRVGVYLWLGMLVIVFSLLMKLFKMKNGGYPFSL
    LF

    >gi|58264546|ref|XP_569429.1| thioredoxin (trx) [Cryptococcus neoformans var. neoformans JEC21]
    MLGQLSRPVRLSVAPLRTILTQRAFHASPIARDHILDASNEVFEKRALDADNSKPVLVDFYASWCQPCRVLTPLLKRVTG
    PESNYDLLTINVDEYPEVAAKYKVSALPTVVAFKNGAVKNKFVGFRGQDDINKFLGML

    >gi|58264602|ref|XP_569457.1| NEDD8 activating enzyme [Cryptococcus neoformans var. neoformans JEC21]
    MTAAHIQSYHSDPTRYAAVDNLLHRKGPWTDERFQGGTETANFLRTKAKILVIGAGGLGCEILQNLALSGFNDIHVIDMD
    TIDISNLNRQFLFREADVGKSKALVAAEFVMKRVPGCTVTPYHGRIQDHPTSFYSTFDVIVAGLDSISARRWINATLVQM
    AQEDEENIKPLVDGGTEGFKGQARVILPTITSCYECSIDMLTPPTAFPI
    CTIANTPRLPEHCIEWASVLEWPKVFRDKKL
    DTDDPEHIEWLYKQAAARAGQFNIEGVTWALTQGVVKNIIPAIASTNAIIAASCCNEAFKIATASAPYLNNYMMYVGNES
    VYTYTFEHEQRPDCPVCGGESLVAEVKRDWTLQQLIESLSQRQDLQVSRPSLSFSSGKALFWPSPPDVYEATKANLELLL
    SDLVQDNDAIVLVDPALPVSASVTVKFV

    >gi|58265022|ref|XP_569667.1| thioredoxin (allergen cop c 2) [Cryptococcus neoformans var. neoformans JEC21]
    MVKAIESYDEWKTLTSGSDVVVVDYWATWCGPCKMISPHFAKLEGKFPNVKFAKVDVEEQEDIAKEAQIKAMPTFVAYKD
    GKVIETVTGAVPAKINALLDKVAA

    >gi|58265152|ref|XP_569732.1| hypothetical protein CNC04710 [Cryptococcus neoformans var. neoformans JEC21]
    MTPDEDSEEREDEEDGEVLKMGDRLPSIKLEDEEGNTVDVSTLAGEKGVVFFLYPKADTPGCTNQACGYRDMFEEIAVFG
    YEIYGLSKDTPTAQQKWKAKKSLNYHLLSDPKSKLIKRLGAFVPPKNTKRSHFIFEKGTGNLIDIDIGVRPAEDPNNVVG
    FLTEKYL

    >gi|58265286|ref|XP_569799.1| endoplasmic reticulum protein [Cryptococcus neoformans var. neoformans JEC21]
    MSFARTFAQRSLRTLASSARLRAPLPAKRAFSTAQPLRMVVSQARYDAANRKPSQWAKDPIVTYEELKPITQQPTDNILL
    VDVREPDEVALGSIPSAVNLPLSKLKEALDSHSNPGDFQREFAFPKPQPEQNIIFF
    CRSGRRSASAAEIANDKGYKSVRN
    YVGSWLDWSKRESQDKDED

    >gi|58265150|ref|XP_569731.1| protein disulfide isomerase [Cryptococcus neoformans var. neoformans JEC21]
    MKIAWSAVITAALLPFSAYAGMYGQPVLHLDSKTFKSVMASEHAAMVAFVAPWCGHCKNLGPEYTAAAQSLSPLIPFYAV
    DCDDASNRGLCAEYGVQGYPTIKGFPKAGKGAAKEYNGERKRGALVEYAKGLVPERVKKLRVQGDIQSDVQGFLGEKSEL
    PHVLLVHPSSPSIPFLWKVLAHRFSNKLHLGYVRDTTSHEVLSSLGIYDSADTTRDGTRVVAWSPGSQSGEFVEYDGILK
    FNALLEWLQTTFPSAAPSNAKQRPVKAPQPTVKSTNKRQEQIPTQSQNDAAARRAKLEEMERRDKARREKAAEAARAQTM
    ATEAEPEIEKEATPVEDAANAAPAQMVEDTSLPAEEMESRPVPEEAPEDEGSAGDVEVEKTEVVHEEL

