Ciona intestinalis

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|198429970|ref|XP_002123940.1| PREDICTED: similar to AGAP010217-PA [Ciona intestinalis]
    MSVYNIALFETVDYYLVATALKEEDFVEFIKAKERLSNDSQKTATFWQDIPNVQYLHQLTNETWQSFVKENSKVLITIYY
    AGCPNCEVIRKELTECAKAAREQNIAVKIAVVDGEQYGSTIHRLWTKDMGTPTIFWYENGIKQFEYIKSRAAEELIKFIK
    NPKKPQEKKSYPDWSMQESADDIYFLDARGFDSFVKDQEHMMVVFFSPG
    CNACFNIRSQYEEAATRLDDIRSDVTMAAVN
    FAKARELSARFNVVSYPYFAYFKEGRFKFQYKGKPLADDIVEFMKNPKPPAEPDISENIPAEPESNVTSLTEETFNKFMK
    THSNVLVMFSTPW
    CGHCRHFKPKYEKAADALKADGSLGKLASVNGNNEKNLLKEYNVYGFPTLLHFQNGENKDKYKGERT
    MESVVRFMKNATNETTLSEHPKPKTTDIIMKTKPQQVTALNSTTFEKFINSSEQVFIMFYAPW
    CGACKTSKDAFFQAAIE
    VYEELDYFKLAVINADKLSSLMKKYNLTGFPSFLFFKDGRFITKYRGTTDKKSFIGFLNDPPEEKEETEQKPSSSSSQQW
    ISEVGKVEHPNINNFEQFVRKYTHVLVFFYINACEICLNQMKPEYTKAAEILRKERPAVRLAAVNGAWESKLMQQFGVDG
    FPTILYFSKGKKQYVYKGDWKTGSLVKFMKNPKEELAKKQKPTSWQDIKGVMFGGVVHLGNKTFDQFIAKQKHALILFHS
    LYFSRCIIAQEQFRISAMTFARETNVGFGAVDCHRQPEQGLVCYHLDVKKFPSYKYYLNGKLSKDLEFARTEEITDFMLA
    KIEQQKSREEL

    >gi|198429972|ref|XP_002129523.1| PREDICTED: similar to predicted protein [Ciona intestinalis]
    MNVVKRFTLAFASILLVLSLQEVECKKKDEFSKFVQEVDNVKSFKKLIRTKTNVLVLFAESDSAAQKRFSVFGEAGKISK
    GTATLAWVDCADKEGKKLCKKQKAKPSPVEIQHYKDGEYSSTYDRKFTVKSILAFLKDPKSDGPWEEEDGAEDVVHIESE
    KQLNKMIKKNKPLLVMFYAPW
    CGYCKRFKPVFAEAATEVKGQVVLAGLDAEGNKDSASIRQTYNITGFPKTIYFDKGKQL
    FDYSGGHTKQELIDWLEEPSEPKPKEPEPSWADDITDVVHLTDETFDPFLEENKKVMVFFYAPW
    CGHCKNLKPEWNKAAT
    ILKDEEAPEKLTAVDATQYSQLGNRYKVTGYPTVIYFENGEHKYDASSAFKRTAEGIVEYIKDPKPPPPPEKAWTEVESD
    VVHLDDSSFKSTVKKKKHSLVMFYAPW
    CGHCKKAKPEYQGAAAQFVDDKKVVFGAVDCTQNQKTCEIYDVKGYPTIYYLS
    YGKNEEKYQLGREESDFVKFMSGKTGVTKTEL

    >gi|198436964|ref|XP_002121034.1| PREDICTED: similar to thioredoxin [Ciona intestinalis]
    MATENYFEVTSDEEFTRIHQSGNDKPVVIDFHATWCQPCKRIAPKFKQLSTTYPQVLFIKVDVDQCTETAASYGVSSMPT
    FKFELRGRIIDTMSGADPTALATKTESLVNSAGSQTPMKSEVPGAPGMVDLEQFIVQKNCLNENEDHPFKWVFEDNKDLY
    LESDCDAEILMSMTFNQSVKLHSIKCQGPDTGHAPKTVKIFINQPNLMDFDAGRDNTPVQQLQLSKDDVVEGNIIPLKFV
    KFQSVNNVTLFFSDNQSDEEVTQIQRIVIYGKTISTTNMEEFKRISGKKGESH

    >gi|198423907|ref|XP_002125991.1| PREDICTED: similar to Mgmt protein [Ciona intestinalis]
    MVKQDILTVVLKTPIGIVSLIHTSRGIKEINLDKSVNHDPDIVNHNMTNYSVSIESSSGPLTECAQDSIRWVEMFFDPKS
    NSYLKVPAIDNEIVKKDNFTGRVLRSLMENTERGTTVSYAKLAAMCGSPKACRAVGQAMRANPIPLLVP
    CHRVIASDGGL
    GHYMSGKGDNIKSWLLEFEKSSALN

    >gi|198423917|ref|XP_002126962.1| PREDICTED: hypothetical protein [Ciona intestinalis]
    MSQILQKIAKNSVQKVNGGQTVQLESVWQENDVVIYFLRRFGCVVCRWIAKEMSRLQPKFDENNVKLVGVAPETLGLEEF
    QKLNLFSGELFIDEKKKCYTDLEFSTYSFFGALGAAMDKDLRDIASKAKQEGFGGNIQGDWYQMGGMLIVKKGGEVLKFY
    KQQKGSDHMSNQEILDVLGIKEKAKSGEEAQPECTDVCGLPPKQ

    >gi|198419712|ref|XP_002128643.1| PREDICTED: similar to glutathione peroxidase 7 [Ciona intestinalis]
    MAREVLRVLVLLAPLFGVFSENKHNGFYDYNVKTFDGETVSLKKYIGKVSLVVNVASECGYTDEHYKELTALQNELVQKE
    QPFTVLAFPCNQFGEQEPHDNHYIQEFASSEYKASFPIFAKIDVRDRDAHPAYEFLRRSTGQEPQWNFWKYLLDGSGNVI
    NEWGPSISVSQVKDEILKAIQKLKNTHAEL

    >gi|198428064|ref|XP_002126271.1| PREDICTED: similar to Heat shock protein 67B2 [Ciona intestinalis]
    MERTELHKDIFEKHDWEVSLEDFKEIIEANLIPIIDVREPHEVASVRVNAKTYANIPLKEIETALQMDEVEFLNKYSINK
    PNKDDPIVLV
    CRSGRRSNLGLKAFRDCNYLNTRHYNGGTNVWVENYPDKVIRSAT

    >gi|198414403|ref|XP_002127710.1| PREDICTED: similar to Iron-sulfur cluster assembly 2 homolog (S. cerevisiae) [Ciona intestinalis]
    MSSLIFKRVINNSFLTYGVPRYLASKVVKQTNGPRVALSTASVNANKDILHITDACVKQLKKVATPDEFLRISVEGGGCS
    GFTYKFELDDNIMEDDKSYERDGVKVVTDDGSLELIKGSYIDYQEELIKSSFRVSDNPQSNTNCSCGVSFSVEL

