Canis familiaris

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|74009219|ref|XP_549390.2| PREDICTED: similar to chloride intracellular channel 2 [Canis familiaris]
    MADPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEE
    FLEQTLAPPRYPHLSPKNKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSAEELTV
    SRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYASVAKQKS

    >gi|73986497|ref|XP_542042.2| PREDICTED: similar to Peroxiredoxin 2 (Thioredoxin peroxidase 1)
    MTSGKAHIGKPAPPFQATAVVDGAFKEVKLCDYKGKYLVLFFYPLDFTFVCPTEIIAFSEHAEDFRKLGCEVLGVSVDSQ
    FTHLAWINTPRKEGGLGPLNIPLVADVTRSLSEDYGVLKEDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEVLRLVQ
    AFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

    >gi|73945954|ref|XP_541090.2| PREDICTED: similar to Thioredoxin-like protein 1 (32 kDa thioredoxin-related protein) [Canis familiaris]
    MVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQ
    HLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDMTFLESDCDEQLLITVAFNQPVKLYSMKFQGP
    DNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTF
    IGTPVQATNMNDFKRRVHIGKLRVINL

    >gi|73986499|ref|XP_867426.1| PREDICTED: similar to Peroxiredoxin 2 (Thioredoxin peroxidase 1)
    MTSGKAHIGKPAPPFQATAVVDGAFKEVKLCDYKGKYLVLFFYPLDFTFVCPTEIIAFSEHAEDFRKLGCEVLGVSVDSQ
    FTHLAWINTPRKEGGLGPLNIPLVADVTRSLSEDYGVLKEDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEVLRLVQ
    AFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

    >gi|74007799|ref|XP_549095.2| PREDICTED: similar to implantation-associated protein isoform 1 [Canis familiaris]
    MAARWWLWCVSANMAVALLLSYGVPSASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTA
    LQLHRQ
    CVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRG
    FSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSSMEFLFNKTGWAFAALCFVLAMTSGQMWNHIR
    GPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIALVVLFFSWMLSI
    FRSKYHGYPYSFLMS

    >gi|73964749|ref|XP_540488.2| PREDICTED: similar to prolyl 4-hydroxylase, beta subunit [Canis familiaris]
    MLRRALLCLALAALTRAGAAAPEEEDHVLVLHKGNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGTLKAEGSEIR
    LAKVDATEESDLAHQYGVRGYPTIKFFKNGDTAAPREYTAGREAEDIVNWLKKRTGPAATTLPDGAAAEALLESSEVTVI
    GFFKDVESDFAKQFLLAAEAIDDIPFGITSNSDVFSKYQLSKDGVVLFKKFDEGRNNFEGEISKEKLLDFIKHNQLPLVI
    EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDSKLSNFKKAAERFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLI
    TLEEEMTKYKPESTELTAEKIEDFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPW
    CG
    H
    CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
    GDDDDLEDLEEAEEPDLEEEDDQKTVRDEL

    >gi|74001420|ref|XP_544870.2| PREDICTED: similar to chloride intracellular channel 6 [Canis familiaris]
    MAGERSVLELPLLALSLLLHFLGAGYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFD
    GEVKTDVNKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKNLLKALKKLDNYLNSPLPD
    EIDAYSTEDITVSGRKFLDGDELTLADCNLLPKLHIIKIVAKRYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEIE
    HAYSDVAKRMM

    >gi|73968713|ref|XP_850508.1| PREDICTED: similar to methionine-R-sulfoxide reductase B3 [Canis familiaris]
    MKRLGSVIEPLGLTSWPSQVAPFEYVSTRPFRQATANANLKGMKGGRWWEGPRVSTAAFKCPEKLGGLRPNQTRRARDAG
    GGSVWDGGGRAAHGSPWLVVQTRRARRSPPAPCTPRASILCLTALGGRSIFNSTSWEIQQVLTAHFISSLLENTVLHDKE
    WIDFDTDSVGMNPAFCGLECKGRAALPARHPLGGHASLVPTASSIWVRFERRPGKKCIFVLCLTCGVTSLPFFLCAGFDT
    SQMAQAIGRRAGRLVQPLMKQDRRTFYGQPGEHEEAAAWLSDCIYRAHSIPLGEGEAVSIIRTVDLGIINGKMERKFPFA
    VLCSRFALSKLLRLFIAFRSVGEDITVMSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYH
    VTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFRSESKFDSGSGWPSFHDVISSDAITFTDDFSYGMHRVETSCSQCGA
    HLGHIFDDGPRPTGKRY
    CINSASLAFTPAGGGTQGSSGPGGPAAGGRAEL

    >gi|74002900|ref|XP_535765.2| PREDICTED: similar to Protein disulfide-isomerase A5 precursor (Protein disulfide isomerase-related protein) [Canis familiaris]
    MTMGPLHWWVLRGRGPCPKALLAHQTRQGACRKALRGFLLPVAFSQDARGFISLPQARDMDCGAEERTPSPLIGAKRAPS
    CPPAPRLRGWDVEWLRDEVWAAGEGGTLETAELAGITRERGGFRRDNDINTSSNDSYVMDVAWRGNACEGGGTVVLPVWL
    SSTKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAAESHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDL
    SPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHIDSEKDFRRLLKKEEKPLLMMFYAPW
    CSMCKRIMPHFQKAATQLRGHFVLAGMNIYPSEFENVKEEYNVRGYPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQP
    PQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPW
    CGHCKKMKPEFENAAEVLHGEADSSGVLAAVDATVNK
    ALAERFHISEFPTLKYFKNGEKYAVPALRTKKNFIEWMRNPEAPPPPEPTWEEQQTSVLHLAGDSFRETLKKKKHTLVMF
    YAPW
    CPHCKKVIPHFTATADVFKDDRKIACAAVDCVKEKNQDLCQQEAVKAYPTFHYYHYGKFAEKYDSDRTESGFTSFI
    RALREGDHERLGKKKEEL

    >gi|74007803|ref|XP_860306.1| PREDICTED: similar to ATPase, Cu++ transporting, alpha polypeptide isoform 2 [Canis familiaris]
    MDRSMSVDSVTISVEGITCDSCVWTIEQQIGNLNGVYHIKVSLEEKNATIIYDPKLQTPKTLLEAIDDMGFDAVLHNPNP
    LPVLTDTVFLTVAGSLALPWDHIQNTLLKTKGVTDIKISPQQRTIVVTLIPSIVNANQIIELLPDLSLDIRTLEKKSGTC
    EDYSMAQAGEVMLKMKIEGMT
    CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIGYQPHLITIEEIKKQIEAVGFPAFIKK
    QPKYLKLGAIDIERLKNTPVKSSEGSQQRSPSYTSDSTVTFIIDGMHCKSCVLNIESALSTLQYVSSIVVSLENRSAIVK
    YNASLVTPETLRKAIEAISPGQYRVSIASEVESTSNSPSSSPLQKIPLNIVSHPLTQETVINIDGMTCNSCVQSIEGVIS
    KKEGVKSIRVSLANGNGTVEYDPLLTSPETLREAIEDMGFDAALIFPCPPDINEPLVIIGQTSSEMPLLTSTNEFYTKMM
    TPIHDVETKTSSKCYIQVTGMT
    CASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPVVIQPPMIAEFIRELGFGATMI
    ENADEVDGVLELVVRGMT
    CASCVHKIESILTKHRGIFYCSVALATNKAHIKYDPEIIGPRDIIHMVESLGFEASLVKKDR
    SASHLDHKREIRQWRRSFLVSLFFCIPVMGLMIYMMVMDHHLAILHHNQNMSQEEMINIHSSMFLERQILPGLSIMNLLS
    FLLCVPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPITFFDTPPMLFVFIALGRW
    LEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITG
    EAMPVAKKSGSTVIAGSINQNGSLLIRATHVGAETTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVIISIATLLVW
    IIIGFLNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAH
    KVKVVVFDKTGTITHGTPVVNQVKILVESNRISRNKILAIVGTAESNSEHPLGAAITKYCKQELDTETLGTCIDFQVVPG
    CGISCKVINIEGLLHKDNWKIEENNIKNASLVQIGANNEQSSTSSSMIIDAQLSNTLNAQQYRVLIGNREWMIRNGLVIN
    NDVDDSMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSRTARSIASQVGITKVFAE
    VLPSHKVAKVKQLQEEGKWVAMVGDGINDSPALAMANVGIAIGTGTDVALEAADVVLIRNDLLDVVASIDLSRKTVKRIR
    INFVFALIYNLVGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHARSQMGQKRPSEISV
    HVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSIGTSEPDKHSLLVGDYREDDDTTL

    >gi|74007805|ref|XP_549096.2| PREDICTED: similar to ATPase, Cu++ transporting, alpha polypeptide isoform 1 [Canis familiaris]
    MDRSMSVDSVTISVEGITCDSCVWTIEQQIGNLNGVYHIKVSLEEKNATIIYDPKLQTPKTLLEAIDDMGFDAVLHNPNP
    LPVLTDTVFLTVAGSLALPWDHIQNTLLKTKGVTDIKISPQQRTIVVTLIPSIVNANQIIELLPDLSLDIRTLEKKSGTC
    EDYSMAQAGEVMLKMKIEGMT
    CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIGYQPHLITIEEIKKQIEAVGFPAFIKK
    QPKYLKLGAIDIERLKNTPVKSSEGSQQRSPSYTSDSTVTFIIDGMHCKSCVLNIESALSTLQYVSSIVVSLENRSAIVK
    YNASLVTPETLRKAIEAISPGQYRVSIASEVESTSNSPSSSPLQKIPLNIVSHPLTQETVINIDGMTCNSCVQSIEGVIS
    KKEGVKSIRVSLANGNGTVEYDPLLTSPETLREAIEDMGFDAALSDINEPLVIIGQTSSEMPLLTSTNEFYTKMMTPIHD
    VETKTSSKCYIQVTGMT
    CASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPVVIQPPMIAEFIRELGFGATMIENADE
    VDGVLELVVRGMT
    CASCVHKIESILTKHRGIFYCSVALATNKAHIKYDPEIIGPRDIIHMVESLGFEASLVKKDRSASHL
    DHKREIRQWRRSFLVSLFFCIPVMGLMIYMMVMDHHLAILHHNQNMSQEEMINIHSSMFLERQILPGLSIMNLLSFLLCV
    PVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIA
    KGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPV
    AKKSGSTVIAGSINQNGSLLIRATHVGAETTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVIISIATLLVWIIIGF
    LNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVV
    VFDKTGTITHGTPVVNQVKILVESNRISRNKILAIVGTAESNSEHPLGAAITKYCKQELDTETLGTCIDFQVVPGCGISC
    KVINIEGLLHKDNWKIEENNIKNASLVQIGANNEQSSTSSSMIIDAQLSNTLNAQQYRVLIGNREWMIRNGLVINNDVDD
    SMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSRTARSIASQVGITKVFAEVLPSH
    KVAKVKQLQEEGKWVAMVGDGINDSPALAMANVGIAIGTGTDVALEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVF
    ALIYNLVGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHARSQMGQKRPSEISVHVGID
    DTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSIGTSEPDKHSLLVGDYREDDDTTL

    >gi|73963782|ref|XP_853432.1| PREDICTED: similar to Thioredoxin domain containing protein 1 pre
    MSETSQKGQSRNDRYTDGFYSQIEVTWRSVWIQREGRASKANWGKPTSRNHIKTNQEAAASEEGEKQSSEAQLKARQSAR
    GQAHEQIRPRGRKWRAAAQRWGPPRLLWGGRAAGMMPSGSPAVPVAVLLLLVWGAPWTHGRRSDVRIITDENWKELLKGE
    WMIEFYAPW
    CPACQNLQPEWESFAEWGEDLEVNVAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINF
    ISEKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLLSGLLLGLCMIFVADCL
    FPSKRRRPQPYPSKKLLPESSQPLQKVEEEQEADEEDVSEEEAGSKEGTNKDFPQNAIRQRSVGTSLATDKS

    >gi|73947972|ref|XP_533699.2| PREDICTED: similar to Ubiquitin-like 1 activating enzyme E1B (SUM
    MNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIR
    NTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEASWEPMEAEARARASNEDGDIKRISTKEWAKSTGYDPVKLFT
    KLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYACLFSKSIETLRVHLAEK
    GDGAELIWDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTI
    FLNKQPNPRKKLLVPCALDRPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEG
    ETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDIEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQP
    STSTAQEQDDVLIVDSDEEGPSNNADISEEERSRKRKLDEKENISAKRSRTEHTEELDDVIALD