    >gi|58265226|ref|XP_569769.1| thioredoxin [Cryptococcus neoformans var. neoformans JEC21]
    MSASNLVQVNSPEHFRELLSADLNRVSCLNFWAPWAEPCVAFNNAVEQEAAQFPSVLFLNIEAEQLADISESFDIEAVPS
    FLVLRGHTLLARHSGADASLLRSLLTQHASPSAPLSTSSAQPQAPAAAQRPRTEAEIVARCHELMNKHKVVLFMKGNPTA
    PK
    CGFSRQTVGLLREQGVEFAWFDIFSDEDVRQGLKKVNDWPTFPQIIVNGELVGGLDILREMIENGEWQELMDSIEEGK
    AE

    >gi|58265228|ref|XP_569770.1| thioredoxin [Cryptococcus neoformans var. neoformans JEC21]
    MNSTPTPTPQPDTDNPHSNDANHADDRRPLAAHIPDYAGKSPFPAPPSRFTPRTPLQFLSNSPTNTDASAISCPSYILPT
    LPSSAASLPSLDPPSSNDRLAMINRIKSLGSYTNSPATVKIPLPTPSPSVSLSLSSRGPATPSSSIIRNKPHMPSPLNKL
    DYLYDIPPSPPISADADPGQLLVMPRMPNPDVESPIASPFVNLNLQTSTSSNRKPGGHTLLARHSGADASLLRSLLTQHA
    SPSAPLSTSSAQPQAPAAAQRPRTEAEIVARCHELMNKHKVVLFMKGNPTAPK
    CGFSRQTVGLLREQGVEFAWFDIFSDE
    DVRQGLKKVNDWPTFPQIIVNGELVGGLDILREMIENGEWQELMDSIEEGKAE

    >gi|58266528|ref|XP_570420.1| URM1 activating enzyme [Cryptococcus neoformans var. neoformans JEC21]
    MQVNQEASSSRRTAVEGLPLDPDEYERYGRQMIMPDFGLPGQVNLKNAKVAVVGAGGLGCPVLQYLAGAGVGTIGIIDHD
    TVSMSNLHRQILHTTDRVGMNKAESACQALRALNNKINLIPHPVPITPATALDILRPYSMILDCTDRPLTRYLLSDAAVR
    LDVPLVSGAAISSAGQWAVYGGKTKSGKRRACYRCIWPSILPGSVGT
    CEEQGVWGVVTGMVGVGMAGEAIKLIVGKEDPD
    PLLHLHHLGSNPLIRTIRIKPPSAKCITCGPNATITDDLDVFGYESFCAGGPETNDETGLVAGQSGHRISVQELDELLQF
    DKSKVTVIDTRPEVEFGICSVPGSINMPLPSILSGPTDIQLTPDIVFICRRGNDSQIAAASLRKALDAKEDVRVRDVRGG
    LKAWGREVDLNFPVY

    >gi|58266540|ref|XP_570426.1| glutathione transferase [Cryptococcus neoformans var. neoformans JEC21]
    MTADVKSLVDKAIADNKVVVFSKTYCPYCKRAKSYLAEDTKDIEILELDEREDGAAIQAYLKELNGQGTVPHVYINKEFI
    GGSSDLLKLSHEQVKQKISAAASA

    >gi|58266732|ref|XP_570522.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MTTDIPAQPLKTTKETHPDLPPGLIIGPDGKPCKVCNSWQDWAKIKVKKKAASGGEDAEKKNVSGSGAAVGMAGFGSMLS
    GAGASKAPTNAPLDRTPDRSNCPPDTAALGRSTWTFLHTTAAYYPINAPPQTQSSMLNLLSSLSLLYP
    CSWCATDFQKDM
    RRHPPDVSGRESLMKWLCERHNEVNEKLGKEKFGCDIKNLDVRWKDGPEDGSCD