    >gi|198438547|ref|XP_002132000.1| PREDICTED: similar to thioredoxin reductase 3 [Ciona intestinalis]
    MSFILSGFRRYTKIYSSLWTTYSTKMPPTENVRSLVEQNIKDNPVMVFSKTTCGFCSKVKSLFDELKVTYKALEINQLEN
    SAEVQSVLLEVSGQQTVPNVYIKGRHLGGCDATFKAHSEGLLLKMIEAPSSTHEYEYDLIVIGGGSGGLAASKRASELGK
    KVAVCDFVQPTPKGVSWGLGGT
    CVNVGCIPKKLMHQASMLGKSIEDAKSFGWQLTSEPVKNKWEGMVEAVQNYIGSLNWG
    YRVQLREKKVNYVNAYAKFEDQHTITTVNRRGKETKMTADKFIVAVGERPRYPDIPGAKEH
    CITSDDLFSLPYCPGKTLV
    IGASYVALECAGFLKGIGLDVTVMVRSIFLRGFDQQMADKAAGYMEKEGVQFLRRCVPVKIEQVEAGEPGLLRVTGKMTE
    NGEEVTGDYNTVILAIGRDSVTKTIGLDKINVQVSKNGKVPVNDYDQTNVENIFCIGDNGEGKPELTPVAIHAGRLLSER
    LYGGSTLKCDYEGVPTTVFTPLEYSCCGLSEEAAIAKYGEDNLEVYHTNVWPLEWSVPGHDNNTCYVKAITNKLDSERVI
    GLHYLGPNAGEVMQGFAAAMKCGITKAQLDQTIGIHPTTAELFTTLNVTKRSGAAIDQSGC

    >gi|198438553|ref|XP_002132022.1| PREDICTED: similar to thioredoxin (TRX), putative isoform 1 [Ciona intestinalis]
    MAIPDIRDLAEFNKALADAGNKLVLVDFHALWCGPCKMIAPTVKELANTHADKLVVLKVDVDEAADVAEQAEISAMPTFI
    FYKNGKQVATFKGANKEKLTEMTLENL

    >gi|198438555|ref|XP_002132031.1| PREDICTED: similar to thioredoxin (TRX), putative isoform 2 [Ciona intestinalis]
    MAIPDIRDLAEFNKALADAGNKLVLVDFHALWCGPCKMIAPTVKELANTHADKLVVLKVDVDEAADVAEQAEISAMPTFI
    FYKNGKQVATFKGANKEKLTEMTLENL

    >gi|198428584|ref|XP_002127121.1| PREDICTED: similar to peroxiredoxin 6 [Ciona intestinalis]
    MGINLGQVFPNFDCKTTEGDLNFHEYIKDSWAVLFSHPADYTPVCSTELGAAALQHCEFQKRGVKMLEVSVDSVESHKGW
    VKDIQVLYSMSEKRFPFPLASVSRQLLSDLGMLDPDEVDSTGLPLTARCVFVIGPDKKLKLSILYPATTGRNFHEILRVI
    DSLQLTANSKVATPANWKKGEKCRVIPSLSDEEAVKLFPKGFEVTEVPSKKSYIRLTPDPSI

    >gi|198428586|ref|XP_002127186.1| PREDICTED: similar to peroxiredoxin 6 [Ciona intestinalis]
    MGVNLGQVFPNIDCKTTKGDYKLHDFINESWSILFSHPADYTPVCTTELGTAAQLKPEFDARGVKMIGLSIDSVDSHNGW
    IKDIQSYAGLQGEFPYPIIAGTRQTAADLGMLDPDEVDASGMALTARCVFIIGPDKKLKLSLLYPATTGRNFNEIIRVID
    SLQLTATKKVATPANWKSGEDCMVVPSLSDAQATELFPKGFKVTEVPSKKSYIRLTPDPSK

    >gi|198434038|ref|XP_002131987.1| PREDICTED: similar to Thioredoxin domain-containing protein 5
    MRISLVLVLISVFATSKCDEPAQRTDETLYSEATFKELVADQKHFIMFYAPWCGHCQRLKPVWENLAEEINGNSEIDISI
    AKVDCTVETKLCSDEGVMGYPTLKLFHPSRDSLRYKGGRDFESLKSFVIAAVNPLPDPNQFSIPNDGLHELTEDNFENHV
    STGHHFIKFFAPW
    CGHCKRLEPAWAQLAKAHTPSEENKGDVKVGRVDCTVQKSVCSKHEVRGYPTLLWFNNGQVVKKYQS
    GRDIDSFERFITEMTTGEAPPPPVEDKAPPKPAPPKPVPVFQEEPKEQEPTTPVLVLTGKDFDFNIALDVTFVMFYAPW
    C
    GY
    CKRLAPTWEDLAVSDFSEVESPVKIAKIDCTEYNHICQAFEVGGYPTLILFKDGDKVAKYKGNRSMDDLKSFIIKNSK
    EVAQEAKDEL

    >gi|198437056|ref|XP_002126795.1| PREDICTED: similar to interferon gamma-inducible protein 30 [Ciona intestinalis]
    MKIYVAIAFISLVGCVSAQCNIPPQYWCDSLSVAQKCGVESACREFLNAEAAEPVNIELYFESLCPGCRQFITTQLYPTW
    MSLKESGIMAASMVPYGNAKEVQLSSGLWNYTCQHGAEECVGNLIENCIIHYSEDKFDTYFPILYCMEDASDPIKAAEMC
    VKKSDLDWDQIHTCSKGEQGNHLMHKSAMKTEALDPAHKYVPWIVANGKHTEGMQQEAQGNLLKFVCDTYTGAKPKECQS
    GIKFKQIVSFREM

    >gi|198435560|ref|XP_002120592.1| PREDICTED: similar to methionine-R-sulfoxide reductase B3 [Ciona intestinalis]
    MYSFMSSFVVLSALIVITAKSEEVYKHEELKARLTPLQYHVTQERGTEEPFTGEFNDHKGTGAYKCVVCGTPLFHSDQKY
    NSGSGWPSFYDTTHKSSIEEKQDDREGRVRTEVVCNKCKSHLGHVFKDGPEPTSLRY
    CINSASLTFDSTEQKDKEEL

    >gi|198430595|ref|XP_002126000.1| PREDICTED: similar to Thioredoxin-T (ThioredoxinT) [Ciona intestinalis]
    MVIAIANKEEFENQLATAGSKLVVLDFFADWCWPCREIAPKYEKIAGENSEQAVFLKVDVTVDQTLAYKYKVTGLPTFIF
    FKHGENIKSFSGADEDQLRSNIETLK

    >gi|198432574|ref|XP_002119767.1| PREDICTED: similar to Phosducin-like protein (PHLP) [Ciona intestinalis]
    MALRSLDDKLMGEKVNNYCSSSEDEEEEKAPAPPQHIKQPRAKNGTGKGVVHTGPKGVIEDWRTYKRLEYEKREEEEKKR
    DEILKKLSLTCDPNAGEDGVDNEDKEFMDWYNKKRIMELKNKFASKWVGIAFGKVTNLTGENYVEEIESEKKFVTIIIHI
    YDDNVPA
    CEAMNGCIQVLAQKYRTVKFCKVKASEARVSSNFVENGLPALLAYKNNVIIGNFVALSETLGEDFYATDVESF
    LHSYGTLPTSNESLSDD

    >gi|198432103|ref|XP_002119555.1| PREDICTED: similar to Glutathione reductase, mitochondrial precursor (GRase) (GR) [Ciona intestinalis]
    MFRFRSISRLFSGEITRRMASSVTKVDYLVIGGGSGGIASARRATEFGVSAVLIEHGPLGGTCVNVGCVPKKVMFNTAMH
    AEMIHDHKDYGFNLGGGVTFDWSVIKQKRDAYIKRLNGIYATNLDKAKVNTVHGHARFTGESDPHPIVEVGDKKFTAPHI
    LIATGGYPVIPSNDEIPGASHGITSDGFFELEDLPKKTVVVGAGYIAVELAGILNALGSETRLVIRRHQALRAFDSMISE
    NVTHEITSSGITLDRFSHVKKVVKDSTTGKMTITIDSTQDGTTTSTVVENVECLIWAIGRKPNTDMNLDKVGVKLDNRGN
    IVVDKFQNTNIEGVHAVGDVQGKALLTPVAIAAGRRLAHRLFDGKTDLFLDYTNIPTVVFSHPPIGTIGYTEAEAKKLHG
    DDKIKTYKAMFTPMYHAVTERKTKVAMKLVCLLPTEQVIGLHMQGLGCDEMLQGFGVAVKMGATKAQFDECIAIHPTSSE
    ELVTMR