    >gi|74007348|ref|XP_538014.2| PREDICTED: similar to ubiquitin-activating enzyme E1 [Canis familiaris]
    MSSSPLSKKRRVSGPDPKPGSNCSPAHSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGL
    RGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVSAYTGPLVEDFLSGFQ
    VVVLTNTPLEDQLRVGEFCHSRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDSPGVVTCLDEARH
    GFESGDYVSFSEVQGMVELNGSQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLLASLAEPDFVMTDF
    AKYSRPAQLHLGFQALHQFCAQHGRPPRPRNEEDATELVALARAVNARALRAVQQDSLDEDLIRKLAYVAAGDLAPINAF
    IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEALTEDKCHPRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIG
    CELLKNFAMIGLGCGEGGEIVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIY
    DDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSN
    NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATLLRSVQVPEFT
    PKSGVKIHVSDQELQSANASVGEALPPHLPPPSPCNSPSLHLFPLAHAAYQVRGQIQFPYGFIVAASTSRAENYDIPPAD
    RHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVHGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFE
    VQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQP

    >gi|73998604|ref|XP_864832.1| PREDICTED: similar to NHL repeat containing 2 isoform 2 [Canis familiaris]
    MAAPRARGCSLAGLLPAQTSLEYALLDAVTQEEKDSLVYQYLQKVDGWEQDLAVPEFPEGLEWLNTEEPLSVYKDLCGKV
    VILDFFTYC
    CINCIHLLPDLHTLEHTYSDEGICPLIGF

    >gi|57107627|ref|XP_544027.1| PREDICTED: similar to NHL repeat containing 2 isoform 1 [Canis familiaris]
    MAAPRARGCSLAGLLPAQTSLEYALLDAVTQEEKDSLVYQYLQKVDGWEQDLAVPEFPEGLEWLNTEEPLSVYKDLCGKV
    VILDFFTYC
    CINCIHLLPDLHTLEHTYSDEDGLLIVGVHSAKFPNEKVLDNIKSAVLRYNITHPVVNDADASLWQELEVS
    CWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIEIKLYKDSLPPSPLLFPGKVTVDHVSNRLVI
    ADTGHHRILVVWKNGQIQYIIGGPNPGRKDGIFSESTFNSPQGVAIRNNIIYVADTENHLIRKIDLEAEMVSTVAGIGIQ
    GTDKEGGAPGEEQPISSPWDVVFGMSGSEVGGDDILWIAMAGTHQIWALLLDCGRLPKKNELKKGTCLRFAGSGNEENRN
    NAYPHKAGFAQPSGLSLAPEDPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNLFAFGDVDGVGVNARLQHPLGV
    TWDKKRNLLYVADSYNHKIKAVDPKTKNCTTLAGTGDASNVITSSFTESTFNEPGGLCVGDNGQLLYVADTNNHQIKVMD
    LETKTISVLPVSRPDNAVVDGPFLVEKQKTLPKLPKSAPNIRLSPVAASPGQTLQFKLRLDLPSGTKLTEGVPSCWFLTA
    EGNEWLLQGQIPSGEIESISSQPAISLQIPGDCLSLEAVISISVFLYYCSADSSACMMKGILFSQPLQITSTHQECTAPV
    ELKYVF

    >gi|73998607|ref|XP_864867.1| PREDICTED: similar to NHL repeat containing 2 isoform 3 [Canis familiaris]
    MAAPRARGCSLAGLLPAQTSLEYALLDAVTQEEKDSLVYQYLQKVDGWEQDLAVPEFPEGLEWLNTEEPLSVYKDLCGKV
    VILDFFTYC
    CINCIHLLPDLHTLEHTYSDEDGLLIVGVHSAKFPNEKVLDNIKSAVLRYNITHPVVNDADASLWQELEVS
    CWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDNKIEIKLYKDSLPPSPLLFPGKVTVDHVSNRLVI
    ADTGHHRILVVWKNGQIQYIIGGPNPGRKDGIFSESTFNSPQGVAIRNNIIYVADTENHLIRKAPCMEPASPSACVSSSL
    SVCVSQIDLEAEMVSTVAGIGIQGTDKEGGAPGEEQPISSPWDVVFGMSGDDILWIAMAGTHQIWALLLDCGRLPKKNEL
    KKGTCLRFAGSGNEENRNNAYPHKAGFAQPSGLSLAPEDPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNLFAF
    GDVDGVGVNARLQHPLGVTWDKKRNLLYVADSYNHKIKAVDPKTKNCTTLAGTGDASNVITSSFTESTFNEPGGLCVGDN
    GQLLYVADTNNHQIKVMDLETKTISVLPVSRPDNAVVDGPFLVEKQKTLPKLPKSAPNIRLSPVAASPGQTLQFKLRLDL
    PSGTKLTEGVPSCWFLTAEGNEWLLQGQIPSGEIESISSQPAISLQIPGDCLSLEAVISISVFLYYCSADSSACMMKGIL
    FSQPLQITSTHQECTAPVELKYVF

    >gi|73963815|ref|XP_547813.2| PREDICTED: similar to ERO1-like protein alpha precursor (ERO1-Lal
    MGRRWGFLVGLVGAVWLLGPSHGEQRPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVN
    LKRPCPFWNDISQ
    CGRRDCAVKPCQSDEVPDGIKSASYKYSEVANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDD
    SSDNFCEADDIQSPDAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGKSEENTFYSWLEGL
    CVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVVP
    FFERPDFQLFTGNKVHDAENKMLLLEILHEIKSFPLHFDENSFFAGDKKEANKLKEDFRLHFRNISRIMDCVGCFKCRLW
    GKLQIQGLGTALKILFSEKLIANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH

    >gi|73961355|ref|XP_537190.2| PREDICTED: similar to Peroxiredoxin 6 (Antioxidant protein 2) (1-
    MEGDEQLQDKHGRQNQLDLDLLLGSLLLGDEAPNFEANTTIGRIRFHDYLGDSWGILFSHPRDFTPVCTTELGRAAKLAP
    EFAKKNVKMIALSVDSVEDHLAWSKDINAYNGQEPTETLPFPIIDDKNRDLAILLGMLDPAEKDEKGMPVTARVVFIFGP
    DKKLKLSILYPATTGRNFDEILRVITSLQLTAEKRVATPVDWKDGDSVMVLPTIPEDEAKKLFPKGVFTKELPSGKKYLR
    YTPQP

    >gi|73981638|ref|XP_855591.1| PREDICTED: dihydrolipoamide: NAD+ oxidoreductase [Canis familiaris]
    MQSWSRVYCSLAKRGHFSRISHGLQAVSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTC
    LNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLEKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKN
    QVTAKKADGSTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
    AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVFIEGASGGKAEVITCDVLLVCIGRRPFTQ
    NLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVA
    WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
    ARVCHAHPTLSEAFREANLAASFGKSINF

    >gi|57092777|ref|XP_531744.1| PREDICTED: similar to 3-mercaptopyruvate sulfurtransferase [Canis familiaris]
    MAPQQLFRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPSAE
    HFAEYAGRLGVGAATHVVVYDASDQGLYAAPRVWWMFRAFGHRTVSLLDGGLRHWLRLGLPLSSGKSRPAPAADFRAALD
    PAFVKTYEDLKENLESRRFQVVDARAAGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLTSEGLEKSPEEINRLFQDKKVD
    LSQPLVAT
    CGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRAQPEEVISEGRGKTH

    >gi|73971270|ref|XP_852413.1| PREDICTED: similar to disulfide isomerase [Canis familiaris]
    MRLLGWWQVLLWVLGSPARGLEVAEEGSHLQSEEQPAHALLAGVVSTSEEEHPRGPGGQDRSAGEAGTVLGLDADGDHVL
    MLSVIPGETDDKLSSEPSGGTCGAQGEEDSRCSLREHLFSLDGTGASFQDREEEYYSEPEVGESDPAPHEDSNNTESLKS
    PKVNCEERNVTGLENFTLKVLNMSQDLMDFLNPNGSDCTLVLFYTPW
    CRFSASLAPHFNSLPRAFPALHFLALDASQHSS
    LSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKVFIFNQTGIEAKKNVVVTQADQIGPLPSTLIKSVDWLLVFSLFF
    LISFIMYATIRTESIRWLIPGQEQEHVE

    >gi|57093173|ref|XP_538396.1| PREDICTED: similar to thiosulfate sulfurtransferase [Canis familiaris]
    MVHQVLYRALVSTKWLAESVRAGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDMEECRNTASPYEMMLPSEAH
    FADYVGRLGIGNQTHVVVYDGDNLGCFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLDRS
    LLKTYEQVLENLESKRFQLVDSRSQGRYLGTEPEPDAVGLDSGHIRGSVNMPFMDFLTEDGFEKSLEELRAMFEAKKVNL
    AQPLIAT
    CRKGVTACHVALAAYLCGKPDVAVYDGSWFEWFHRAPPETRVSQWKREKA

    >gi|73949514|ref|XP_859275.1| PREDICTED: similar to F26E4.12 isoform 2 [Canis familiaris]
    MEPLTAYPLRCSGSKAKVTLVVNVASDCQLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSKEVVSFARNNYG
    ATFPIFHKIKILGSEADPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKSWRPEEPIEVIRPEIAALVRQMILRKKDDL

    >gi|57042784|ref|XP_535237.1| PREDICTED: similar to F26E4.12 isoform 1 [Canis familiaris]
    MEPLTAYPLRCSGSKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDAKGRTVSLEKFKGKVTLVVNVASDCQ
    LTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSKEVVSFARNNYGATFPIFHKIKILGSEADPAFRFLVDSSKK
    EPRWNFWKYLVNPEGQVVKSWRPEEPIEVIRPEIAALVRQMILRKKDDL

    >gi|73967327|ref|XP_853899.1| PREDICTED: similar to nucleoredoxin [Canis familiaris]
    MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSGSLAAFYGRLLGDAAAGPGPGPGPGPGPWA
    GAGPGPEAVAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDATTGKVV
    CRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHW
    CPPCRSLTRVLVESYRKIKEAG
    QKFEIIFVSADRSEDSFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCREFP
    WHPKPVLELSDSNAVQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYT
    NLPEAAPLLTILDMSARAKYVMDVEEITPAIVEAFVNDFLAEKLKPEPI

    >gi|73949030|ref|XP_848867.1| PREDICTED: similar to selenophosphate synthetase isoform 2 [Canis familiaris]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|73949032|ref|XP_857341.1| PREDICTED: similar to selenophosphate synthetase isoform 3 [Canis familiaris]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGAT
    S

    >gi|73965349|ref|XP_537604.2| PREDICTED: similar to Methyltransferase-like protein 2 [Canis familiaris]
    MSPTFLTACTFASTFSGWREKPALTNSAATCRVPRARCPAPEAELELQPRRGPSEPPRPASPCSFPAQTPRLPEGAWTLR
    KFSRYRKGGTSGSGVMADPYPECALAAVGEKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAERKVRENSTQRVCQE
    KQVDYEVNAHKYWNEFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLNDLLPENKRSKVPQCRSNEDGPGLQIEEQHKCS
    SNSLGHKMQMPPVEENVTQKLSHLEICVDEFPGSSATYRILEVGCGVGNTVFPILQTNNDPGLFVYCCDFSSTAVELVQT
    NSAYDPCRCFAFVHDLCDEDKSYPVPRDSLDIIILIFVLSAVVPDKMQKAINRLSRLLKPGGLMLLRDYGRYDMAQLRFK
    KGQ
    CLSENFYVRGDGTRVYFFTQDELDTLFTTAGLEKVQNLVDRRLQVNRGKQLTMYRVWIQCKYRKPLLSGTG

    >gi|73949034|ref|XP_857383.1| PREDICTED: similar to selenophosphate synthetase isoform 4 [Canis familiaris]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIVKTRIQRGRDIGRGRSRLHLAYQ
    EAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCP
    ETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|73949036|ref|XP_535183.2| PREDICTED: similar to selenophosphate synthetase isoform 1 [Canis familiaris]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIWLEDESHFSPSFPPNLCSLVTQE
    DVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFG
    LMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGAT
    S

    >gi|73969813|ref|XP_531748.2| PREDICTED: similar to Thioredoxin, mitochondrial precursor (Mt-Trx) (MTRX) (Thioredoxin-2) [Canis familiaris]
    MSGSGGVHRSDGGCGEGGAAASPRGRVALPAPPPPPGPLDRPGPQRLPETGWSDVRKALPPEVTKGVSLTGGEGRAVSAS
    LRSGCREMAQRLLLRRFLASVISRKPPQGRWAPLTCRALPCSPGHLTATPTQARSIYTTRVCTTTFNIQDGPDFQDRVVN
    SETPVVVDFHAQW
    CGPCKILGPRLEKVVAKQHGKVVMAKVDIDDHTDLALEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQ
    LEAFLKKLIG