    >gi|58266926|ref|XP_570619.1| thiosulfate sulfurtransferase [Cryptococcus neoformans var. neoformans JEC21]
    MRLPSIANPYLRTARSFTTSAHLRVPLLLTPKQFNDLPKQTTLPLDATWHMPNSPRSALAEYLNGPRIPNARRFDLDEVA
    ELSVGKNPLSLTHMLPSAERFKKELEKLGIHKDTHVVVYDTIGIFSSPRALYTFKAFGHDKVSVLDGGLPRWIEEGNEVE
    MGEAGEVGSSEYPKVQGPNKDWVRSYEEIVSNSQKPLSDPTAEIVLDHRPAARFLGINSEPRPNLPSGHIPNSRSLPFTH
    YLVPATDKKPFTNYKPVPELKQVLVDGVGGEAMWDDIERRDKPLVFS
    CGSGMTAAIGWLANELIRETEGKAPKSALYDES
    WTGYALREDSKIARNGHFKP

    >gi|58266898|ref|XP_570605.1| thiol-disulfide exchange intermediate [Cryptococcus neoformans var. neoformans JEC21]
    MAGGIQNITSAAGKSTRQDSLHTLLTNHSINRGSKSLTVSSVHYPPHVCSSQTSMPCVSYVCQVETDAYSDSQQWCGPCH
    AIAPVLEQLAGAKIDVDQQRELASRFRITAMPTFKLLKGGREVDQVSTASSGSKSQVATGEITESLLKQVISKGLNCLNE
    AKEHPLSSILGPEKGPRGNSYLESDVDPELLISIPFQDAVKLKAISIFSGISPSQAPKTVKLFINQPNIGFDDAENEAPA
    QELILTPEQVKGDRIPLRYVRFQNVRSLHILVKDNQEDEETTRIDSIDVYGAQGEKLDAGVTSQSSAGTGSMLEKLLASE
    TALSWS

    >gi|58265916|ref|XP_570114.1| dihydrolipoyl dehydrogenase [Cryptococcus neoformans var. neoformans JEC21]
    MFARQPLSQNLLRPLSRPSSSFSRTSTIPKLAFLQSARGFASASEPYDVVIIGGGPGGYVAAIKAAQLGFKTACIEKRGA
    LGGT
    CLNVGCIPSKAMLNNSHIFHQTQHDLKNRGIDVSGIQLNLPKMLAAKEASVKALTGGIETYLFKKNGIDYIKGEAS
    FETANKLNVKLLEGGETQVEAKNVIIATGSEVTPFPGLEIDEERIVSSTGALELKEVPKKMVVIGGGVIGLELGSVWSRL
    GAEVTVVEYLGAIGAGMDGEIGKQFQKILTKQGFKFKLNTKVISGHREGDIVKLKVDSAKGGKEETIEADVVLVAIGRRP
    VTTGLNLEAIGVETDKRGRIIIDDEFNTSAKGVKCIGDVTFGPMLAHKAEEEGIAAVEILKTGHGHVNYDAIPSVVYTHP
    EVAWVGKNEEELKGAGVQYKIGKFPFAANSRAKTNQDSEGFVKFIVEKETDQVLGCHIIGPNAGEMIASATLALEYKASA
    EDIARTCHAHPTLSEAFKEAALASYDKTINF

    >gi|58267232|ref|XP_570772.1| glutathione peroxidase [Cryptococcus neoformans var. neoformans JEC21]
    MTFFDSIASKFGYESLPGDVANKSFYDLKAKLPGSKGDLDFSTLKGKVVLIVNTASKCGFTPQYTGLEELHKTYGDKGLV
    VLGFPSNEFGGQEPGSDDDIAQFCTLNHGVTFPLMKKSEVNGKNMNEVFAWLKSQKGENVGGLAGTTAIKWNFTKFLINK
    EGKCVGRYGSSTKPEKLKEEIEKLL