    >gi|198427647|ref|XP_002122465.1| PREDICTED: similar to predicted protein [Ciona intestinalis]
    MQTRYSLKLLLNTCEAVQGGITSRLVRQHTPVLVGNFCSRKLSTEVAPTDDEYSLEWLNKPRQKLVILGTGWGSYSVLKH
    INKSKYDVVVVSPRNHFLFTPLL
    CSTTVGTLEFRSIIEPVRSNYFRNVQDFHLSHAVQLDPKSKKLTCQSAVQPDNLYDL
    KYDKLVIGVGAVSNTFGIPGVKEHAFFLKELSDARGIRDRIISNFELANQPGSDEATQDQLLHIVIVGGGPTGVEFGAEL
    YDFLREDVARLYSTGLQQKVKVTLIEANKILGSFDKRLREYAEKKIIKRKQFEILQGVVAKVTRNNVHLKDGTKIPCGLV
    VWSTGLSPRPFVQQLTFRKDKYGHIMTNRKLQVPDVDDEHSVFSLGDCADIEGMPLPATAQVAERKGKWLAEYLNGDTSE
    DFQFSNLGMLAYVGGYSGLSDFKPKLFKLTGFHAWFVWRSAYLTKLGSWKSRFQVPMDWLKTLIFGRDISRF

    >gi|198430143|ref|XP_002124353.1| PREDICTED: similar to GEC-3 [Ciona intestinalis]
    MSAPQTPSLDEKHPRMRRIDLTRDNLTAEQRKMIVKYNRVQYDAFRKTNRMRTSLLATGIFGVIAGIYSYTIYQMSKDNI
    IKEMEDENMDRVSIILCLLLQYITHSQGDVGLYNASDHVTILNGDNLLQTVTNSTTPWFVEYYSEW
    CGHCQDFAPSFKAL
    AKDIAEWHRLMKVAVLNCADRSNQEICRQMSIESVPDMRVYPARANKTYPGLHYKGKQNIKDIRNFLIDYIMENIESIEW
    LYDNPKPVFEPATFKEVMSISSNTDVMYTAYVIEDAESYMGKSITLDVSSCTNLQVRRVVANTEDGVKIMEQLQLNPQDL
    PFLVVKSNNGTNFPINVKMKTRSFYTYQLTHLYGVGEPVISTVSVGTQVEHRNTIVDITLVDREKVYLADIESALRYSLT
    MEVASVKEISNRKLDALKKFLNMFNKIGSYLPGRQTTINFLTELNTWIQSKSKVTYQEWGERVSLKTNTSYLPTTSKLWV
    GCQSSKPSLRGYPCSLWTLFHTLTVAGYNANLQDQSLVPDTMYQYITNFFS
    CQECRLNFKKEIAKFPFNNAGHKYDAVLW
    LWKLHNCVNERLHKNSSTEDPLFPKIQFPSMKQCIDCYTISNEWNEKNVAKYLVHRYSKGNMAMNYLDTQGGGMQLDAKN
    NVSEVVKNLRQELVVTDFSNETEILQTQDFMSKKLKTQNFSDVLYGNEGLEIETVEKVQEIQQKEEFLMDSISESMPVIT
    TSLNLSESPKNEEVFAQIPKPESNLLENVENSEFLEVKNEKYYENGNDFEIRQFKEGENLGENLPENAGNSEFLETKKET
    YLENDKQSENANDFEFASKTRDADKVKQELLDEINKGKFTKTVEDVLLDAVILPIAVKNGDISEPQDNNGPTYNDFDADW
    SEKELVRFHPRALGSNLAQGRQGFFQGGLRVELGFTTMDFSLCLIVWVLSTIGAAFLCLGLKLRRAHLRRKLSKHIL

    >gi|198433617|ref|XP_002125050.1| PREDICTED: similar to glutaredoxin 2 [Ciona intestinalis]
    MGSQESLKKARTLIESEISKNKVQVFSKTYCPYCKMAKDALKAAGIDYNVMELDNRSDGSAIQDVLKEMTGARSVPRVFI
    NGKCIGGGSETKALQVQGKLVQMVNAS

    >gi|198435127|ref|XP_002126047.1| PREDICTED: similar to ERO1-like [Ciona intestinalis]
    MANTGFHISLYATFLLIFVTLLQTNCEEKCFCQLSGQIDDCFCDIETLEKFNNEQVFPLVSQLVKRDFFRYYKVNMFKPC
    NYFDGDIGF
    CESESCGVKPCSEEDLPVGLRNGNFNKHTPDTEDVECNKPKKSISDINGTLSNVTIDFLDRWDKHDDTVHQ
    FCDIDDESSIELQYIDLIANPERYTGYKGPMAWRIWRAIYEENCFIPETMSQNVNPFKRIPQATAEENDGKRLKFSHSDL
    QGMCLEKRVFYRVISGLHTSINTHLSAKYLFEDGWGERRWEANLAEFQRRFDKDVTKGEGTARLKNLYFIYLLELRALSK
    AAEYFNRGNVVLFTGRDKEDVKTKEMLTQLLDLTKKFPMHFDEGVMFQDKNSRGLKREFVQRFLNVTRIIDCVTCEKCRL
    WGKLQTQGLGTALKVLFSAKEMNGKSDSPFQLIRQEVVSLINAFARLSESIKSLEMFRAMIKDTRNNGKEEL

    >gi|198421679|ref|XP_002127492.1| PREDICTED: similar to ubiquitin-like modifier activating enzyme 1 [Ciona intestinalis]
    MSSEGNDTANFPEAAVRPFPSNSPPAKQRKTNHNSDTYFSKTSKLSGPDTMDQVQNGDSQQAIDEGLYSRQLYVLGHDAM
    KRMGASNILISGMKGLGIEIAKNVILGGVKAVTLHDEDTATIEHLSSQYFVSDADIGKNLAEVSAIQVSELNPYVPVHPY
    TGKLTEEFLSQFQVVVLTSSSLAEQLRISDFTHKSNIYLIVANTFGLFGQIFCDFSSNFTVYDTNGENPQSAMISAITKN
    EKGEGIVACLDETRHGFESGDFVKFHEVKGMDGLNDSEPRKINVLGPYTFNIGDISQYNNYDRGGIATQVKMPTTVQFKS
    LRESLQSPEFMVTDFAKFDRPGQLHILFQALHQFVEEKGHLPQIRNTPDADALVAIATTINNNASAEAKQSELDEKLIRQ
    FSFMARGDACPVQAVIGGIVAQEVMKACSGKFMPIKQYFYFDALECLPEGSQDENVESYQTSGSRYDGQIAIFGKDFQRK
    LSSQRWFVVGAGAIGCELLKNFSMIGLGCKLGNLVEKEDETGSLVVTDMDVIEKSNLNRQFLFRPHDVQKLKSQCAADAV
    KKMNPLARIVSHENRVGPETENVYTDDFFENLDGVANALDNVQARIYMDRRCVYYRKPLLESGTLGTKGNIQVVLPYSTE
    SYSSSQDPPEKSIPI
    CTLKNFPNAIEHTLQWARDEFEGLFRNSADTANQYLTDPKFYDRISKLPGAEPVTTLEAVHNALL
    KNRPQNFADCVQFARLRFQELYHNNIKQLLHNFPPDQKNSSGAMFWSGPKRCPHPLVFDPENTTHFGYVLAASNLYATMY
    GMPTMTNAEEIKKHLGQITVPEFKTKSGVKIATTDAEANQMNSGSMDDTQFEDLKKAIPTVESFKGFRMLPADFEKDDDT
    NFHMDFIVAASNLRAENYEISPADRHKSKLIAGKIIPAIATTTALVAGLVCLELYKIVQGNKKLESYKNGFVNLALPFFA
    FSEPITAPKLKYYDIEWSLWDRIDVNGLDLAAPGSDEMTLGQFIDYFQKEHKLEVTMLSQNVAMLYSFFMTPVKRKERLA
    TKMSEVVQKVSKRKLQPHEKALVLEMCCNDVDGEDVEVPYVRYVFRR