    >gi|73998671|ref|XP_535031.2| PREDICTED: similar to Thioredoxin-dependent peroxide reductase, m
    MAAAVGRFLRASIARHVSAIPWGISASAALRPAASRRTCLTNVLWSGSGQAKFAFSTSSSYHAPAVTQHAPYFKGTAVVN
    GEFKDLTLDDFKGRYLVLFFYPLDFTFV
    CPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINTPRKNGGLGHMNIA
    LLSDLTKQISRDYGVLLEGPGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPDSPT
    IKPHPTASKEYFEKVNQ

    >gi|73949038|ref|XP_857465.1| PREDICTED: similar to selenophosphate synthetase isoform 5 [Canis familiaris]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIKRGGLKIEKLHGSASNEAPKTLL
    AYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHG
    TCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|73998673|ref|XP_865127.1| PREDICTED: similar to Thioredoxin-dependent peroxide reductase, m
    MAAAVGRFLRASIARHVSAIPWGISASAALRPAASRRTCLTNVLWSGSGQAKFAFSTSSSYHAPAVTQHAPYFKGTAVVN
    GEFKDLTLDDFKGRYLVLFFYPLDFTFV
    CPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINTPRKNGGLGHMNIA
    LLSDLTKQISRDYGVLSAGFVLQGSPSLGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPD
    SPTIKPHPTASKEYFEKVNQ

    >gi|73946570|ref|XP_849435.1| PREDICTED: similar to HESB like domain containing 2 [Canis familiaris]
    MRSYFKLRSGPITPSGWAGFPVRGHLEAKVTGAPSSSSPCSTALEEGVAGPLASRLGRDSVLGSAAQRDQREDKRESPGL
    GEHGSRARRPEAVTPHLARGHLWSQCRRRVHVESLRWSSSRPKDPGAGTATMSASLVRATVRAVSKRKLQPTRAALTLTP
    SAVNKIKQLLKDKPEHVGLKVGVRTRG
    CNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSE
    FVFNNPNIKGTCGCGESFNI

    >gi|57094359|ref|XP_532079.1| PREDICTED: similar to Chloride intracellular channel protein 1 (N
    MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI
    EEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFSIPEVFRGVHRYLRNAYAREEFASTCPDDEEIELAYEQVAKAL
    K

    >gi|73986149|ref|XP_533874.2| PREDICTED: similar to Gamma-interferon inducible lysosomal thiol reductase precursor (Gamma-interferon-inducible protein IP-30) [Canis familiaris]
    MGYSLSVLMSCVNTFPAVGDLCLQEPLRKSEAPLVNVSVYYEALCPGCRAFLVRELFPTWLMVLEILNVTLVPYGNAHEQ
    NVSGRWEFTCQHGEQECKLNKVEACLWDKLDKNLAILIIVCIEEMDDMEENLKPCMEIYAPTMSPDTIMECAVGDRGMQL
    LHINAQLTDALQPPHEYVPWVVVNGKPLKDLSQLLSLVCQLYQGEKPDACQLTATSQRKVCFK

    >gi|57088417|ref|XP_547107.1| PREDICTED: similar to protein disulfide isomerase-like protein of the testis [Canis familiaris]
    MKLLWMALLLVAICVSTVQGLPEEDFREASINISQPLHIVEEGNLLVLTPPGLIQMLNQTRFLMVLFHNPSSKQSRNLAK
    ELGKAVEVMGKGKNGLGFGKVDITVEKELQKEFDVKKAPELKLFFEGNRSEPISCKGVVESAALVVWLRRQISQKAFLFN
    NTQQVLEFVKSRPLVIVGFFQDLEEEVAELFFDMIKDFPELTFGVISISNAIGRFHVTLDSLLVFKKGKIVKREELINDI
    TNKQVINQVIKQHLTDFVIEYNTENKDLIYELHILNHMLLFASKSSESFGMIMKHYKLASKEFTNKILFILVDADEPRNG
    HIFKYFRITEVNIPCVQILNLSSDARYKMPSEEITYENLKKFGRSFLNRSAKKHQSSEDIPKYWDQGPVKQLVGKNFNVV
    VFDKERDVFVMFYAPWSEK
    CKALFPVLEELGRKYQNHSTVTIAKIDITANEIQLMYLDRYPFFNLFPTDTQQAIMYTGEH
    TMKGFSDFLESQIKTRIEDEDELLSIEESELTEEEALAEEKKLPFIKEELTEQKVLELENVTKLEEPAGQKETAKEEKEK
    VAKPKGPPKQEKKPKVKEEL

    >gi|50979242|ref|NP_001003376.1| O6-methylguanine-DNA-methyltransferase [Canis familiaris]
    MDKACKMRYKTMDSPLGKIEISGCAQGLHEIRLHDRKTPDPGPAEAPAPPELLGCPEEMTEPLVQCVAWLDAYFREPSVL
    PGLPLPAIHHPIFQRGSFTARVLRKLLELVKFGDTVSYQQLAALAGNPKAARAVGGAMRSNPVPILIP
    CHRVVCSSGAMG
    NYTGGLATKEWLLAHEGRLAGKPTYPGGSYLAGTRRGALGGTPSPHPAGRDGCVRE

    >gi|70608105|ref|NP_001020438.1| ATPase, Cu++ transporting, beta polypeptide [Canis familiaris]
    MKQSFAFDNVGYEGGLDSVCPPQTATSTISILGMTCQSCVRSIEGRISSLKGIVSIKISLEQGNATVKYMPSILSLPQVC
    RHIEDMGFEASVAEGKAASWPSRSSPGLEAVVRLRVEGMTCQSCVSSIEGKLGKLQGVARVRVSLSTQEAVITYQPYLIQ
    PQDLRDHVNDMGFEAVIKNRVAPVSLGPIDIGRLQRTNPKMPLTSDNQNLNNSETLGHQGSHVVTLQLRVDGMH
    CQSCVL
    NIEENIGQLPGVQNVQVSLENRTAQVQYDPSCVTAGALQRAIEALPPGNFKVSLPAAAAGSETGNRFSACAAPAPAPRTP
    APGRCDTVMLAIVGMTCASCVQSIEGLISQREGVQQISVSLAEGTAVVLYDPSIIGPEELRAAVEEMGFETSVLSENGYS
    NHVGNHSAGNSSAHTTAGVPVSVQEGAPHTEGLPGNHSPGRPSRSPPASTSVTAQKCFLQITGMT
    CASCVSNIERKLQKE
    AGVVSVLVALMAGKAEVKYHPDVIQPLEIAQLIQDLGFEATVLEDYAGSEGDLELIITGMT
    CASCVHNIESKLTRMAGIT
    YASVALATSKAHVKFDPEIIGPRDIVKVIEEIGFHASPAQRNPSAHHLDHKVEIKQWKKSFLCSLVFGIPVMGLMIYMLV
    PSSTPHESMVLDHNVIPGLSILNLIFFILCTFVQLLGGWYFYVQAYRSLRHRAANMDVLIVLATSIAYTYSLVILVVAVA
    ERAERSPVTFFDTPPMLFVFIALGRWLEHIAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDVIKV
    VPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSMNAHGSVLVTATHVGNDTTLAQIVKLVEEAQMSKAPI
    QQLADRFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISEAEVIIRFAFQTSITVLCIACPCSLGLATPT
    AVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGV
    AVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAPGERQRSKQAAPPGTVGGVPEETDETPQTFSVLIGNREW
    MRRNGLTISSDISDAMADHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVLITGDNRKTARAIATQ
    VGINKVFAEVLPSHKVAKVQELQNEGKKVAMVGDGVNDSPALARADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHL
    SKRTVWRIRLNLVLALIYNLVGIPIAAGVFMPIGVVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERYEAQAQGRMK
    PLTASQVSVHIGMDDRRWDSPQATPWDQVSRVSQVSLSSLKSDKLSRHSAAADDGGDTWSLLLNDRDEEQCI

    >gi|73975297|ref|XP_532378.2| PREDICTED: similar to phosducin-like 2 [Canis familiaris]
    MEGGQKVTFKMKGRRAAAAPQQPPGRAFTLPGNSAAPGAGAEAGFAPRAPRGRWKPLGPRPARLPLEADFGVRVRRPPPA
    AGRRWLARAKGSTMQDPNEDTEWNEILRDFGILPPKEEPKDEIEEMVLRLQKEAMVKPYEKMTLAQLKEAEDEFDEEDMR
    AIEIYREKRLQEWKALRKKQKFGELREISGNQYVNEVTNAEKDVSVVIHLYRSSIPM
    CLLVNQHLSLLARKFPETKFVKA
    IVNSCIQHYHDNCLPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENPKKSIVDVMVSSIRNTSI
    YDDTNSSNSDNDDTK

    >gi|73952532|ref|XP_546074.2| PREDICTED: similar to endoplasmic reticulum oxidoreductin 1-Lbeta [Canis familiaris]
    MDILLKLKEKILEVCASIRDHQKSLNRRKKLIQNGNQQVCDSIKAKWDPNLNQDVEERGWDEEEDDIHVWGVEPGPPLQV
    SGGLSQAFAADRGLQNPDRDRDSAWARNCKAPRRALLICLRLGSRPGPPGCAVSGTAAPQQPAAGFPEQLPGEGAPRAPR
    APPAPPLVLEARVVRPHWPRRSPRPRGGGAASAAVVPESPAPPAPPSARGPARGSAGPQLPQGPALGGGVAAAGSRRERP
    PPRAACAPLALEPVGRREPSPRVVAWAARRSPAPRARPAALRGEASMRPGARPAGAGQGAAAAAQLLLTLSFLPSVVEAQ
    VTGVLDDCLCDIDSIDNFNTFKIFPKIKKLQERDYFRYYKVNLKRPCPFWAEDGH
    CSIKDCHVEPCPESKIPVGIKAGSS
    NKYSKVANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDSQDHFCELDDERSPAAQYVDLLLNPERYTGYKGSS
    AWRVWNSIYEENCFKPRSVYRPLNPLAPSRGKDDGESFYTWLEGLCLEKRVFYKLISGLHASINLHLCANYLLEETWGKP
    SWGPNMKEFKRRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPYFERSIVDLYTGNVEEDADTKTLLLNIFQDTKSFP
    MHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEIQKLPENSPSKGFQL
    TRQEIVALLNAFGRLSTSIRELQNFKVLLQHSR

    >gi|57092849|ref|XP_531782.1| PREDICTED: similar to phosducin-like 3 isoform 1 [Canis familiaris]
    MQDPNADTEWNDILRKKGILPSKESLKDLEKEAEEEEQRVLQQSVVKTYEDMTLEELEDNEDEFNEEDERAIEMYRQQRL
    AEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPL
    CALINQHFSGLARKFPDVKFIKAISTTCIPNYP
    DRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTDLEENPKKPIEDTLLSSVRCSIPTRRDSDSEDD


    >gi|73966409|ref|XP_548202.2| PREDICTED: similar to sperm protein SSP411 [Canis familiaris]
    MSHLSSPPQKQKGEHKGRGLPRGSERGSSSRDKDRSATVSSSVPMPIGGKGSRTNCSPSVPQKVPNRLINEKSPYLLQHA
    YNPVDWYPWGQEAFDKARKENKPIFLSVGYST
    CHWCHMMEEESFQNEEIGHLLNEDFVSVKVDREERPDVDKVYMTFVQA
    TSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWKQNKNTLLENSQRVTTALLARSEISMGDRQVP
    PSAATMNSRCFQQLDEGYDEEYGGFAEAPKFPTPVILNFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGF
    HRYSTDRQWHIPHFEKMLYDQAQLAVAYSQAFQISGDEFYSDVAKGILQYVARNLSHRSGGFYSAEDADSPPERGMRPRE
    GAFYVWTVKEVQNLLPEPVLGATEPLTSGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVDAV
    RTLLNTGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGQERLINYAINGAKFLKRHMFDVASGRLMRTCYA
    GPGGTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQDTQDRLFWDSQGGGYFCSEAELGAGLPLRLKDD
    QDGAEPSANSVSAHNLLRMHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAHQQTLKQIVICGDPQAKDTKA
    LLQCVHSIYIPNKVLILANGDPSSFLSRQLPFLSTLRRLEDRATAYVCEDQACSMPITEPCELRKLLHQ