    >gi|58267108|ref|XP_570710.1| thiol oxidase [Cryptococcus neoformans var. neoformans JEC21]
    MLGPLVHIPRILRLALLCAFIVIVPTLYLLYPSEERLPAPGEWQAGGIDSEHWREPVKPDFARYEHEEGRAWGEELLTQK
    DASVAMDDDVIHGGVIMPKLGNATAKAELGRAAWRVLHLMTLRYPDEPTEDDRLALKSYFHLFSRLYP
    CGECAQEFQKLL
    KEYPPQTSSRKSASLWLCHVHNQVNARLGKPEFDCLTLDETYDCGCGDDADTSSSVSIASSPSSAATDFSDANDVNVVKA
    MTEAVDDPTILSRGGAALQGEFEVVASGEGVGLSAEEVDEERLLEKEEREIISQEQVGVHEWRKSQIVKEEEWEKEKANH
    GLD

    >gi|58267230|ref|XP_570771.1| glutathione-disulfide reductase [Cryptococcus neoformans var. neoformans JEC21]
    MPPINKAQAEQVGEYDYFVIGGGSGGLASARRAGSYGAKVGLVEVSPRLGGTCVNVGCVPKKIMWYTADVAENLRKSAQY
    GFGKEGEGYKLAADFNWTELKHKRDAYIHRLNGIYESNLEKDHVDHHQGWASFVDANTVAIEPPNGDKYTVKAKNIVIAV
    GGRPTVPSEKDIPGASYGITSDEFFELETQPKRVAVIGAGYIAVELAGVFNTLGSETHLVIRHNQLLRTFDPMMSEVLVP
    CMEKAGMKIHKKTHVKKVEKTSSGSLLVHLDSSSEPIEVDCLLWAIGRHADTAKLGLDKAGVKYDKKGDVIVDDYQNTNV
    PGIYAVGDVGGRMLLTPVAIAAGRRLSNRLFGPEKYKNDKLSYDNIPSVVFSHPTIGSIGLSEPEAREKFGDDNIKIYKT
    SFRAMSFAMLDEDHKQPTAYKLICTGPDEKVVGLHIIGEGSDEMLQGFGVAIKMGATKEDFDACVAIHPTSSEELVTLR

    >gi|58267804|ref|XP_571058.1| iron ion transport-related protein [Cryptococcus neoformans var. neoformans JEC21]
    MALPTLRTTFASSSRVTLHHLSFPARSLAYLRCGSSLAQHSSSQAYTPTPAYSGPVASSSSSKAKGGVKDMHAAPNPAPP
    AAPAKNEGTGEKKEPRRRVPLKSQRNAITMTPTAISHLRELLASPTEPRLLRISVKSRG
    CAGMAYHLDYVPPPGGKFDEV
    VEQDGVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNVVDTCGCGESFNIRF

    >gi|58268664|ref|XP_571488.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MPRSTYTEALLGPEVYKKVRETKVLVVGAGGIGCELLKNLVLVGFANIEIIDLDTIDLSNLNRQFLFRKPDISKSKALVA
    AATAHHFNPNSGININARHGNVKDSVNDLEWIKGFGLVMNALDNMDARRHVNRLCQAAGVPLIESGTAGYLGQVTPMIKD
    VTECFDCVPKPAPKAFPV
    CTIRSTPSEPIHCIVWAKTYLFGKLFGEDDEDMDTEELDKAKSSGENAEEIENLKKEAAAFR
    QVRKSLSEEDGPRRVFHKIFNEDIRRLLAMEDMWKKEGRVKPVPLDCDAILDETFVTPPLRTVPVTNQQADSDRAAERDK
    GKSAALLKDQKELNLKENLELFLDSCKRLSARALAFPDTPLSFDKDDDDTLDFVLATANLRATAYGIPNKTRFQVKEMAG
    NIIPAIATTNAIIAGLIVMQSLNILSRIHSTSNGGPSTDSSSIPVRNVFLRTDPTKPLGSFLPQHPDPTCSVCRDVYIPF
    KADVGKCTLGEFVEDAVKDWLGSAEFEGQGEGEDVEWTVFEGGRLLADPDFDDNLGRTLDDLGVGRGKILTVRDEDTKYR
    PVHFCVCQPDPEASKAYTLPDEKPTIPLAPAKPGAAARESSEEPEIVEHVPANTAPKDLPSVTAGVKRPAPEDEGQTAAG
    RDDAKKRRVTTVVDDDDDFEIL