    >gi|198418917|ref|XP_002122369.1| PREDICTED: similar to thioredoxin domain containing 4 [Ciona intestinalis]
    MMFQVTKKLLSSFIYFIVLITQCSCEVLQLDSTNLESTLANNQVVFVNFYADWCRFSQMLAPIFEQTAEKIATEYPTPGM
    VTLAKVDCDRQGGIAQQYHVSKYPTMKLFYNGKPAKREYRGNRTPDGIAAFIRDHLKDPVKEFANLDVIYELPRQKRNVV
    GYFTSKESEEFKVFNNVAKILKDDCDFHAGFGEVSKPERTTGDNIIFKPDSEAQPEMVFLGSLTNQDLLHAWAQDKCVPL
    VREITFANGEELTEEGLPFVILFHKKEDTESLEAYRKEVSRLVSFKTSVNFLVADCETFSHPLHHLGKSVRDCPLVAIDS
    FKHMYMFPNFNEINTPNKLKQFILDLQSGKLHREFHHGPDPHIQALPEDPSAAPAVNDNPEVISAEVQASEKPAEEVETS
    PPESIFKQLKPSEHRYTLTDRDEL

    >gi|198429175|ref|XP_002120789.1| PREDICTED: similar to gamma-interferon-inducible-lysosomal thiol reductase [Ciona intestinalis]
    MEIKYLILFFFCGSALCCDIAPAYWCDTEAIASQCGVLPACSDRLYPSYATEADPVVVGVYFECLCPDSIRFITNMLFPT
    WVKLRTTGVMKIMMVPYGKATMNRHGSGYNFTCQHGPQECEGNIIENCLLNETNYDEAKYLPVIQCMERSPQPVAAAEQC
    ITRSGLNWTNINACASSVNGTMLMHKAGLATAALNPSLTWVPWITINGIHTDHIQSSAITDLLTLVCETYKGEKPRSCQH
    TKHGIGAYARRQRFSNKLYFRSRG

    >gi|198437166|ref|XP_002123432.1| PREDICTED: similar to thioredoxin-related transmembrane protein 2 [Ciona intestinalis]
    MTLITPLILFLKNSRSVRKALTPGLISSIIMSVLFILVRKVPPVCKHMPSFEGNECTFDWREVEIGMFLLSIIVIKNRAS
    VSAEQMITSTLMYTKLASAVLFYRLDPRFAIGYCLLCVFRVWLLPDYFVDGPEELTYFSDTTLQESLEEDKRVTWVVLFY
    TTWSPH
    CHSVSPVFSELSNEYATKYLKFAKIDIGKYSKAAKTYGVSASTMSHQLPTIIVFEDGKAVDWRPMLGSNKKFVK
    YVFTEENIKRDFGMNRLYDESLVKCKKFKKGKKEE

    >gi|198435167|ref|XP_002122838.1| PREDICTED: similar to methyltransferase COQ3 [Ciona intestinalis]
    MIKLFESVKHTLKYAEARPTTPDSVAERIISFMSKSKPLEGSRYAKMVDVGCGNGQSTSIFAPYFKSVVGMDTSENQIAF
    AKKMNSIDHIEYLVGNGESLPFEDAELDLVASGLAVHWMDLDRFFGECRRVLKPGGCILLHGYKDPEVRMVGMEVDKVKR
    TEEEVERLQRKMHEQ
    CTFNPKVKHVNDGYLEIFDILKSDDKVREDGNIVIERYWTLEKLEAYFHSMSGYQTYIEDKKKEL
    MEKYGNIDALEEHDIMKWYIDGVKKVWNVETKNNSQIPLHVTFDVFMILSGIPKN

    >gi|198427711|ref|XP_002127772.1| PREDICTED: similar to Thioredoxin, mitochondrial precursor (Mt-Trx) (MTRX) (Thioredoxin-2) [Ciona intestinalis]
    MLSNSVRLQLGKRLVNFATRQVVCKHAISQRFLFMNVNNTSSLSLQHNFHTSTTRLHPGDQKLETATNFHIQDEDDFKAR
    VLMAKIPIIVDFHAEW
    CQPCKTLGPNLEKEVDKYGGKVMLAKVDVDDVGEVAMEYEISAIPTVILFKNGKQVSDFKGNVD
    DATLAAFVKNSIKEP

    >gi|198411938|ref|XP_002125702.1| PREDICTED: similar to predicted protein, partial [Ciona intestinalis]
    MFCSFCLKMRPLSHLKVAEKLYFSSVCTKLAPASFKPLHTFLAIHTNLPPQTATRNLSYSHTMLNTDTKNENSKEKSAEE
    PVETPQPMPMGKRLLIVASILLAWGGIYYLATTQKKKNRLMERETQLSKVDIGAEDYNLIDHNGKPVTKKDFLGKWLLLY
    FGFTH
    CPDICPEELEKMADIIDLV

    >gi|198426687|ref|XP_002129586.1| PREDICTED: similar to thioredoxin domain containing 1 [Ciona intestinalis]
    MLLLPSVSFILCITFALPLNAKKSQLITLTDSNWKECLTGEWMIKFYAPWCPACRDNEPQYSEFSEWSDDLGIKVATVDI
    TKQLGLSGRFMVTALPSFYHAIDGEFRRYNGERSADTMHEFIEGKLWKDHETVYWLRHPNSFGMTLMSWLFKTSVIMKNI
    HESLTEDYGLSLWMSYAVFGVGTIITGLFLGFILVCIVDFVSPPPPPPKKSTTVTQQKTAEPPVDDKNDKGGEGENKASL
    EEDSEKDSQASDWETINEAEIDPGSQGSQPRQRKIAASQLKEEDKKESEKVGGKGEKDD

    >gi|198420333|ref|XP_002126891.1| PREDICTED: similar to tumor suppressor candidate 3 isoform 2 [Ciona intestinalis]
    MVKYILVVTFLLAIFSLCSCKTKQDLLDEKVKQLTEWSNRRTVIQMNSNKYSTYVKSKPRNYSMIVMFTALDPKRGCSVC
    REANDEFTILANSYRFSPAYTSSLFFAVVDFDEGSEVFQSLGLNSAPAFMHFPPKGKRKGADTYDIQRLGFHADNLAKWM
    AERTEVVFIVLAMTSGQMWNHIRGPPYYHRNPQNGAIHYIHGSSQGQLVAETHIIMLIHAAIVGGFILLNEAHQPKVDIS
    KRRIMAIGGLVLVAFFLSLLMSIFRQKYQGYPYSFLLR

    >gi|74096113|ref|NP_001027810.1| peroxiredoxin-like [Ciona intestinalis]
    MSAGKACIQKSAPDFTATAVVNGDFRDISLSEYKGKYVVLFFYPLDFTFVCPTEIIAFSDRVSEFRDIGCEVLACSTDSH
    FSHLAWTNIPRKKGGIGNMKIPLIADKNCAISKDYGVLMEGSGIAFRGLFIIDTMGILRQITINDLPVGRSVDETLRLVK
    AFQFTDQHGEVCPAGWKPGDDTIKPDVQDSQKYFSKQ