    >gi|73960986|ref|XP_547419.2| PREDICTED: similar to quiescin Q6 isoform a [Canis familiaris]
    MVTIIFLPTSECRPGYAKTREEKKTSHLNSYNHCYPRTVELELTALASAHSTTKIGWIFKDFIKILRYGAREKPNSQQPR
    EYRSGSRPGERPSDLGADTVRGALLGSRSAWAVEFFASW
    CGHCIAFAPTWKALAQDVKDWRPALNLAALDCADETNNAVC
    RDFNIPGFPTVRFFKAFSKNAFEGLRAIPPAGADVETLRKRLIDALESHSDTWPPACPPLEPARLEEIDGFFARNDDEYL
    ALIFEKEGSYLGREVALDLSQHQGIAVRRVLNTEGDVVSKFGVTDFPSCYLLFRNGSTSRVHVLQESRPFYTAYLKKFSK
    LIREAVPTKVVPTTVHTIAPTVWKVVDRSKIYMADLESALHYILRVEVGKFSVLEGQRLVALKKFMAVLAQHFPGQPLVQ
    NFLHSVNDWLKRQQRKKIPYSFFKAALDNRKEVSLGTMIAKKVHWVGCQGSEPHFRGFPCSLWILFHFLTVQAARHNLDH
    SQETAEAQEVLQAIRSYVRFFFG
    CRDCANHFEQMAAASMNRVDSLNSAVLWLWSSHNKVNARLAGAASEDPHFPKVQWPP
    RGLCSACHNDLRGSPVWDLDNTLRFLKTHFSPSNVVLDMPSAVPGPQMGALRMAAGNVTLGPKKAGIAVGPGTKSPGTTV
    PEVPTERLSATYPQDMLLGLSVTPAEPDRGSREHRAELQMDKLEQPKGQQHLTKRDTGTVLLAEFLAEKNLPRNPSELRR
    VGRSSKQLASIPEGEPEAGPMGGRDQWLQVLEGNFSHLDISLCVGLYSLSFMGLLAIYTYFRARMRALKGHPGHPAA

    >gi|73975341|ref|XP_532390.2| PREDICTED: similar to ubiquitin-activating enzyme E1 (A1S9T and BN75 temperature sensitivity complementing) [Canis familiaris]
    MEASAPVAAPQREEASCSSWAAGGANKNLSIMSAESVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNL
    VLAGIKALTIHDTEKCQTWDLGTNFFLCEDDVVNRRNRAEAVLQHIAELNPYVHVTSSSVLLNETTDLSFLDKYQCVVLT
    EIKLPLQKKINNFCHSQCPPIKFISTDIHGIWSRLFCDFGDEFEVSDTTGEEPKEIFISNITQANPGIVTCLENHPHKLE
    TGQFLTFREVNGMTGLNGSTQQITVVSPFSFSIGDTTELEPYLHGGIAVQVKTPKTFCFEPLETQIKHPKCLIADFSKPE
    ASLQIHTAMLALDQFQENYNRKPNIGCQEDSEELLKLATSISETLEEKPEVNADIVHWLSWTAQGFLPPLAAAVGGVASQ
    EVLKAITGKFSPLCQWLYIEAGDIVKSLDKIEREEFLPRGDRYDALRACIGDTLCQKLQKLNIFLVGCGAIGCEMLKNFA
    LLGVGTGKEKGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAADATLKINPQLKIDAHLNKVCPATEAIYSDEFYTK
    QDIIITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPF
    CTLKSFPAAIEHTIQW
    ARDKFESSFSHKPALFNKFWQTYPSAEEVLQKIQTGHSLEGCFQVIKLLSRRPRNWSQCVELARLKFEKYFNHKALQLLH
    CFPLDTRLKDGSLFWQSPKRPPSPIKFDLNEPLHFSFLLNAAKLYAAVYCIPFTEEDLSADALLNILSEVKIQEFKPSNK
    VVQTDETARKPDHVPISNEDERNAVFQLEKAISSNKATTSDLQMAVLSFEKDDEHNGHIDFITAASNLRAKMYSIEPADR
    FKTKRIAGKIIPAIATSTAAVSGLVALEMIKVAGDYPFEAYKNCFLNLAIPIIVFTETSEVKRTEIRNGISFTIWDRWTI
    HGKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPSTEKKYVDLTVSFAPDTDGDEDLPG
    PPVRYYFSHDTD

    >gi|73979303|ref|XP_532823.2| PREDICTED: similar to tumor suppressor candidate 3 isoform b isoform 1 [Canis familiaris]
    MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAP
    PRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRP
    KRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRTNLEFIYNKTGWAMVSLCIVF
    AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLG
    LVVFFFSFLLSIFRSKYHGYPYSFLIK

    >gi|73979305|ref|XP_858740.1| PREDICTED: similar to tumor suppressor candidate 3 isoform a isoform 3 [Canis familiaris]
    MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAP
    PRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRP
    KRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRTNLEFIYNKTGWAMVSLCIVF
    AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRSKSGCYFC
    SFALVLRFI

    >gi|73979307|ref|XP_849445.1| PREDICTED: similar to tumor suppressor candidate 3 isoform a isoform 2 [Canis familiaris]
    MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAP
    PRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRP
    KRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRTNLEFIYNKTGWAMVSLCIVF
    AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLG
    LVVFFFSFLLSIFRSKYHGYPYSDLDFE

    >gi|57099689|ref|XP_533241.1| PREDICTED: similar to Peroxiredoxin 5, mitochondrial precursor (P
    MAPIKVGDAIPSVTVFEGEPGNEVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFMEQAEALKAKGVQVIACLSVNDVF
    VTEAWGRAHNSGGKVRLLADPTGAFGKETDLLLDDSLVSLFGNHRLKRFSMVIENGIVKSLNVEPDGTGLTCSLAPNILS
    QL

    >gi|74006048|ref|XP_536114.2| PREDICTED: similar to glutaredoxin 2 isoform 1 [Canis familiaris]
    MSRVRAALPVTRPVRSWSGSGSRSGSAGRLGGAAGAAASGMGNSTSSSASAPAPVNQIQETISDNCVVIFSKTSCSYCTM
    AKKLFHDMNVKYKVVELDMLEYGSQFQDALYKMTGERTVPRIFINGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKE
    F

    >gi|73950600|ref|XP_544493.2| PREDICTED: similar to Chloride intracellular channel protein 4 (mc3s5/mtCLIC) [Canis familiaris]
    MALSMPLNGLEEEDKEPVIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITF
    NNEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLP
    DEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV
    EIAYSDVAKRLTK

    >gi|73971886|ref|XP_532011.2| PREDICTED: similar to Thioredoxin domain containing protein 4 precursor (Endoplasmic reticulum resident protein ERp44) [Canis familiaris]
    MLRGGQDPEVRVCEASLEVVPGVRCWSSGSRGRGAAAGRAVRRRRRLPEPSPFLNPAQPCPVPAAKPGVTMNPAVFLSLP
    DLRCSLLLLVTWVFTPVTTEITSLDTENIDDILNNADVALVNFYADW
    CRFSQMLHPIFEEASNVIKEEYPNENQVVFARV
    DCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPVQELHDLAEITTLDRSKRNIIGYFEQK
    DSENYRVFERVANILHDDCAFLSAFGAVSKPERYSGDNIIYKPPGHSAPDMVYLGSMTNFDGTYNWIQDKCVPLVREITF
    ENGENASVALLAVALKMSLTMLLR

    >gi|73998775|ref|XP_543995.2| PREDICTED: similar to Arsenite methyltransferase (S-adenosyl-L-me
    MGKYAQGRPWRYYGCGLVIPECLENCWILDLGSGSGRDCYALSQLVGETGHVTGIDMTESQVEVAKKYIEYHMEKYGFQT
    PNVTFLHGYIEKLEEIGIKDESYDIVISNCVINLVPDKQAVLQEVYRVLKHGGELYFSDVYASLELPEEIRTHKILWGE
    C
    LGGALYWKDLAVLAQKIGFCPPRLVTANLITVQNKELERVIGDCRFVSATFRLFKLPKTGPAERCQVIYNGGITGHEKEL
    IFDANFTFKEGEIIEVDKETAAILKNSRFAKDFLIRPIGETLPTCSGCSALESKGIITDPFMLAGQSDSMKSRCSPDVAG
    GCCGITYS

    >gi|73990614|ref|XP_542805.2| PREDICTED: similar to Thioredoxin domain containing protein 6 (Thioredoxin-like protein 2) (Txl-2) [Canis familiaris]
    MKSFQKLLQIHVADQVCSQHDRRPDSWPKRLLAKNPDWAQAQVSGPEVQGQPQGQEPALATGESLQIPPNLEPPLRGTPE
    RTGSLLGEAKPPDADTASANESVPGATSDPEGAGLPPPFCGARWAWLVTRATRAALSCPRDCGRVAADQLGTLHFEDRVP
    VERSFAVAQFPRTILQQAMGSKKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGW
    CGPCKPMVSLFQKMRIEVGLDLLH
    FALAEADHLDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTIREQLEAEKKVLAEGCERKVIRDEALSDEDGCLS
    HDEDNGEDEDMASSGKTCTLAIIKPDAVAHGKTDEIIMKIHEAGFDILTNEERTMTEAEMRLFYQHRAGEEAFEKLVHHM
    CSGPSHLLILTRSEGTEDVITAWRMLMGPCDPDVARREQPDSLRAQFGTEMPFNAVHGSQDRDDASRELALLFPTFKFSD
    EVPEASLELGLAHDVPATELAICSLSLRPWGKERRAPLRHVTSLRTWIERLGCNSGACDQGQGHEMKCQYA

    >gi|73959530|ref|XP_537010.2| PREDICTED: similar to erv1-like growth factor [Canis familiaris]
    MAPVARADPGDPGPGAPRSVRSPRRSALPRRPSADRRARPAEGTEPGRGHAGRSERSDGGVPGRNTDFAPAAAGVHGAAA
    ARLPQHATLLLEEAGAPPRTTPCAGNMAAPGERSRSGGGSLFSFLPGGARSEVMDDLVTDARGRGAGRRDASAAASAPAP
    TPEPQVAEDPSRRRPCRACVDFKTWMRTQQKRDGKFREDCPEDREELGRHSWAVLHTLAAYYPDLPTPEQQRDMTQFIHL
    FSKFYP
    CEECAEDIRKRICRNQPDTRTRACLTQWLCRLHNEVNRKLGKPDFDCSQVDERWRDGWKDGSCD

    >gi|73979351|ref|XP_532813.2| PREDICTED: similar to Glutathione reductase, mitochondrial precursor (GR) (GRase) [Canis familiaris]
    MALLPRALGASAGPSWRPAARAFPGFPRPPPARALSRAMACRQEPQPQPQPQRPPPAAGAAASFDYLVIGGGSGGLASAR
    RAAELGARAAVVESHKLGGT
    CVNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCESKFNWRVIKEKRDAYVSRLNTIYQNN
    LTKSHIEIIHGHAAFTCDSEPTIEVNGNKYTAPHILIATGGVPSRPQESQIPGASLGITSDGFFQLEELPGRSVIVGAGY
    IAVEIAGILSALGSKTSLMIRHDKVLRNFDSIISSNCTEELENSGIEVLKYSQVKEVKKTSSGLELCMITSAPGRKPTLT
    TIPDVDCLLWAIGRDPNSSGLNLDKVGIQTDDKGHIIVDEFQNTSVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFECK
    EDSKLDYDNIPTVVFSHPPIGTVGLTEDEAIYKYGKENVKTYSTTFTPMYHAVTKRKTKCVMKMVCATMEEKVVGIHMQG
    IGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR

    >gi|73993844|ref|XP_850101.1| PREDICTED: similar to Peptide methionine sulfoxide reductase (Protein-methionine-S-oxide reductase) (PMSR) (Peptide Met(O) reductase) [Canis familiaris]
    MGPQRASSLHTLIKNRVEAFLLGLVCPFIAPSVLPTITPAALEDVQDPSHAVAAGWPSKHHANGNRTVEPFPEGTQMAVF
    GMG
    CFWGAERKFWTKKGVYSTQVGYAGGYTSNPTYKEVCSGNTGHAEVVRVVYQPEHISFEELLKVFWENHDPTQGMRQG
    NDYGTQYRSAIYPTSTEHMEVALRSKEDYQKVLSEHGYGLITTDIREGQAFYYAEDYHQQYLSKNPDGYCGLGGTGVSCP
    LGIKK