    >gi|58268228|ref|XP_571270.1| thioredoxin-disulfide reductase [Cryptococcus neoformans var. neoformans JEC21]
    MSPIANGNPHGSSFSVREPERTGEVSKKMHSKVVIIGSGPGGHTAAIYLARANLEPVLYEGMLANGFAPGGQLTTTTDVE
    NFPGFPEGVTGTEMMDKFRAQSERFGTKIITETVARVDLSVRPFKYWTEGEEEEHEFMTADTIIMATGASAKRLFLPGED
    TYWQSGISA
    CAVCDGAVPLFRQKPLAVIGGGDSAAEEATYLTKYGSHVYVLVRRDELRASKIMAKRLTSHPKVTVLWNTV
    ATEAKGDGEVLTSLTIKNTKTGEIGDLPVNGLFYAIGHEPATSLVKSQVELDSDGYIKTVPGTSQTSVHGVFAAGDVQDK
    KYRQAITSAGSGCIAALEAEKLISEEEADDESLQTQDVHVPAEHYLGTDKE

    >gi|58269430|ref|XP_571871.1| thioredoxin-dependent peroxide reductase [Cryptococcus neoformans var. neoformans JEC21]
    MATYTLPQIQKPAPNFAGTAVKEGSFEEIKLNDFKGKWTILVFYPMDFTFVCPTEILAFNKALDQFAAVGAEVICVSTDS
    EFTHLAWSQTKRSEGGLGPDLKLTLLADRNHAAAKAYGVLLPEEGVALRGTFFIDPKGTLRAMHVHDLPVGRSVEETIRV
    IKAFQFTDEHGEVCPAGWEEGKDTIDTSAPSAYFSKQ

    >gi|58269910|ref|XP_572111.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MRLTAKLAVFSLVAAVSAQLDGLGSSSKAAFALKQKPDSRVARNVLEGKSEGYCSPSGPIESTHCLYETVESLNQQLFPV
    LHELVETPFFKHYKVDLYKECPFWYENGF
    CMNRNCGVEEMDENEIPEKWRARALSEVKVSSESDGVSSCYFKEQDFCYVE
    DDADANGQYVDLTLNPERFTGYAGDSAHNVWRAIYEENCFGLSEASLSEMSKASVGISGLGSKGKSELASAVVGAGGVSK
    PSRGINAAPGWGFSKLSEGWGTEMVKAPLNGEEMCEEKKIYYRVISGLHASISIHICADYLDQTTGKWAPNLECFISRLA
    THPERLSNVYFNAVLLLRAVARAAPYLEAYDISTSPAGLLKEGDKKAKARLGEVLSLAGGQSMEKGFDEADFFAGEDSGI
    LKEQFKSHFRNVSRIMDCVGCDKCRLWGKLQVSGIGTALKILFELDDRALDPKVNPDLLQRSEVVALFNTLHRISESLAS
    VEQFRQIYAATQKAETEASRAKALKSARKKHVPSPVAPPPAFSLTNMERIGARIWEKLKGNCKGCLEMCLQTLERRKLGE
    LATSFRRWVGSIGQDRDL

    >gi|58269860|ref|XP_572086.1| protein-methionine-S-oxide reductase [Cryptococcus neoformans var. neoformans JEC21]
    MVNFKNPPAPTVPSAIKAKESLKPGEGVEQAIFASGCFWGTEHLFTKHYGNLPQFSAISGYIGGHAESPSYRQVCTGATG
    HAEAVKVTYQTGSVAYAELVEFFYRTHDPTTVDRQGPDTGTQYRSAIFYTTPEQEETAKKVTAEVQEKYLKGRPIVTQIA
    KAGTFYQAEDYHQNYLDNNPGGYECPTHRFYW