    >gi|198420335|ref|XP_002126809.1| PREDICTED: similar to tumor suppressor candidate 3 isoform 1 [Ciona intestinalis]
    MVKYILVVTFLLAIFSLCSCKTKQDLLDEKVKQLTEWSNRRTVIQMNSNKYSTYVKSKPRNYSMIVMFTALDPKRGCSVC
    REANDEFTILANSYRFSPAYTSSLFFAVVDFDEGSEVFQSLGLNSAPAFMHFPPKGKRKGADTYDIQRLGFHADNLAKWM
    AERTEVVVRIFRPPNYTGTVVLVLLFSLAGGLLYVRRNSLEFFYNKTFWSILSIFIVLAMTSGQMWNHIRGPPYYHRNPQ
    NGAIHYIHGSSQGQLVAETHIIMLIHAAIVGGFILLNEAHQPKVDISKRRIMAIGGLVLVAFFLSLLMSIFRQKYQGYPY
    SFLLR

    >gi|198418983|ref|XP_002129037.1| PREDICTED: similar to protein disulphide isomerase [Ciona intestinalis]
    MNNLLKLLFVSFVFGLVSSEVPDATPEVKEENGVLILTNDNFDSVVTETKHVLVEFYAPWCGHCKALAPEYAKAAAQLKE
    EGSEVKLGMVDATVETELGTKFKVQGYPTLKFFKNGSPLEYGGGRQAADIVSWLKKKTGPPTVPLENAEAVANFKKDNEV
    VVIGYFPDSESDGHLSFKKVADEIDDVMFGSIHTAEAAAESDIAENTVTVFKQFDEGRADYDGAVTDGDLLNKFVKENQL
    RLVTEFTSESAPKIFGGDIQIHNLLFIPKLSQESQDHLTAFTEAAKQFKGKVLFIYIDTDSEENKRVMEFFGLTDADIPD
    YRIIKMSENMAKFKPDTKELTTEAIAAFTNKVVTGEVQRHLMSAEIPDDWDKNPVTVLVGKNFEQVAYDKKKKVFVEFYA
    PW
    CGHCKSLAPTWDKLGEKYSDNADVVIAKMDSTANELSQFEISGFPTLKFFPEVAEGEEQKVLDYDGDRTVEAMAAFID
    SNGEKGNVATKPLPPKETEPPADFNPNQIKDDMHKELEDVVPKGDPKEMLEKQAEKEKQEKQKTAEPKEGEKRVPQPEPK
    KGKEKKEL

    >gi|198428786|ref|XP_002128360.1| PREDICTED: similar to Ubiquitin-like modifier activating enzyme 3 [Ciona intestinalis]
    MEVDDCDDGARWSGRWNHLQKILERNGPFVHPDFEPSPDILDFMLNSCKVLVVGAGGLGCELLKDLSLMGLRHIHVIDMD
    TIDLSNLNRQFLFRQCDIGKPKAEVAASFINKRVKGTKCVPHFCRIQDHDSSFYKQFHIVVCGLDSIVARRWINGMLISL
    LEYDEDGNLDPSSLIPLVDGGTEGFKGNARVILPGMNACMDCTLDLYPPQVNFPM
    CTIAHTPRQPEHCIEYVKIFQWEKE
    KPFGDIAIDGDDPDHIKWICKAASTRADEYGIQGVNYRLTQGVIKRIIPAVASTNAVIAAACANEVFKLATSCSIPLNNY
    MVFNDTNGVYTYTFEAERNEQCLACNNTPRNLSFKPDALLREVVDFLCQDNSLQMKSPGLTTTIEGLNKTLYMKNIPSLE
    AATRPNLSKSLKDLGIVDGQEVIVADVTTPNSLRFKIKFNDDVTSS

    >gi|198437250|ref|XP_002130179.1| PREDICTED: similar to thioredoxin-dependent peroxidase (AGAP007543-PA) [Ciona intestinalis]
    MGVSFQLFTLACLFLAHSGICQERAVFWPPYESHLLQSTKAQISKPAPDWEGTAIVDGEIKTIKLGDYKGKYLIFFFYPL
    DFTFV
    CPTEIIAFSDRVAEFKKINAEVVAASVDSHFTHLAWLNTHRSEGGLGKLNIPLLSDLTHKISRDYGVLLEDLGHT
    LRGLFIIDPKGILRQITMNDLPVGRSVDETLRLVQAFQHTDEHGEVCPAGWEPGKDTIIPDPKDKLKYFHKTSKAKGEL

    >gi|198412120|ref|XP_002122342.1| PREDICTED: similar to GI11058 [Ciona intestinalis]
    MVIAIANKEEFENQLATAGNKLVVLDFFADWCWPCREIAPKYEKIAGENSEQAVFLKVDVTVDQTLAYKYKVTGLPTFIF
    FKHGENIKSFSGADEDQLRSNVETLK

    >gi|198437272|ref|XP_002130820.1| PREDICTED: similar to Pdia4 protein [Ciona intestinalis]
    MYRWKNILLLISLGLLLTASLSKADEEENDDSEDEEEESAPSEPERENGVYVLTDDNFDSFIEDKEVVLLEFYAPWCGHC
    KTFAPTYEKIAQALEGKVAVAKIDATASKDLGGRYEVTGYPTVKILKKVDGEHQAITYDGARTEDAVVQKVMELSDPDWK
    PPPEAVLTLTTENFDETVNNADIILVEFYAPW
    CGHCKKLAPEYEAAAQELKNRDTPLPLAKVDATAESALGTRFDVSGYP
    TLKLFRRGRAYEYDGGRDKTGIVNYMLEQSKPPSTSVETVKAIRNILHHSSDVTIIGCFNGADDTNLEVYQDSGNSLRSE
    YTFHHTFNKDVMDDVGCSEGEIVLFHPERFHSKYEKKSYKFPFSKSTTKAELEKYFSSHSVPLVGQRTRDNKDKRYGKRP
    LVVVYYGVDFSFDYRVATQVWRNKVLEVANQFKKVTFAIANEEDFQEELKRVGLEDSPEEINVIAYDDEDRKYPMEPNEE
    FDAEVLQEFVEDFLAGKLKPKIKSAPKPKKNSGAVKVVVGDTFNELVMGKKNVLIEFYAPW
    CGHCKKLEPVFKKLGKKLK
    GNDKVVIAKMDATANDIPHSAYKAEGFPTLYWAPEGSKDKPVKYDGGRELDDLLKFVNEKLSSSKDEL

    >gi|198427807|ref|XP_002131804.1| PREDICTED: similar to thioredoxin domain containing 9 [Ciona intestinalis]
    MESLIEQQLLQAAQVVEQQVDAEINRLESMDEDELEKIRERRVQAMKKAQVQKQEWISKGHGMYSELSSEKEFFDICKES
    KHVVCHFYKNSSFR
    CKILDSHLSTLAQQHCETKFIKLDVEKAPFLTERLGIRIIPTMAMVKDSKTQGYIVGFTDLGNCDD
    FSTEMLEWRLGCSEMVRYKGDLATPPDNRKASSSRPLTEKPKKTIRGREEDSEDSDYES

    >gi|198419492|ref|XP_002119638.1| PREDICTED: similar to Y45F10A.7a [Ciona intestinalis]
    MDLKGRILVYSISGCPHCKAAKEKLDSLNLPYNDVNLDNHPEQRDIMMKLTDQRSVPQIFFNEHHIGGNDKFQELSKDRL
    NELIELVKHNEPPPDSPQPVMESNTHDVPVLPPEEDEMSALVQDFSEQTEIIYDHRRFLTNETKSFTGEDLITYITIKKK
    TDRDSAKEIGQELINKKFMAAVKKVQNMKDDSTLYRLLQHWPSNALNAGLTSYKALTSASELSLLIRKTILHLYGDFLSK
    DGKHVDYTGISESVKFKDYVEQVAQLQRAQIDDMPRQESLAFFINIYNALVIHANIKLGFPETTWQRYKFFNDASYIIGG
    HKFNLQEIENGVLRANRKGVGMMVKPFSKSDPRLQYILQPNEPLIHFALVCGAKSCPPIKTYSPDNIENQLKLAAASFLE
    GEDGCRVDKKQGLIGLSLIFKWYKEDFGNTPHEVLLWVKEHMPNGLKKQDLALLLDKNAYKLVYLHYDWGSNKK