    >gi|73973422|ref|XP_853690.1| PREDICTED: similar to Chloride intracellular channel protein 1 (N
    MAEEQPRVELFLKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQTLCPGGQLPFLRYRTEVHTDTKIE
    EFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNPNPALNDNLEKGLPKALRVLDNYLTSPLPEEVDETRAEDEG
    ISQRKFLDGNELTLADCNLLPKLHIVQVVCKKSRGFSIPEVFRGVHRYLRNACAREEFASTCPDDEEIELACEQVAKALK


    >gi|74006605|ref|XP_548896.2| PREDICTED: similar to Peroxiredoxin 4 (Prx-IV) (Thioredoxin perox
    MEAPPAPLAATTPASGRSRRLLLLPLLLFLLPTGALRGQEAEERPRTRQEECHFYAGGQVYPGEASRASPADHSLHHSKA
    KISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAW
    INTPRRQGGLGPIKIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTD
    RHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|74006607|ref|XP_859371.1| PREDICTED: similar to peroxiredoxin 4 isoform 3 [Canis familiaris]
    MDHRSRPRGIGLNRIPGTRTCRTPLPFHVEQQEAREGEEFEQREVPRQRTPVYVPPESEELTDNVMVSKPAPYWEGTAVI
    NGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIKI
    PLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDRHGEVCPAGWKPGSE
    TIIPDPAGKLKYFDKLN

    >gi|73971948|ref|XP_532029.2| PREDICTED: similar to Thioredoxin (ATL-derived factor) (ADF) (Surface associated sulphydryl protein) (SASP) [Canis familiaris]
    MTIPNGSSNQSHTLLWEQGARCKPPQMLEPRGDPRERGAVTWRPLPSRPSPALSVWTGDVGWLRKCELLCRGAHRLVDPY
    NQKACLESMQYLNMLLDIWAVFSASVNVFVHAPLQSSGLFPQYAFQEALNSAGDKLVVVDFSATW
    CGPCKMIKPFFHSLS
    EKYSNVVFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI

    >gi|73967486|ref|XP_848692.1| PREDICTED: similar to chloride intracellular channel 3 [Canis familiaris]
    MAETAKLQLFVKASEDGESVGHCPSCQRLFMLLLLKGVPFTLTTVDTRRSLDVLKDFAPGSQLPILLYDGDAKTDTLQIE
    EFLEETLGPPEFPSLAPRYRESTTAGNDVFHRFSVFIKNPVPAQDNALYQLLLRALTRLDGYLRRPLEHELAQEPQLQES
    RRRFLDGDQLTLADCSLLPKLYIMDTVCTHFRQVPIPAELCGVRRYLESALQVKEFKYTCPCSAEILAAYRMAVHPRYPL
    PTADRHPVCFSTAP

    >gi|73969976|ref|XP_531765.2| PREDICTED: similar to thioredoxin reductase 1 [Canis familiaris]
    MGCGKSKVRAGAPPQPEANGRRGPGSQSSAKDHFPCQPLPENPAIGVSRPSGSTSTSLLDPRARLRAYIDSHPVVIVSKS
    A
    CKRCAEVKKLFESMSVPYFLLELDQAEDARGLELALSELTPETDAPVVFVKRRNIGGHGPTLKAYQEGRLQNLLNMNGS
    EDLPEVYDYDLIIIGGGSGGLAAAKEAARYNKKIMVLDFVTPTPRGTRWGLGGT
    CVNVGCIPKKLMHQAALLGQALQDSR
    NYGWSTEETVKHDWDKMTEAVQNHIGSLNWGYRVALREKKVTYENAYGQFVGPHRIKATNNKGKEKIYSAERFLIATGER
    PRYLGIPGDREY
    CISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHG
    VKFIRQFVPIKVEQIEAGTPGRLRVVAQSTSSSETIEGEYNTVLLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQT
    NVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYAGSNVKCDYENVPTTVFTPLEYGACGLSEERAVEKFGEENIEVYHS
    YFWPLEWTIPSRDNNKCYAKVICNIKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKMQLDSTIGIHPICAEVFTTLSV
    TKRSGASILQAGC

    >gi|73973937|ref|XP_854742.1| PREDICTED: similar to CG12279-PA [Canis familiaris]
    MALSGPLLGGARRTVLRSAEAALWGELGVPGGPRGRKWPGWRCSRSLRLPVRHETHDSGPLGRQHPLSVLVPSGPGLLGS
    GGAPGGRRERSALLLGAGAREEAGAPPGGEGLKSIKGSCHNFCTAIFKDVTYKELKNLLNSKKIMLIDVRETWEIVKYGK
    IPGSVNIPLGEVGEALQMNPKDFKEKYNEVKPSKSDSLVFS
    CLAGVRSKKALDTAISLGFNSAQHYAGGWNEWATYEFSE
    KKHGN

    >gi|73956627|ref|XP_546736.2| PREDICTED: hypothetical protein XP_546736 [Canis familiaris]
    MSTVDLARVGACVLKHAVTGEAVELRTLWLEQACVVAGLRRFGCSVCRWIARDLSSLRGLLDQHGVRLVGVGPEVLGVQE
    FLDGGYFAGELYLDESKQFYRELGFKRYNSLSILPAALGKPVRDVALKAKAVGIHGNLSGDLLQSGGLLVVTKGGDKVLL
    HFVQNSPGDYVPRESILQALGISAEGCASESPQCDGQVCTR

    >gi|57091101|ref|XP_537653.1| PREDICTED: similar to chromosome 17 open reading frame 37 [Canis familiaris]
    MSGEPGPTSEAPPPGEIEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLEN
    GGFPYEKDLIEAIRRASNGEPLEKITNSRPPCVIL

    >gi|50978750|ref|NP_001003076.1| phosducin [Canis familiaris]
    MEEAKNQSLEEDFEGQATHTGPKGVINDWRKFKLESEDSDSVPPSKKEILRQMSSPQNRDDKDSKERFSRKMSIQEYELI
    HRDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKITTIVVHIYEDGVKG
    CDALNSSFTCLAA
    EYPMVKFCKIKASNTGAGDRFSSDVLPTLLIYKGGELLSNFISGTEQFAEEFFAGDVESFLNEYGLLPEREIHALDQTNM
    EEDTE

    >gi|73980394|ref|XP_532876.2| PREDICTED: similar to Protein disulfide-isomerase A6 precursor (Thioredoxin domain containing protein 7) [Canis familiaris]
    MARLVLGLVSCTFFLAANGLYSSSDDVIELTPSNFNREVIQSDNLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVKVGA
    VDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGSRTGEAIVDAALGALRQLVKDRLGGRGGGYSSGKQGRSESSNKK
    DVIELTDDSFDKNVLDSDDVWMVEFYAPW
    CGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQLLASRYGIRGFPTI
    KIFQKGESPMEYEGGRTRSDIVSRALDLFSENAPPPELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVL
    LKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGG
    GAFPTISTREPWDGKDGELPVEDDIDLSDVELDDLERDEL

    >gi|50978980|ref|NP_001003213.1| epididymis-specific secretory glutathione peroxidase-like protein GPX5 [Canis familiaris]
    MTAWLGASYVLPILLVSFVQTNAKPEKTKMDCYKDVKGTIYEYEALTLNGNERIQFKQYPRKHVLFVNVATYCGLTAQYP
    ELNSLQEELKPLGLVVLGFPCNQFGKQGPGENSEILPGLKYVRPGRGYVPNFQLFEKGDVNGEKEQKVFTFLKLSCPHPS
    EVLGSFRHISWDPVKVHDIRWNFEKFLVGPDGVPVLRWFHRTPISTVKEDILVYLKQLKMK

    >gi|73978405|ref|XP_539831.2| PREDICTED: similar to Protein disulfide-isomerase A4 precursor (Protein ERp-72) (ERp72) isoform 1 [Canis familiaris]
    MRPRTAWLLLLLLLALAHLLAAAGPDGDSSNKEDAIEDEEEEDDDEEEEEDDLEVKEENGVLVLNDINFDNFVADKDTVL
    LEFYAPW
    CGHCKQFAPEYEKIASTLKENDPPIPVAKIDATSESALAGRFGVSGYPTIKILKKGEAVDYEGSRTQEEIVAK
    VKEVSQPNWTPPPEVTLVLTKENFDDVVNGADIILVEFYAPW
    CGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDL
    AKRFEVSSYPTLKIFRKGKPFDYNGPREKYGIVDYMIEQSGPPSKEIMALKQVQEFLKDGDDVIIIGVFKAESDPAYQQY
    QDAANNLREDYKFHHTFSTEIAKFLKVSSGKLVVMQPEKFQSKYEPRSNVLDIQVSEGPRAVGLQGVRPALPLTGHRSCI
    NGARPAPPRPASATQFWRNKVLEVAKDFPEYTFAVADEDDFASEVRDLGLSESGEDVNAAILAEGGRRFAMEPDDFDADA
    LREFVRAFQDGTLKPVVKSQPVPKNNKGPVKVVVGKTFDSVVMDPKKDVLIEFYAPW
    CGHCKQLEPEYAALGKKYKNRKN
    LVIAKMDATANDITSDRYRVDGFPTIYFAPRGDKKNPIKFEDGNRDLEHLSKFVEEHATKLSRTREEL

    >gi|73978407|ref|XP_848238.1| PREDICTED: similar to Protein disulfide-isomerase A4 precursor (Protein ERp-72) (ERp72) isoform 3 [Canis familiaris]
    MRPRTAWLLLLLLLALAHLLAAAGPDGDSSNKEDAIEDEEEEDDDEEEEEDDLEVKEENGVLVLNDINFDNFVADKDTVL
    LEFYAPW
    CGHCKQFAPEYEKIASTLKENDPPIPVAKIDATSESALAGRFGVSGYPTIKILKKGEAVDYEGSRTQEEIVAK
    VKEVSQPNWTPPPEVTLVLTKENFDDVVNGADIILVEFYAPW
    CGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDL
    AKRFEVSSYPTLKIFRKGKPFDYNGPREKYGIVDYMIEQSGPPSKEIMALKQVQEFLKDGDDVIIIGVFKAESDPAYQQY
    QDAANNLREDYKFHHTFSTEIAKFLKVSSGKLVVMQPEKFQSKYEPRSNVLDIQDARAASRVVAWIQFHVLPAQGHLPMS
    HPDGPQPRVKSMVFTSHLLLCSLGGQLTTQFWRNKVLEVAKDFPEYTFAVADEDDFASEVRDLGLSESGEDVNAAILAEG
    GRRFAMEPDDFDADALREFVRAFQDGTLKPVVKSQPVPKNNKGPVKVVVGKTFDSVVMDPKKDVLIEFYAPW
    CGHCKQLE
    PEYAALGKKYKNRKNLVIAKMDATANDITSDRYRVDGFPTIYFAPRGDKKNPIKFEDGNRDLEHLSKFVEEHATKLSRTR
    EEL

    >gi|73945785|ref|XP_533381.2| PREDICTED: similar to thioredoxin domain containing 10 [Canis familiaris]
    MLKENLCASDLLAYINLAGHVFLLDMAFSKGFVQDLDESNLVWLPSNLKETCSSPKQAGAQSVISWIHQRIAHGNSHVIL
    DEAGSTGAATVVRRHENGMKKPIHLFKDNRKDDIWLVDFYAPW
    CGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSS
    IASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHVQKRHRVFFVYIGGESPLKEKYID
    AASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFIYDEYEDGDLSSWINRERFQNYLTVDGFLLYELGDTGKLV
    AIAVIDEKNTSIEHTRLKSIIQEVARDYRDQFHRDFQFGHMDGNDYINTLLMDELKVPTVVVLNTSNQQYFLLDRQIKNA
    EDMVQFINNILDGTVEAQGGDSILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVVSIMCYGIYTADTDGGYIEER
    YEVSKSEIESQEPTEESKEQEPRSGDALVPTVQGPKDVLEKKKD

    >gi|73972981|ref|XP_866055.1| PREDICTED: similar to chloride intracellular channel 5 isoform 2 [Canis familiaris]
    MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGD
    VKTDVNKIEEFLEEALAPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTRALKKLDDYLNNPLPEEI
    DANTHGDEDKRSRRKFLDGDELTLADCNLLPKLHVVKIVSKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAADKEIES
    AYADVAKRLSRS