    >gi|58270338|ref|XP_572325.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MRLPRLLSVTFSLSALLTTATATITDLDDDFQLRELTEDNFKSSVSQGVWLVEHFSPKCAHCRAFAPTWTQLARDKRHLE
    RLTGFHMAQINCLAQGDLCNSNGIKFYPQIIMYTDGKPSPHYTGDRSYEELSKYIDEHAHTYAETILDPAVQSQEALVIG
    PANSEGKVQEVDERGLEALKAEGPVLVEYFAPW
    CGHCKALRPTYEQLALELQGQLNVAAVNCDDHRALCVNSGIKAYPTI
    RLLHHGTSAEYSGARSLAKLKEFSQRAEKPASLTSIKAGDFDKIVSANEAFFLYLQTFDTTVAEVDSVKKAFEPLLGTVP
    AYTSADVALYQRLHVVNPPTSTLFAFSSYSTRPVGTMGLPASPNDLRKFINLHRFPTLVRLDASNFQSLMRSDTRAIVVL
    AGVHKGEEGKKERDKFADVARAWKRGGRRFEQPVWFVWVEGETSRWANWLKRFYGIKKRDLPGVVVIDTPLEEYYDTTIE
    GTKIEFEGSSIFSVLEGFYQHFLRPKRIESTLEWGSRSASETLISVGESAVEHPFLFLTVLVGTVALFVYLLQKCLVKDP
    KDGYSPSRLD

    >gi|58270100|ref|XP_572206.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
    MSLRIATTTARAIPARAVATRSIMTLRRVAVPQASPKGYRQSSILQDTAKTAHSAFANLASAAPIKKGDKMPDVEIKIDG
    PEGKVNLGKEKGKNVVVLVPGAFSGV
    CSNQVPPYITSFSDFKAKGINNVYVVAVNDIFVVNAWKDKMIGEFSSKEGEGVK
    FAADDTAALASALGLTFDAQPVFGGPRLKRGVLVVNDGVVEYVGVEDSPGDITISAADKVIKQL

    >gi|58270884|ref|XP_572598.1| GTPase inhibitor [Cryptococcus neoformans var. neoformans JEC21]
    MSRSPSPTLSDSALLDSLEDSFDFSAHREARMEALSRQIKQVKDLRESEYGRVVEFNEEKALIERMAKEKYCVLHFVHPN
    FQR
    CDIMDRHLSQLAPKHKHTLFLRANVDNVPFLVTKMAIKVLPCVMSYVDGRAVDRLIGFEELGQTDNFTTKALEFRLS
    QTGVLPTDLTLATNVSSSLLTQKQQGSRSDFEEEDSEEEKDRRRGKSGIRGGFRNKRGDESDDDW

    >gi|58262018|ref|XP_568419.1| hypothetical protein CNM02370 [Cryptococcus neoformans var. neoformans JEC21]
    MPFTPIHSLIGAILLHLSTSELLEDTGHVFGISGIVSGAVLGERQGWRWAVVGGLVAGPALAAVTGVKALFPGQALSALE
    IIGKGKLALAGILVGLGSRLGSG
    CTSGHMLCGVSRLSVRSIVATITFFATAVITSNIFPQYPTPSTPAYSIELPSLSTTV
    VLICVPLVARLVQRATSTTLTRMSSVPKTARLLPYFVSSLIFSVGLSLSGMTDPSKVSAFLRFPHPQCWDPSLLLVVLGG
    VLPNMLHYAFIINENKRPGDGQPKPKPRFSWESWQVPTREDIDSKLVVGAAIFGVGWGLVGICPGPALVSLGSALLDVCS
    GSGSWQVLGKISTFLGTMLLGMAFGGSI