    >gi|198430301|ref|XP_002130038.1| PREDICTED: similar to heat shock protein 67B2 [Ciona intestinalis]
    MAHQGAPLPVLDDSQKISVGELKDLLAKSDPLVVDVRNPSEIEASGSIGSKKNINIPITDLDKELSLSNDEFKAKYGLDK
    PQGDGSDVIFH
    CMKGGRGSRAVVVAEKHGMKKARNLEGGYGLWSSQ

    >gi|198424221|ref|XP_002127851.1| PREDICTED: similar to glutaredoxin 3 [Ciona intestinalis]
    MGRLIHIKNEAVFSTRLEEAKKSLVVVHFWAPWAEQCKQMNDVMEELAKKNTNVVFLTIEAEELPEVSVKYEIEAVPTFI
    FIKNKQKIGKLNGAHAPELTKLVAQHIDTIAPPTPTTTDPKTALNNKLKSLINSAPCIMFMKGNPKEPK
    CGFSRTMVSIL
    NEHKCKYSTFDILQDQEVRQGLKEFSNWPTYPQLYVNGELIGGLDIVKEMVQEGELTSALPTQDETQTLEQQIKKIITQS
    HVVLFMKGEPGAPK
    CGFSRQIVQILSEAGVTYTHFDILTNEDIRQGLKKYSDWPTYPQLYAGAELIGGLDIVKEMAQAGE
    LAEALTEGSA

    >gi|198437302|ref|XP_002131488.1| PREDICTED: similar to ubiquitin-like modifier activating enzyme 2 [Ciona intestinalis]
    MEVSSEVNTPLSSSVLTDVNNAKLFVVGAGGIGCELLKNLVLTGFRNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAMVA
    KESVLRLCPKANINARHDSIFNPQYNMQFFKQFDLVLNALDNRAARNHVNRMCLAADVPLIESGSAGYLGQVTVIKKSVT
    ECYECQPAPRQKSFPG
    CTIRNTPSELIHCIVWAKYLFNQLFGEEDADQDVSPDTADPEAANNPGEKGDGSSEENNSHDLD
    KPRISTREWARECDYDAEKIFNKLFHTDINYLLSMDKLWQKRTPPKPVLWAECQEIQERQLDHQTVMTLQENARLFSESI
    NALKDEFKKQGDGGMLVWDKDEDPAMNFTSSVANIRAHIFHIEEKSCFEVKSMAGNIIPAIASTNAIVAGLIVLQALCLI
    RKRFADCRTVYVCEAVNDTKKLLKPCTLDPPKRGCYVCAEKPEITLKLNTKTLTCEQFRDKILKSHLGMLAPDVEILDGR
    GTILISSEEDEEENQSLGQTLDSFNITHGSRLRADDFLQNYDIVVNILHEENLPDDMIFQVSETKGTIGASAEKETTPEN
    NTEENSVVQEDKIEIIEDADPSASQDEIPRKRKRSSTNDKDSVLIDSSKRSKQCDDSVIVNDDNNVVVLD

    >gi|74096237|ref|NP_001027618.1| dynein intermediate chain 3 [Ciona intestinalis]
    MAKRKEVILQETLNTQEAWEVAMNSGKLYVVDAHQKWCGPCTAIVGMLKRIKNELGDDLLRFATAQVDVIDTLEQYRGKC
    EPNFLFYGGGELVAAVRGCNAPLVQETIQETLKNEHKILSGEMERKVFRDVYSDTPDQEEEEEDEEEEEGGVVSKQITVA
    LIKPDVVQNGQVDEILQKISEAGIEVLADEERMLTVEEARDFYKNKEEEEYFDQLIDYVTSGPCRVLVLTKGESGEGVVT
    LWRDIIGPFDAAVAKEENPDSLRAIYGTDATSNALHGSSSTEEAVRELGFFFPDFKPPTYRSAKSAASRASGRRSKTPSQ
    KPRLQRTLAIIRPDALQAHKDSILQKIDEAGFKIAMQKEMVLTREQAESFYSEHKDTDYFEPLVKQMTCGPVLALCLAHD
    DAVDHWRSMLGPKVVADAVEEQPDSLRAQFRVEEAEVNMLHGSDSAEAAEEELSKIFHVEQTLAVIKPDAIDEKEQIMGK
    LKEAGFMISCQKDMNLSKEIASEIYKSKEGSEYYDHLIDHMTSGPTLMMVLSAENAVEKLRDIMGPTDPEVAKESHPESL
    RAMFAKSILENAIHSPSTNESAQEKIRIVFGDAQFDWDVNDMQAEEGEVNETSGEQPTDEQSGETEKTEEDGEHEGAQSD
    QQQAVSEAMEKEE

    >gi|198419516|ref|XP_002120410.1| PREDICTED: hypothetical protein [Ciona intestinalis]
    MSSHRQYDDEPHEAVASMGRKVCRVCDDFKSWRKNKNEEPRSPSCPLDREELGRNTWSFIHTMAAYYPRKPTEQQQCEMK
    QFIESFSKFYP
    CVDCAEDLRKNIKLNPPKVGGRVDLSRWFCEQHNIVNLKLGKQQFDCSKVLERWKNGWKDGSCD

    >gi|198436302|ref|XP_002128139.1| PREDICTED: similar to prostaglandin E synthase 2-like [Ciona intestinalis]
    MLGLCRITNFHRVTSICGSVYYAAPVQLAYSRINNANIQKSSLTTYTPSSRRQNYGHGSYKTMVLSMLFGSGMCVYLHKD
    KQFIRCHHKNSECANSSKWDGMTIKLYQYQT
    CPFCTKTRCFLLAHGIPFENIEVHPIFKKEMKFSKYKKVPLVTVEKNGE
    VLELRDSSLIISILSSYIINEGMNITELLKRYPTTTVVGEDGKSKQETLNKHWLISDEADLATVENDARKEEAEWRFWAD
    DYLVHLISPNVYRTYREAYQAFDYHVKQGRFNGTWEGVVAKYLGSIAMWGIAKRLKTKYKLDENVRLDLYKACNKWTEAI
    GKGRTFMGGSKPNLADVSVFGVLSVMENLDSFHDVLTHTNIKKWYYKTKQAIEDHGGQTLNLRTTT

    >gi|198437815|ref|XP_002129792.1| PREDICTED: similar to GK20354 [Ciona intestinalis]
    MTINSEHPLTFYSQMWCPKSQSILLALEASGLPHTTVNLAVDDKNHVCNDNEKSQPALVQNGNISKQNYKEAVQFLHGLD
    GANANQDVAKKTKQDRILDHFFEHILPYFEKSVVLDSPREGLDLFIEASSFLENELVTAGGSYFGGREPSFADYGLFPYF
    DKVGKWFQDFDDYECPRIKSWIRVMRQHPLVVKVLKDTHTNDHLARYTEDVVNRKS