    >gi|73972983|ref|XP_538943.2| PREDICTED: similar to Chloride intracellular channel protein 5 isoform 1 [Canis familiaris]
    MNDEDSNNIYDTVQRIGIYELPDDPEENEVPSYDNINECLTENHVYASELETHEYDSVSVYIAGGKEDSLPSSQPEAADY
    LLPDEVCPESQGLQPGELQEDHDISMEELHSATQDQETGPEESQEDGGMMGEDLPSPANFTIQEGRAFVARNSANEGLEE
    NQSTSMDPEISLFVKAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVN
    KIEEFLEEALAPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTRALKKLDDYLNNPLPEEIDANTHG
    DEDKRSRRKFLDGDELTLADCNLLPKLHVVKIVSKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAADKEIESAYADVA
    KRLSRS

    >gi|57096374|ref|XP_539450.1| PREDICTED: similar to anterior gradient 2 homolog [Canis familiaris]
    MEKISVSAFLLLVALSYTLAKDITVKSGAKKDTKDSAPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDE
    CPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIIFVDPSLTVRADITGRYSNRLYAYEPSDIALL
    LDNMKKALKLLKTEL

    >gi|74000349|ref|XP_535453.2| PREDICTED: similar to protein disulfide isomerase-associated 3 precursor [Canis familiaris]
    MTAFLIKSSSHKAGVPGLDKKPHLDLSPDFASPPPTLATPERSSPHGRRAQSGPPARLHLSPPQSGPPARLHLSPPQSGP
    PARLHLSPPQSRLPARLHLSPPHLLPGFRLAAGPARPQPGASQPIGGCHTAARAGLGGWDLRLQVRLGQTRERRLRVRGR
    GRPSQSPPSPDPPGRPQPHLVAMRPRCRALLPGVALLFAAAGLASASDVLELTDDNFESRISDTGSAGLMLVEFFAPW
    CG
    H
    CKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVP
    LRTEEEFEKFISDKDASVVGFFQDLFSEAHSEFLKAASNLRDNYRFAHTNVESLVNKYDDDGEGITLFRPSHLMNKFEDK
    TVAYIEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLN
    FAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPV
    KVVVAENFDEIVNDENKDVLIEFYAPW
    CGHCKNLEPKYKELGEKLRKDPNIIIAKMDATANDVPSPYEVRGFPTIYFSPA
    NKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKAKKKKKAQEDL

    >gi|73977959|ref|XP_532599.2| PREDICTED: similar to peroxiredoxin 1 [Canis familiaris]
    MSSGNAKIGHPAPNFKATAVMPDGQFKDLSLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|73995917|ref|XP_850181.1| PREDICTED: similar to thioredoxin reductase 2 isoform 1 precursor [Canis familiaris]
    MSSCGIRAPALTWPFLSPLSAAGQQNYDLLVIGGGSGGLACAKEAAQLGKKVAVVDYVEPSPRGTKWGLGGTCVNVGCIP
    KKLMHQAALLGSMIRDAPHYGWDVAQPVLHDWRTMAEAVQNHVKSLNWGHRVQLQDRKVTYFNVKASFVNEHTVCGVAKG
    GKETLLSAEHIVIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGLGLDTTIMIRSIPL
    RGFDQQMSSLVTEYMASQGTRFLRGCTPSRVRRLPDGQLQVTWENLTSGKEDVGTFDTVLWAIGRIPETKSLNLEKAGVN
    TNPNSQKILVNAQEATSIPHIYAIGDVAEGRPELTPTAIMAGRLLAQRLCGQASDVMDYDNVPTTVFTPLEYGCVGLSEE
    EAVTRHGEEHVEVYHAYYKPLEFTVAERDASQCYVKMVCLRKPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMRT
    VGIHPTCAEEVAKLRITKRSGLDPTVTGC

    >gi|73984367|ref|XP_850180.1| PREDICTED: similar to Thioredoxin-dependent peroxide reductase, m
    MKIGEGGQSGESLAAVVGRFLQASIAGHVSAIPWGISASAALRPAASRRTCLTNVLWSGSGQAKFTFSTSSSYHAPAVTQ
    HAPYFKGTAVVNREFKDLTLDDFKGRYLVLFFYPLHFTFV
    CPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINAL
    QKNGSLGHMNIALLSDLTKQISREYGVLLEGPGIALRGLFITDPNGVIKHLSVNDLPVGRSVEETLCLVKAFHFVETHGE
    VCPANWTPDSPIIKPDPSASKEYFEKVNQ

    >gi|73984878|ref|XP_864203.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 isoform 4 [Canis familiaris]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRILQWPKEQPFGEGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSP
    AITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|73991576|ref|XP_534350.2| PREDICTED: similar to Thioredoxin-like protein KIAA1162 precursor [Canis familiaris]
    MLASYAPWCPSCQQTDSEWETFAKNGEVLHISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGVYEDLQNYI
    LEKKWQSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYIFFVMATLIFGLFMGLVLVVISECFY
    IPLPRRLSEHAEQTQRPEDAHKAEQLQDAEEEKEDSNEEENKDSLVDDDEEKEDLGDEEEAEEDEEEDSSAPPVGEGRND
    TQGQGPLREVQQVGELEPEEQVPVWPSSVHAEVAEDTLRQRKNQHADKGP

    >gi|57104706|ref|XP_543052.1| PREDICTED: similar to Molybdenum cofactor synthesis protein 3 (Molybdopterin synthase sulfurylase) (MPT synthase sulfurylase) [Canis familiaris]
    MASREEVLALQAEVARREEELSSLKQRLAAALLAEQAPERRVPVSPLPPKAALSREEILRYSRQLVLPELGVHGQLRLAA
    ASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYAQALT
    PATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCVFPQPPPAETVTN
    CADG
    GVLGVVTGVLGCLQALEVLKVAAGLGPSYSRSLLIFDALRGQFRCIQLRSRRLDCAACGERPTVTALQDYEAFCGSSATD
    KCRSLQLLSPEERVSVADYKRLLDSGSPHLLLDVRPQVEVDICRLPHALHIPLKHLERRNAESLKLLGEAIREGKQGAQA
    GAAFPVYVICKLGNDSQKAVKILQSLTAVQELESLTVQDVVGGLMAWAAKIDGTFPQY

    >gi|73946795|ref|XP_850854.1| PREDICTED: similar to Peroxiredoxin 2 (Thioredoxin peroxidase 1)
    MSSGNAKIGHPAPNFKATAVVPDGQFKDLSLCDYKGKYVVFFFYLLDFTFVCPTETIAFSDRAEFKKLNCQVIGASVDSH
    FCHPACHHCKLNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|73984884|ref|XP_864278.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 isoform 7 [Canis familiaris]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLVKILVLLYPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPR
    LPEHCIEYVRILQWPKEQPFGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCAT
    EVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATL
    EGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|73981925|ref|XP_851794.1| PREDICTED: similar to NM23-H8 [Canis familiaris]
    MAGKKREIQLQAVVNSQSLWDEMLQNKGLTVIDVYQAWCGPCKAMQPLFRKLKNELNEDELLHFVVAEADNIVTLQPFRD
    KCEPVFLFSVNGKIIARINGANAPLVNKKITNLINEEKKIAAGEMVRPQYREIVFVDSDVEDAGEAHSESAEQLYIIVII
    KPDAVMTRKSLEIKKKIIEAGYVLEIEDKRVLTEQQAREFYSRKAEEPDFQDFVLFMTSGVSHILVISQGDEEQPDLKET
    EPDPEMEAKEADEDHHEEVRTPVKKKHDSLQEYLERQHVSQFCDIEENLTDTNHFIDILFPDFKNMKNLKLEKTLAFLRP
    RLFQEKREHVLKIIEDEGFKILMQRQIILSEEEAQTLCREYENEDYFENVIEQMTSGPSLALVLLRDCGLQHWKNLIGPS
    SVEKAKEHLPESLCVRFAMEDLPINQLYGSDSLEEAEKEIQYFFPSQDTLALIKPHVTHEQREEILKLIRETGFEITQMK
    EVVLNEEAAEKIYSKIKGRDFYQDVLQMLSEGPSLVMVLTKWNAVSDWRRLMGPIDPDEAKLLSPDSIRAHFGRSTLKNA
    VHGSSTIYEAMETISRMFEDFIPENHEGN

    >gi|73984886|ref|XP_864299.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 isoform 8 [Canis familiaris]
    MDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLI
    SLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVRILQWPK
    EQPFGEGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLN
    NYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS
    IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|73984888|ref|XP_864319.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 isoform 9 [Canis familiaris]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLVKILVRDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRL
    PEHCIEYVRILQWPKEQPFGEGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCA
    TEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITAT
    LEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|73984890|ref|XP_864341.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 2 isoform 10 [Canis familiaris]
    MADGEEPMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTEALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVG
    RPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDG
    GTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVRILQWPKEQPFGEGVPLDGDDPDHIQWI
    FQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERK
    ENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDG
    QELAVADVTTPQTVLFKLHFTS

    >gi|73984892|ref|XP_864363.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 isoform 11 [Canis familiaris]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTEALSGFRQIHVIDMDTIDVS
    NLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYED
    GVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVRILQWPKEQPFGEG
    VPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFND
    VDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRP
    NLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|73984894|ref|XP_864382.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 isoform 12 [Canis familiaris]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRILQWPKEQPFGEGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKIATR

    >gi|73984896|ref|XP_533765.2| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 1 isoform 1 [Canis familiaris]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRILQWPKEQPFGEGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKIATRWTVHIHI

    >gi|73967568|ref|XP_849400.1| PREDICTED: similar to quiescin Q6-like 1 [Canis familiaris]
    MGTPQMDDQAEAYLVTAPGPGCCGHGPAGGRGRPGQQACKDSSGALRDRGDSGGTAPQLVSRSPPTTPVKWEFPNQQPSV
    ARRLPPLLVLLAAAAAGPGAGGAARLYRAGEDAVWVLDSGSVRGATANSSAAWLVQFYSSW
    CGHCIGYAPTWRALARDVR
    DWAAAIRVAALDCAEEENHEVCRAYDIHFYPSFRYFKAFTKDFTTGENFKGPDRELQTVRRTMIDFLQNHTDTDRPPACP
    PLGPIPPSDVLSLLDNRDGRYVAILFENNSSYVGREVILDLLPYENIVVKRVLDADEAFLEKLGVSSLPSCYLIYPNGTR
    GLMNIGKPLRSFFSSYLKSLPDVRKKLISLPEKPNKEENPEVVIWREFDRSKLYTADLESGLHYLLRVELATHRSLAGAE
    LQTLKDFVTVLAKLFPGRTPVRKLLETLQEWLANLPLDRIPYNAILDLVNNKMRISGIFLINRIKWVGCQGSRPEFRGYT
    CSLWKLFHTLTVQAGTHPEALDGTGFEDDPQAVLQTIRRYIHTFFG
    CKECSEHFEEMAKESMDSVKTSDQAILWLWKKHN
    LVNNRLAGHLSEDPKFPKVPWPSPDLCPACHEEIKGLHSWNEGQVLLFLKQHYGSDNLVDTYAADQEDAHEGGAPPEGGE
    QEQGLVSPEKPQGEQRAKSLRPPSVLPPRPDLSQGLQLGLDGGHQSVSRAEGHREVEVAVPFLGMGFSSLDMSLCVVLYV
    ASSLFLMLMYFFFRVRSKRWKVRYHRLSV

    >gi|73984898|ref|XP_851790.1| PREDICTED: similar to ubiquitin-activating enzyme E1C isoform 2 isoform 3 [Canis familiaris]
    MADGEEPMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFR
    QIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRW
    INGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVR
    ILQWPKEQPFGEGVPLDGDDPDHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATS
    AYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLY
    LQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|73970067|ref|XP_531785.2| PREDICTED: similar to ATP binding protein associated with cell differentiation [Canis familiaris]
    MEANASVDMFSKVLENQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLEALRKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKKVVCHFYRDSTFR
    CKILDRHLVILSKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDYVVG
    FTDLGNTDDFTTETLEWRLGCSDILNYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

    >gi|57085139|ref|XP_536403.1| PREDICTED: similar to R53.5 [Canis familiaris]
    MDPSFFSVGMWSIGAGALGAAALALLLANTDVFLSKSQKATLEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPG
    CFLCREEAADLSSLKPKLDELGVPLYAVVKEQIRTEVQDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFVRLGVWYNFFR
    ARNGGFSGNLEGEGFILGGVFVVGPGKQGILLEHREKEFGDKVNPVSVLEAARKIQTQTSAAETK

    >gi|73977503|ref|XP_532572.2| PREDICTED: similar to glutathione peroxidase 7 [Canis familiaris]
    MNKEGGGVGGLRAALLAGVSSVRLSAEDETGETLEVRGPWGDPDPALEVRVPRGDPALEVRPRGTQGPTTQAACVRLLLL
    QVSLVVNVASA
    CGFTDGHYRSLQQLQRDLGPRHFTVLAFPCNQFGQQEPDGDREIESFARRTYGVSFPMFSKVAVTGTGA
    HPAFKYLTQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEDIRPQITALVRKLILKKREDL

    >gi|73984927|ref|XP_541733.2| PREDICTED: similar to thioredoxin reductase 3 [Canis familiaris]
    MNFPENSAMALKAPSNEALMDQLDVKELFSSLGVACNILELDQVDDGANVQEVLSEITNQRTVPNIFVNKVHMGGCDRTF
    QAHQSGLLQKLLQEDSAYDYDLIVIGGGSGGLACAQEAAILGKKVMVLDFVVPSPQGTSWGLGGT
    CVNVGCIPKKLMHQA
    ALLGQALRDARKFGWEYSQQVKHTWETMTEAIQNHIGSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNRKGQETCYT
    AAKFVLATGQRPRYLGIQGDKEY
    CITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTIMVRSILLRGFDQEMA
    EKVGSYMEQHGVKFLRKFVPVLVQQLEKGSPGKLKVVAKSTEGPETIEEIYNTVLLAIGRDSCTRKIGLEKIGVKINEKS
    GKIPVNDVEQTNVPYVYAVGDILEGKLELTPVAIQAGKLLARRLFAGRLEKCDYVNVPTTVFTPLEYGCCGLSEEKAIEM
    YKKENLEVYHTLFWPLEWTVAGRDNNTCYAKIICNKLDNYRVIGFHVLGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHP
    TCGEVFTTLEITKSSGLDITQKGC

    >gi|73952273|ref|XP_851559.1| PREDICTED: similar to Glutaredoxin (Thioltransferase) (TTase) [Canis familiaris]
    MAQAFVSSRLQPGKVVVFVKPTCPYCRRAQELLGALPLRPGALEFVDITAAGDTSSIQDYLEKLTGARTVPRVFIGRDCI
    GGCSDLIEMNQSGELCKRLQQIGALQ

    >gi|74003790|ref|XP_848225.1| PREDICTED: similar to F26E4.12 [Canis familiaris]
    MEPLTAYPLRRSGSKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDAKGRTVSLEKFKGKVTLVVNVASDCQ
    LRDRNYLAVQELHKEFGPFHFSVLAFPCNQFGESEPFPSKEVVSFARNNYGATFPIFHKIKILGSEADPAFRFLVDSSKK
    EPRWNFWKYLVNPEEQVVKSWRPEEPIEVIRPEIAALVTQMILRKKDDL

    >gi|74004753|ref|XP_850921.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 isoform 2 [Canis familiaris]
    MGVWLNKNDYVRDLKRVILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLADNQEGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CS
    H
    CHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVSFAMQHVRRTVTE
    LWTGNFVNSIQTAFAAGVGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNLCKSLDITTSTTAYFPPGAT
    LNNKEKSSVLFLNSLDAKEIYLEIMHNLPDFELLSANTLEDRLAHHRWLLFFNFGKHENSNDPELKKLKTLLKNEHIQVG
    RFDCSSAPDVCSNLYVFQPCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPW
    CPPCRALLPELRKASKHLYGQLKFGTLDCTIHEGLCNMYNIQAYPTTVVFNQSNVHEYEGHHSAEQILEFIEDLMNPSVI
    SLTPTTFNELVKQRKHDEVWMVDFYSPW
    CHPCQVLMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVRRYPEIRFYPQ
    KSNKAYQYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVLQGKNHWVVDFYAPW
    CGPCQNFAPEFELLARMIKG
    KVKAGKVDCQAYGQTCQKAGIRAYPTVKFYPYERAKRNIWGEQIDARDAKEIATLIHEKLKNLQNHGKRDKDEL

    >gi|74004755|ref|XP_862695.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 isoform 3 [Canis familiaris]
    MGVWLNKNDYVRDLKRVILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLADNQEGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CS
    H
    CHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVSFAMQHVRRTVTE
    LWTGNFVNSIQTAFAAGVGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNLCKSLDITTSTTAYFPPGAT
    LNNKEKSSVLFLNSLDAKEIYLEIMHNLPDFELLSANTLEDRLAHHRWLLFFNFGKHENSNDPELKKLKTLLKNEHIQVG
    RFDCSSAPDVCSNLYVFQPCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPW
    CPPCRALLPELRKASKHLYGQLKFGTLDCTIHEGLCNMYNIQAYPTTVVFNQSNVHEYEGHHSAEQILEFIEDLMNPSVI
    SLTPTTFNELVKQRKHDEVWMVDFYSPW
    CHPCQVLMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVRRYPEIRFYPQ
    KSNKAYQYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVLQGKNHWVVDFYAPW
    CGPCQNFAPEFELLARMIKG
    KVKAGKVDCQAYGQTCQKAGIRAYPTVKFYPYERAKRNIWGEQIDARDAKEIATLIHEKLKNLQNHGKRDKDEL

    >gi|74004759|ref|XP_862743.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 isoform 5 [Canis familiaris]
    MGVWLNKNDYVRDLKRVILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLADNQEGGQYESWNYYRYDFGIYDDDPEIITLDRREFGNFVNSIQTAFAAGVGWLIT
    FCSKGGDCLTSQTRLRLSGMLFLNSLDAKEIYLEIMHNLPDFELLSANTLEDRLAHHRWLLFFNFGKHENSNDPELKKLK
    TLLKNEHIQYNIQAYPTTVVFNQSNVHEYEGHHSAEQILEFIEDLMNPSVISLTPTTFNELVKQRKHDEVWMVDFYSPW
    C
    HP
    CQVLMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVRRYPEIRFYPQKSNKAYQYHSYNGWNRDAYSLRIWGLGFL
    PQASIDLTPQTFNEKVLQGKNHWVVDFYAPW
    CGPCQNFAPEFELLARMIKGKVKAGKVDCQAYGQTCQKAGIRAYPTVKF
    YPYERAKRNIWGEQIDARDAKEIATLIHEKLKNLQNHGKRDKDEL

    >gi|74004761|ref|XP_862766.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 isoform 6 [Canis familiaris]
    MGVWLNKNDYVRDLKRVILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLADNQEGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CS
    H
    CHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVSFAMQHVRRTVTE
    LWTGNFVNSIQTAFAAGVGWLITFCSKGGDCLTSQTRLRLSGMLFLNSLDAKEIYLEIMHNLPDFELLSANTLEDRLAHH
    RWLLFFNFGKHENSNDPELKKLKTLLKNEHIQVGRFDCSSAPDVCSNLYVFQPCLAVFKGQGTKEYEIHHGKKILYDILA
    FAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPW
    CPPCRALLPELRKASKHLYGQLKFGTLDCTIHEGLCNMYNIQAYPT
    TVVFNQSNVHEYEGHHSAEQILEFIEDLMNPSVISLTPTTFNELVKQRKHDEVWMVDFYSPW
    CHPCQVLMPEWKRMARTL
    TGLINVGSIDCQQYHSFCAQENVRRYPEIRFYPQKSNKAYQYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVL
    QGKNHWVVDFYAPW
    CGPCQNFAPEFELLARMIKGKVKAGKVDCQAYGQTCQKAGIRAYPTVKFYPYERAKRNIWGEQIDA
    RDAKEIATLIHEKLKNLQNHGKRDKDEL

    >gi|74004763|ref|XP_535988.2| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 isoform 1 [Canis familiaris]
    MGVWLNKNDYVRDLKRVILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLADNQEGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CS
    H
    CHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVSFAMQHVRRTVTE
    LWTGNFVNSIQTAFAAGVGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNLCKSLDITTSTTAYFPPGAT
    LNNKEKSSVLFLNSLDAKEIYLEIMHNLPDFELLSANTLEDRLAHHRWLLFFNFGKHENSNDPELKKLKTLLKNEHIQVG
    RFDCSSAPDVCSNLYVFQPCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPW
    CPPCRALLPELRKASKHLYGQLKFGTLDCTIHEGLCNMYNIQAYPTTVVFNQSNVHEYEGHHSAEQILEFIEDLMNPSVI
    SLTPTTFNELVKQRKHDEVWMVDFYSPW
    CHPCQVLMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVRRYPEIRFYPQ
    KSNKAYQYHSYNGWNRDAYSLRIWGLGFLPQASIDLTPQTFNEKVLQGKNHWVVDFYAPW
    CGPCQNFAPEFELLARMIKG
    KVKAGKVDCQAYGQTCQKAGIRAYPTVKFYPYERAKRNIWGEQIDARDAKEIATLIHEKLKNLQNHGKRDKDEL

    >gi|73979031|ref|XP_853872.1| PREDICTED: similar to Thioredoxin-dependent peroxide reductase, m
    MTAAVGRLLWASIARHVSAIPWGISASAALRPAASRRTCLTNVLWSGSSQAKFAFSTSSSYHAPAVTQHAPYFKGTAIVN
    GEFKDLTLDDFKGRYLVLFFYPLDFTFV
    CPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINTPQKNGSLGHMNIA
    LLSDLTKQIPRDYGMLLEGPGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLCLVKAFQFVETHGEVCPANWTPDSPT
    IKPHTTASKEYFEKVNQ

    >gi|74004274|ref|XP_545450.2| PREDICTED: similar to glutathione peroxidase 6 [Canis familiaris]
    MVQCSYIGNHCTRELNALQEELKSFGVVVLGFPCNQFGKQEPGKNSEILSGLKHVRPGGGFVPNFQLFEKGDVNGEKEQK
    VFTFLKNSCPPTSDLLGSSNQLFWEPMKVHDIRWNFEKFLVGPDGVPVMRWFHQAPVSTVKADILAYLKQLKTE

    >gi|73946376|ref|XP_848380.1| PREDICTED: similar to UPF0308 protein C9orf21 [Canis familiaris]
    MAEPAPAPGPVTQQVSGRAVPAAAPSGPERGQPLSAAVAELPVLDASGRRVPFGALFRERRAVVVFVRHFLCYICKEYVE
    DLAKIPKSVLQEADITLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKKLGMKRGEGIASSGKSPHIKSNILSGSIR
    SLCRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLVGIQHVDFTSRPSIIHV

    >gi|73996011|ref|XP_543566.2| PREDICTED: similar to apoptosis-inducing factor like isoform 1 [Canis familiaris]
    METIGTLKHEGPGGAVLGAAGSRPQCRRSAGPAGSRRRERGTSGGRSVSAPSPLPPPRSPRGPTVCPTPFPAARVGEGAG
    EGAGEGEVLPQRGDRTCQGPESAREAGAGPGERGWEASIQEEEAVAAPGGGPGGSSSRNGSSSISKGHGESSPTWGTLGL
    PQPSICVPAPPLICGPLAMGGCFSKPKPDCISELLGAFWKEVEDANSLAWLLSGPLPGCSWRWARLGVTVLPRLPTVELK
    IEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHAEERLPAPHPYPGPQDCVEAAVCHVKDLENGQMREVELGWGKVL
    LVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNIGTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQL
    QRRTKVMAKCISPSAGHSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSKSLDAQPEQLALRPK
    EFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRN
    AVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRAQEGKLKEVVLKS
    SKVVRADVCVVGIGLAVRHGGLRGSGVGLGPFGRMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQN
    MLAQEAEISTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEDLKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRA
    IRKREVE

    >gi|73962209|ref|XP_547674.2| PREDICTED: similar to Thioredoxin domain containing protein 2 (Spermatid-specific thioredoxin-1) (Sptrx-1) [Canis familiaris]
    MDKEMEVENDRAGAPEEPKMRPEKQEKANQGDANESPLLQGLTSHVTPLVPEFLNPARIQEKALAHQVNSIQHKSAKESK
    GPQPKDIFLPVWGGNSFNFSAKTLQPEQAVIPNFSAKIISPNQADTPNSSEKNIPLKQADISDFSAKPISPKEGNTPSFL
    AKIIPPKQSDTFNFPAKTIPSNQPDTPNFSAKTIPPKQADTSYSSEKIIPPKEGEIPNSSEKNILRKDDTTSTSSEKNIL
    RKQSDTTKSPAKSILPKQGSSPKFLAKSILPKQANTPKLPAKTLQSKQINSPKVLAKSILPKHGQTSKSSEENILPREGD
    IKSSEDTIQPKEGDIPKSSKEIIQPVEGNVLKPSGTMELLEVDLVKVILNKEDFELALKEAGERLVAVDFSATW
    CGPCRT
    IKPLFRSLSLKYEDVVFLEVDADECEELVKDLEIICIPTFQFYKQEEKVGEF
    CGAVKEKLEAIIAELK