    >gi|198414255|ref|XP_002126638.1| PREDICTED: similar to glutathione S-transferase omega 2 [Ciona intestinalis]
    MVAGSGMGNSVHLKEGSPEPAPVAKGVLRVYGMKFCPYVHRLKLVLAAKEVAHETININLKSKPKWYFAKNPQGKVPTIE
    IDGNVICESDITSEYVDAVYPGRKLTTTDALKATNEKMLLVYWGNKCVTNFYKYCMAKPDDKEAKDAALATLKEGLEYLA
    TFLKKNGSVFICGSQPGLTDYFLYTHLERINAIVPVDLKQIPKVKTYFDQMQEDKAVKSCRFSDELHREFGRKAVAGDIG
    AYDIGPVAQ

    >gi|198431325|ref|XP_002122117.1| PREDICTED: similar to predicted protein [Ciona intestinalis]
    MSLKLYSYFRSSCSWRVRICLALKSIDYETIPIHLVKDGGQQHQESYKKLNPMAQVPALVVDDKVVITQSAAIIEFLEEK
    YKSKDAPLLPDDIYKKAKVKEICEMIGSGIQPIQNLAVLNKVGETRMDWGKYWIDVGFQALEKMLQNCAGKYCVGDDITM
    ADAFLVPQVGNAIRFKVDMSQFPIISRINATLEEHPAFKAAHPNNQVDSPDKN

    >gi|198416219|ref|XP_002123904.1| PREDICTED: similar to glutathione S-transferase omega 2 [Ciona intestinalis]
    MVAGSGMGNSVHLKEGSPEPAAVAKGVLRVYGMKFCPYVHRLKLVLAAKEVAHETININLKSKPKWYFAKNPQGKVPTIE
    IDGNVIYESDITSEYVDAVYPGRKLSTTDALKAANEKMLLVYWGNKSVTNFYKYCMAKPDDKEAKDAALATLKEGLEYLA
    TFLKKNGSVFICGSQPGLTDYFLYPHLERINAIVPAVDLKQIPKVKTYFDQMQEDKAVKSCRFSDELHREFGRKAVAGDI
    GAYDIGPVAQ

    >gi|198417071|ref|XP_002123906.1| PREDICTED: similar to thioredoxin domain containing 15 [Ciona intestinalis]
    MSESYLNICPTSQLEYETNYSIFRDLNFFGNGNFSNELKNCHNVGTDPVFPATILMSVAQLLSHLGSHEPGICAVVLFYA
    TW
    CPFSMKMAADYNALGRLFPTIPIIAVEVESQINTFSSNQLRFGTISVPNLLIFQGPRAISRYNQTHIDLQLLTQFMKQ
    HINVDVQTNCSPNVSTCSDFQIMEQDHIGPLPTKLQTDTDWILIFSILFLLYIVFTKVKTVVV

    >gi|198414609|ref|XP_002119781.1| PREDICTED: similar to thioredoxin [Ciona intestinalis]
    MGVVTITTKQDFDDKLVAAGDKLVVVDFTAGWCGPCRIIAPKFQSIAEENPDVDFLKVDVDANQDLADEYKVQGVPTFIF
    IRNGKKLESFSGANEAKLKENVLKLK

    >gi|198433813|ref|XP_002119504.1| PREDICTED: similar to thioredoxin domain containing like [Ciona intestinalis]
    MISVSYGQNVLKVFILLGLMCKVFSTVPAPLPTTIDHGLGGHINWTTLDKGIEDSVKTRKPIMMIIHQTWCKACRDLLPR
    FRASESISEMAQYFEMVNVIDEEIPEDDAFAPDGGYFPRILFIGPDGDVRTDIQNPRATKKFLFYHYDTDTIELAMMKAL
    RTFYQFSDDDDDVEL

    >gi|198414964|ref|XP_002131664.1| PREDICTED: similar to phosducin-like 3 [Ciona intestinalis]
    MQNPHEDTEWNDALRKHGILPKKEVVVQPPEEDESEPKQNYDDMSLDELAEFEDEEEERIMDLYRQKRLAELKALQMKSK
    FGDVREISAQDYVQEVNKAGEDIWVVLHLYKQGIPL
    CSLINQHITRLAAKFPEVKFLKSISTTCIPNFPDKNLPTLFIYK
    NGDLVHQWIGALHFGGMNLTQDQLEWKFHQADIVKSNLESNPTSKVFDVMSSSIRSSNRDGDSSDEE

    >gi|198420469|ref|XP_002122728.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 [Ciona intestinalis]
    MKLPKLNLVCFVFILQLTYCFGEDYYEVLGVSKDASLKQIRKAFKKLALTMHPDKNVNDPEAHNKFIKINGIYEVLKDED
    LRKKYDQFGEEGLKENGRGGGRYESYNYYRDEFGIYDDDPDVVTLDGSDFDAAVKSGETWFVNFYSPR
    CSHCHDLAPTWR
    KFAEELSGAINIGAVNCHDNRWTCNQKGVHSFPSLLLLLKNNRPIKYMGDRSKKDLMKFVLEHVNIDVVDLWDGNIAEEI
    SSHPKLPWVVSFCGGDAEAHEDEDGEIIGDCPSRNTRMKMAGLLKDIANVGSIDCGTSPELCKRANASKKAGVYYFPLDT
    FPEPKKNDRIHSFSSLDAREIYSEFMLQLMPSLTKVTVTKLEKLVSRQATLAFFQFDTTNDVDVKETNLKKLPQLLKDHN
    IDVVKVYCNNTRWCFDNFHISQDAVLVFKGTGIEEYEIHHGKLTTAELSLFAHESVHARVATLNAQHFHENSLKESNQPW
    FVDFFAPW
    CPPCRALLPELRKASTSLLNIKFGTVDCTSFSSICEKFKIHSYPTTMLFNQSVVTEYNGQHNSHGILEFVQD
    LISPPYEHLNPESFKDKVLRRGVGVTWIVDFYAKW
    CGPCKAMLPAWRQMAKLLEGVVKVGAVDCAIPTNNQLCKTQGVNA
    YPEIRLFPSKKKPRSNPLYKVYTDWNRQALAMAGWAIESTNHDVKDMTMEDFDRGQLIDKQAWLLDFYAPW
    CGPCMAFSP
    KFILTSFRFVGRVKFGKVNCQQFPSICSQAGVNAYPSVKFYHPVKSDEKRSSVKSITSQDPDEITQLVEQFIQPYKHLIK
    KKSSQKKKDEL

    >gi|198423786|ref|XP_002128583.1| PREDICTED: similar to dihydrolipoamide dehydrogenase [Ciona intestinalis]
    MLKLGQFISKSTNLSSNVLRQPYFIRASNYSSQTHDADLVVIGSGPGGYVAAIKAAQLGLKTVCVEKEATLGGTCLNVGC
    IPSKALLNNSHYYHMATGKDFAMRGIDAEVKLNLPKMMEQKSTAVTGLTSGIAGLFKANKVTRVDGHGIIKGPNQVVAKK
    ADGGEETINTKYILIATGSEVTPFPGIEIDEETIISSTGALSLKEVPKRMIVIGAGVIGVELGSVWSRLGSQVTAVEFLG
    HVGGMGIDMDVSKTFQRTLQKQGLKFKLNTKVTSAEKTASGIQVNVESAKGGKAETLECDVLLVCIGRRPYTNNLGLESV
    GIELEPRGTIPVNERFQTSSPTVYAIGDVIKGPMLAHKAEDEGIICVEGLTGAPVHIDYNCVPSVIYTHPEVGWVGKNEE
    QLKEENAPYKIGKFPFSANSRAKTNADTDGFVKILSHKETDRILGAHIIGGGAGEMINEAVLAMEYGASAEDVARVCHAH
    PTLSEAFREANLMAYCGKPINNV

    >gi|198434329|ref|XP_002122693.1| PREDICTED: similar to Glutathione transferase omega-2 [Ciona intestinalis]
    MIQGSGMSNSVHQKECSAEPTPPAKGVLRVYGMKFCPYVQRLKLVLAAKGVAHETININLLSKPKWYFTKNPMGKVPTIE
    IDDVVIYESDIVSEYVDAVYPGRKLCTTNALKSAKEKMFLVYWGNNCVVNYYKYARELKNNDQEAKDAFCALVKEGLEKT
    ATFLENNGTPYICGSQPGLTDYLLYPHLERINAIVPVDLKQIPRVKAYFDAMQEDEAVKSCRFSNELHLEFIKKYVTGDV
    GAYDIGPVAE

    >gi|198434331|ref|XP_002122925.1| PREDICTED: similar to MGC89704 protein [Ciona intestinalis]
    MVAEKGGNSKHLRQDSKDPEAAENDVVRVYGMKFCPFTHRLKLVLAAKGVDYEIININLQSKPSWYFKRDPEGKIPTLEQ
    NGNLVMGSDVASAYVDAMYPGKQLVTTDPLKAAHEKMLLEQWAKSITGYHNYAFGKDDNNDKIIGPMKVKEGFEKVEKYL
    KENEGPFICGSEPGLTDYILYPHLERIGALIPLVITQFDHVKAYYDKMQDDPAVQACRISDEQHRDFIHRACAGDIDACD
    IGVGK

    >gi|198421424|ref|XP_002129633.1| PREDICTED: similar to thioredoxin domain containing 10 [Ciona intestinalis]
    MWNKILFLVILVCWGAEGRVLELDERFLKVESQGLWLVMFYAPWCGHCKNLEPTWIEVGAELAKGNSEVSVARLDATKYS
    AITSKYQVRGFPTIKFFKHGTTFDYDGPRSKENIVSFVSRAKGPSVVDIRNHAEFLQIKQRSTVFFAYVGAADTNLRKMF
    DETANSLFTSIDFYSIRDVSILKGMKIETTPTVVVFKDKKFYEMPANPMSSDFVQMWIRSEQFPSYNALTGMSYHSLRGA
    GLRFAVAAVNKNDKFNTTMKDIALKRNYPYTFCWVEGNGIVNSMTYGTISVPNLVVFDTNSYEYYTLCEEGDCESKLNEK
    EVTKFFKDIKDGVIEPKGGRGFWQQTKRFVTDAIGSVVGFFRESPIIASLVILLPTVVISGLCVCLCSITDGQEDGEQYT
    DDEDEEEDDLPPYNPDDLEQNTELEEELLHEDLAIGDSSEGVRQRVNIKPQEETG

    >gi|198419129|ref|XP_002126758.1| PREDICTED: similar to peroxiredoxin 3 [Ciona intestinalis]
    MFINRLVHGFRRTHTLQSSLNPWISKWNPNSASISTSCRSMVAQVTQPAPPFKGMSVVEGKFKEISLEDYKGKYLVLFFY
    PLDFTFV
    CPTEIISFSDKSPEFEKLDTVVVGASVDSHFSHLAWINTPRKQGGLGEMKIPLLSDLTKNISRDYGVLLENAG
    IALRGLFIIDPSGTIRHASVNDLPVGRSVDEVLRLVQAFQFVDKHGEVCPASWTPGSKTIKPSVDGSKTYFEEAN

    >gi|198427398|ref|XP_002129137.1| PREDICTED: similar to chloride intracellular channel 5 [Ciona intestinalis]
    MEEQTYQNVNEFEPNQEPETNNRDYLHHYQTEEEDLPPPPPPEHKYDFDEQSTTSSASNEPQEPISLGSMAESIVQGVAD
    LKTSDKSTNSSPVVVNGDQPSETPSQPRDNKIALFVKAGSDSECIGC
    CPFSQRLFMILWLKGVVFNVTTVDKTKKVPQIN
    DALGSVNPPVLIFNGEMLTDNQKCEDYIEAELYPPRYPRLACKHSNSNTVGNDIFAKFSAFAKFRGNPNDPKREGMRKKL
    DQALSKLNDYLLEPLDDEIDEGADDNEPQRSSRKFIDGNTMTIADCNMLPKLNMIQVTGRALLNYEIPHSFDAIYRYLET
    SFGMPEFRETCPHDDEIVYFYGGRKPKARSSKH

    >gi|198425338|ref|XP_002126714.1| PREDICTED: similar to protein disulfide isomerase-associated 3 [Ciona intestinalis]
    MKHLFIALSALCVAIVSAADDVLVLTDSNFDAEIVKHSIILMEFYAPWCGHCKKLAPEYDIAATKLKRNDPPIRIGKVDC
    TENTATCSKFGVSGYPTLKLFADGKLSKDYDGPRQADGIVKYMQKAASPAAVLIETAAAHDKLLQKSSSVVVVGYFTDKA
    KATAFENVAKTLRDDYKFAYTTSDDVMDAAGEKDTVKMYRPQAMANKFEESTMVIAGEPTVDGYRTFLNENALGRCGLLT
    TDNYGKFKKPLVILAGSDVDYVKNIKGSNYWRNRVVKFGKEFKEQLTFGIANKDGIVGLLPESGLPEDVSPVVVIVDAQD
    RKYVMPNAFSKDNFVAFLTSYTNGELSPFIKSEEPPADNDGPVTVVTGKTFDEIVMDESKDVLIEFYAPW
    CGHCKSLEPK
    WNELGEKMKDNNDIVIAKIDATANDSPSQFQVSGFPTIYFAPKGNKQNPVKYQGGREVADFSKYLKENASKGKSEL

    >gi|198425858|ref|XP_002124064.1| PREDICTED: similar to PDIA6 protein [Ciona intestinalis]
    MVVHTPEVLDDARPASIGAVNADAHPSLGSKYGVQGFPTIKIFGFDKSNPKPYNGARSADAITDAAMKAVREMVEDRKSG
    KKRGGGGGGQSRKEEKSSSDDVVTLTDSNFRELVLEGKETWFVEFYAPW
    CGHCKNLAPQWARAATEVKDKTEGTIKLGAL
    DATVHQATAQQYGIRGYPTIKIFKQNEKSSPIDYDGSRDSSGIVNKAMEYYVENIDPPTIYELVSQEVFDENCGTHLCIL
    AFLPDIADDGKDGRNRYIDLLKSLGDRFKKQRWGWAWLPANANPELEKSLKVGGSGYPALVALNKKKDVYALYMGAFSDD
    GLGPFLNQLTYGRSRLSTHTLSEGKLPEVKTREPWDGKDAPPMEFVDEDLSDFKWDDEL

    >gi|198435880|ref|XP_002128574.1| PREDICTED: similar to Molybdenum cofactor synthesis protein 3 (Molybdopterin synthase sulfurylase) (MPT synthase sulfurylase) [Ciona intestinalis]
    MDQESISRYSRQLIMPEIGVKGQLKLKDSSILIIGAGGLGCPAIQYLVAAGIGQIGIVDYDEVELSNLHRQILHTETKAE
    RKMRKTSSAAEAALQLNSKVKVDEYCLQLDRENALGIVGKYDVVLDATDNVPSRYLINDVCVVLNKPLVSGSALRWEGQL
    TTYHFHNKEENTYGPCYRCLYPKPPPPETVTN
    CSDGGVIGVIPGIIGCMQSLEAIKIIVGVSPSYNQKLLVFDGLYGAFR
    TIKLRGAQETCAVCGKDPSITANNLPNYEEFCGTAATDKCLKLNILNSEERISAMEYKDLYVDRKKPHVLVDVRSEIEIE
    ICALPNSINVPIKVFERCQRIVKGGNNVNVKELNTRLDKAVQDAEVKDDEKLQVFVVCRLGNDSQKAVEIMKKHVTLPSN
    INVRDIKGGLLAWSNSVDKSFPRY