    >gi|73998492|ref|XP_863964.1| PREDICTED: similar to glutathione-S-transferase omega 1 isoform 3 [Canis familiaris]
    MSAGSARTLAKGSAPPGPVPEGLIRVYSMRFCPFAQRTLLVLKAKGIRHEIININLKNKPEWFFKKNPFGLVPVLENSQG
    QLIYESPITCEYLDEAYPGKKLLPDDPYEKACQKMVFELFSKVLTNKKTTFFGGNSLSMIDYLIWPWFERLEALELNDCV
    DHTPKLKLWMAAMREDPAVSALLNEANTLRGFLNLYLQNSPEACDYGL

    >gi|57107281|ref|XP_535007.1| PREDICTED: similar to glutathione-S-transferase omega 1 isoform 1 [Canis familiaris]
    MSAGSARTLAKGSAPPGPVPEGLIRVYSMRFCPFAQRTLLVLKAKGIRHEIININLKNKPEWFFKKNPFGLVPVLENSQG
    QLIYESPITCEYLDEAYPGKKLLPDDPYEKACQKMVFELFSKVPSLVTGFLRRQNKEDGSGLKEELRKEFSKLEEVLTNK
    KTTFFGGNSLSMIDYLIWPWFERLEALELNDCVDHTPKLKLWMAAMREDPAVSALLNEANTLRGFLNLYLQNSPEACDYG
    L

    >gi|57095572|ref|XP_532386.1| PREDICTED: similar to peroxiredoxin 1 isoform 1 [Canis familiaris]
    MSSGNAKIGHPVPNFKATAVMPDGRFKDLSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFSHLAWINTPKKQGGLGPMNIPLVSDPKHTIAQDYEVLKADESISLRGLFVIDDKGILWQITVNDLPVGHSVDESLRLV
    QAFPFTDKHGEVCSAGWKPGSDTIKPDVQKSKEYFSKQK

    >gi|74006285|ref|XP_545762.2| PREDICTED: similar to KAT protein [Canis familiaris]
    MLAAPRGRPRAAFLQLAVAARTMAGAPTVSLPELRSLLAAGQARLIDVRSREEAAAGTIPGALNIPVSELESALQMEPAA
    FQALYAAEKPKLQEENLIFF
    CQMGKRGLQATQLARGLGYAGARNFAGAYREWSQKEG

    >gi|73973109|ref|XP_532182.2| PREDICTED: similar to Chloride intracellular channel protein 1 (N
    MAEEPPQVELFVTAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLPYRTEVHTDTNNI
    EEVLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALKDNLEKGLLKVLKVLDNYLTSPLPEEGDETSAENE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFSIPEVFRGVHRYLHNAYAREEFASTCPDDEEIELAYEQVAKAL
    T

    >gi|73985479|ref|XP_861668.1| PREDICTED: similar to ubiquitin-activating enzyme E1-like isoform 3 [Canis familiaris]
    MDVLETSKLVDEELYSRQLYVLDMPAMQRIREAKVLLSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCWSDLAAQFFLSE
    QDLETSRAEASRELVAKLNKGVQVSVHTGDITEELLLGFQVVVLTTSKLEEQLKVGTLCHELGICFLVADTRGLVGQLFC
    DFGEDFTVQDPTEAEPLTAAIQHISQGSPGILTLRKETDDHYFCDGDLVTFSGIEGMVELNGCDPRPIRVQEDGTLEIGN
    TATFSRYLRGGAVTEVKRPKTVSHKPLAVALLQPRIVAQSPQEVHRAQCLHQAFRALHQFQHLHGRLPKPWDPVDAEMVV
    GLARSLEPLKGTKGEPLDEALVKTVALSSAGGLSPMAATMGAVAAQEVLKAISRKFMPLDQWLYFDALDCLPEDGEPLPK
    PEDCAPRGCRYDGQIAVFGAGFQEKLSWQHYLLVGAGAIGCELLKSFALVGLGAGPSGGVTVADMDHVEHSNLSRQFLFT
    TQDIGRLKAEVAAEATHRLNSDLQVTPLTMLLDPTTEHIFGDNFFSRVDGVAAALDSFQARKYVAARCTHYLKPLLEAGT
    QGTMGHASVFMPHVTEAYRAPTSTLASEETTYPV
    CTLRYFPSRVEHTVQWARNKFEGLFCLSAETINHNQQVLTSLAETD
    GPQVLTLLQEVLGILRERPQTWQDCVLWALGHWQLCFCYSIMQLLNHFPPDKVLEDGTLFWSGPKQCPQPLEFDANQDTH
    LLYVLAAANLYAQMHGLPGSRDQTALRGLLKLLPLPLQEECRQWGLRTAQHPFRLLGPEQLKKLQEVLEVWSGSPPLKPL
    KFEKDNDSNFHMDFVAAAASLRAQNYGILPANRSQSKRIVGKIIPAIATTTAAVAGLVGLELYKVVGRPRPLSAFRHCFL
    HLAENRFNRWVPFAPAIQKFHHLTWTCWDRLKVPAGQPERTLKLLLAHLQEQFGLRVKMLLHGRSLLYSAGWLPEKQAQR
    LALRVTELVQQVTGWIPKPGQRVLVLELSCEGEDEDTTFPPLHYEL

    >gi|73948878|ref|XP_850458.1| PREDICTED: similar to Methionine-R-sulfoxide reductase B [Canis familiaris]
    MGDSSTTLRFLIRKRHSPYDFVVKIDKSKPKEERSLTKHELPLTKSEWQKKLTPEQFYVTREKGTEPPFSGVYLNNKESG
    MYHCVCCDSPLFSSEKKYCSGTGWPAFSEAHGTSGSDERDTGILRRVDTSLGLTRTEVVCKQCEAHLGHVFPDGPGPSGQ
    RF
    CINSVALKFKPRKH

    >gi|73985481|ref|XP_850545.1| PREDICTED: similar to ubiquitin-activating enzyme E1-like isoform 1 [Canis familiaris]
    MDVLETSKLVDEELYSRQLYVLDMPAMQRIREAKVLLSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCWSDLAAQFFLSE
    QDLETSRAEASRELVAKLNKGVQVSVHTGDITEELLLGFQVVVLTTSKLEEQLKVGTLCHELGICFLVADTRGLVGQLFC
    DFGEDFTVQDPTEAEPLTAAIQHISQGSPGILTLRKETDDHYFCDGDLVTFSGIEGMVELNGCDPRPIRVQEDGTLEIGN
    TATFSRYLRGGAVTEVKRPKTVSHKPLAVALLQPRIVAQSPQEVHRAQCLHQAFRALHQFQHLHGRLPKPWDPVDAEMVV
    GLARSLEPLKGTKGEPLDEALVKTVALSSAGGLSPMAATMGAVAAQEVLKAISRKFMPLDQWLYFDALDCLPEDGEPLPK
    PEDCAPRGCRYDGQIAVFGAGFQEKLSWQHYLLVGAGAIGCELLKSFALVGLGAGPSGGVTVADMDHVEHSNLSRQFLFT
    TQDIGRLKAEVAAEATHRLNSDLQVTPLTMLLDPTTEHIFGDNFFSRVDGVAAALDSFQARKYVAARCTHYLKPLLEAGT
    QGTMGHASVFMPHVTEAYRAPTSTLASEETTYPV
    CTLRYFPSRVEHTVQWARNKFEGLFCLSAETINHNQQVLTSLAETD
    GPQVLTLLQEVLGILRERPQTWQDCVLWALGHWQLCFCYSIMQLLNHFPPDKVLEDGTLFWSGPKQCPQPLEFDANQDTH
    LLYVLAAANLYAQMHGLPGSRDQTALRGLLKLLPLPVPQHLAPNSPNDLKLAPASAEYGPEQLKKLQEVLEVWSGSPPLK
    PLKFEKDNDSNFHMDFVAAAASLRAQNYGILPANRSQSKRIVGKIIPAIATTTAAVAGLVGLELYKVVGRPRPLSAFRHC
    FLHLAENRFNRWVPFAPAIQKFHHLTWTCWDRLKVPAGQPERTLKLLLAHLQEQFGLRVKMLLHGRSLLYSAGWLPEKQA
    QRLALRVTELVQQVTGWIPKPGQRVLVLELSCEGEDEDTTFPPLHYEL

    >gi|73999010|ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
    MAAGAAEAAAVVEVGSAPQFEELLRLRAKSLVVVHFWAPWAPQCVQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYEI
    SSVPTFLLFKNSQKIDRLDGAHAPELTKKVQRHASSGSFPPSTNEHPKEDLHVRLKKLTHAAPCMLFMKGTPQEPR
    CGFS
    KQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASDELDTICPKAPKLEERLKVL
    TNKASVMLFMKGNKQEAK
    CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKELK
    DNGELLPVLKGEN

    >gi|73968171|ref|XP_851400.1| PREDICTED: similar to prostaglandin E synthase 2 isoform 1 [Canis familiaris]
    MAQVARALWPVRYALAWRLGGRLPPGLPAHSRAGFAGAAGGQGPAATARKGSPRLLGAAALALGGVLGLYHTARWHLRAQ
    HLRAQRPAAQLSLSSRLQLTLYQYKT
    CPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILLAQEGESLQQLN
    DSSVIISALKTYLVSGQPLEDIITYYPPMKAVNDQGKEVTEFCNKYWLMLDEKEAQHLYGGKEARTEEMKWRQWADDWLV
    HLISPNVYRTPAEALASFDYIVREGKFGAVEGAVAKYMGAAAMYFISKRLKSRHHLQDDVREDLYEAADKWVAAVGKDRP
    FMGGQKPNLADLAVYGVLRVMEGLEAFDDLMRHTRIQPWYLRVEKAIAEAPQ

    >gi|73977586|ref|XP_852280.1| PREDICTED: similar to Thioredoxin domain containing protein 12 pr
    MELRPHLGATCALGLGLLLLVTSSDGHIGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAEST
    EISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTG
    DAFREKHLEDEL

    >gi|73959117|ref|XP_547123.2| PREDICTED: similar to thioredoxin domain containing 11 [Canis familiaris]
    MALREAQQDASPACGPWGSFPTLSPRLSPALPVFQITEVALEYNNCHGDQVVEQLLQHLRRADAPLLRPLAPEPPEQLPE
    PPLITASPCCNTVVLPQWHSVSRTHNVCELCVNQSTGGVRPSSVGMPQCSFFEMAAALDSFYLKEQTFYHVASDSIECSN
    FLSSYSPFSYYTACCRTINRAVTGFIDSGQSVFETPTITFSSLEKKCEVDPPGSVPHIEENRYLFPEVDVSSTNFTGLSC
    RTNKTLNIYLLDSNLFWLYAERLGAPSATRVKEFATIVDVKEESHYILDPKQALMKFTLESFIQNFSVLYSPLKRHLIGS
    DSAQFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAQW
    CGFCPSLNHVFIQLARLLPSDTFTVARIDVSQNDLPWEFMVDR
    LPTVLFFPCNRKDRSVKYPEDLPVTLPNLLRFILHHSDPASTPQNLANPPTKECLQSEAVFQQGHISHLEREIQKLRAEI
    STLQRAQVQVEAQLSSARRDEHRLLRQKQTLEKQHSLLQLHSEQLQTLYEQKTHELEEVAQKLQELADASENLLTENTWL
    KILVATMERKLEGKDGAENLTPHKEAGSGHPNPSGVPRLPGGSPPPSNSSSTLASERSNENRTD

    >gi|74004757|ref|XP_862718.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 10 isoform 4 [Canis familiaris]
    MGVWLNKNDYVRDLKRVILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLADNQEGGQYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPG
    CS
    HCHDLAPTWRDFAKEIP

    >gi|73973598|ref|XP_853441.1| PREDICTED: similar to NM23-H8 [Canis familiaris]
    MIDEKPDIQLQAFVNSPRQWDEMLQKKKGVTVINFYQAWCGPCKAMQTSFRKLKNELNEDELLHFVITEADNIVTLQPFR
    DKCEPVFLFSVNAKIIAKINDSDADDAGEAPYESTEQLYLIAITKQYAVL

    >gi|73957436|ref|XP_853407.1| PREDICTED: similar to Dim1-like protein [Canis familiaris]
    MSFLLPKLNSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSPDLSKMAAIYLVDVDQTPVYTHYFDISYIPS
    TVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

    >gi|73945343|ref|XP_533363.2| PREDICTED: similar to dim1 isoform 1 [Canis familiaris]
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY