Candida glabrata CBS138 uid12376

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50284893|ref|XP_444874.1| hypothetical protein [Candida glabrata CBS 138]
    MPHNRVTIIGSGPAAHTAAIYLARAEMKPTLYEGMLANGIAAGGQLTTTTEIENFPGFPEGLTGTELMDRMRAQSTKFGT
    NIITETISKVDLSAKPFKLWTEFNEDGEPITTDAIVMATGASAKRLDLPGEDKYWQQGISA
    CAVCDGAVPIFRNKPLAVV
    GGGDSACEEAEFLTKYGSKVFMIVRKDHLRASTIMQRRVEKNEKIEVLFNSVSLEAKGDGKFLNALRIKNVKTNEESDLP
    VNGLFYAIGHNPATDIVKGQVETDESGYIKTVPGSSLTSIPGFFAAGDVQDSRYRQAITSAGSGCMAALDAERYLTELE

    >gi|50285063|ref|XP_444960.1| hypothetical protein [Candida glabrata CBS 138]
    MSTFMRQYARNMARVPVSTRLNAQRFACANYRFYSEKTNYKQADQPRLRINSSAPNFDADTSHGKINLYDYLGDSWGILF
    SHPADFTPV
    CTTEMGAFAKMKPQFDKRGVKLLGLSVEDAESHRKWIKDIEEINGIDKFGFPIIADTKRHVAFLYDMCDEE
    GFGNINDGSLTTVRSVYVIDPAKKIRVIFTYPSQVGRNTAEVLRVIDALQTADKHGVVTPGNWSPNDDVIIPPKVSDAEA
    SEKFGDFKTVKSYLRYTKLK

    >gi|50285145|ref|XP_445001.1| hypothetical protein [Candida glabrata CBS 138]
    MLFNKGLLALAATAALGVSAQDAVAPADSAVVKLEQDNFQDFLKENSLVMAEFFAPWCGHCKKLAPEYVKAAEELKSKNV
    SLVQIDCDDNRDLCMQLQIPGFPSIKLIKDGDIAHAKDYNGARTAEAIVKFMIKQTQPAVQVVEDKAALDALVANSTVPV
    VVDFGVNDFNATFYQFAHALSDDYVFISLPSKENKISVFLPVEGSSAEEIVFKGDHKTLAKDRSVFEEWLKVESLPFFGE
    INGEVFNAYLESGLPLAYFFFNEPSEVEENRKFFTDLAKKYRGKMAFVSLDAKQFGRHAENLNMKQQFPLFAIHNMTSNQ
    KFGLPQMAEEEFAKLNKAIKLKTKDITKLVENVLSGKAEAIVKSEEVPSVQESNVFKIVGKTHDKIVADPKKDVLVKYYA
    PW
    CGHCKKMAPTYEELADTYASDSSSKDKVVIAEVDATANDIFNVEIAGYPTILLYPAGKNAEPVVYEGDRSLDSFLTFI
    KENGANGIDGSSLHKKFLETKKAAEQAEIEDDNEDEDGFDDEL

    >gi|50285157|ref|XP_445007.1| hypothetical protein [Candida glabrata CBS 138]
    MFALVGRGARYTYLTTNKTTYNKTIKMLFQSKTDKKEWNPELTSEQLHVLKDKGTEAPGTGKYLYNDRTGVYTCANCDAP
    LYRSETKFDSGCGWPAFNGEIKGALKYKKDFSHGMMRTEIMCAKCGGHLGHEFKGEGWNKRLNLPNDSRH
    CVNSLSLNFK
    KEE

    >gi|50285641|ref|XP_445249.1| hypothetical protein [Candida glabrata CBS 138]
    MAAKSFYELECKDKKGETFKFDTLKGKVVLIVNVASKCGFTPQYKDLESLYQKHKDEGLVILGFPCNQFGGQEPGSQEEI
    GNFCQLNYGVTFPIMHKIEVNGDNTDPVYDFLKSQKSGLLGLNRVKWNFEKFLVDKHGKVHQRYSSLTKPMSIEDDIKQL
    LAQK

    >gi|50285689|ref|XP_445273.1| hypothetical protein [Candida glabrata CBS 138]
    MSKVIAKSIKYNPETEKLITLGAGCFWGTEHIYRKHLGDKIHDSKVGYANGDESSKDLLNRVSYKRVCKGDTNFCEVLQI
    SYDPKKVSLKELIDFFFRIHDPTTVNAQGPDVGTQYRSAIFTHSPEDLKEVQKLKEEWQPKWNNKIVTEVGPIETFYEAE
    EYHQIYLDRNPNGYACPTHFVRNLK

    >gi|50285829|ref|XP_445343.1| hypothetical protein [Candida glabrata CBS 138]
    MELRRSTRLSAKHGNEVKDEGPIKKKAKSVLKEKVNTKEPVKKPNTKEEKVSSDEAILEVGDDIPDITLQNQDGKDVSLK
    ALAKENKVIIIFLYPKASTPG
    CTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGA
    KKTPASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAKQYSN

    >gi|50286103|ref|XP_445480.1| hypothetical protein [Candida glabrata CBS 138]
    MRDSVTLDKTAVKMIGIRSVTVSRISVRGYARVVSMPKVIPMAKAMAKPMAKPMMNTMQNTRWYGIKVEASEGEVPLVEP
    YKVLNKQEDKGLKIAERAAKRLNEIYKESQEVLRVLVESGG
    CHGFQYNMKLVPESTLSLEETGNSESKTQEEVVDEFAEG
    ADSSSKDVIYIVSEEGGKVAIDETSLGILNNTTLNYTTELIGSTFKITDGNLKSSCGCGSSFDIEK

    >gi|50286105|ref|XP_445481.1| hypothetical protein [Candida glabrata CBS 138]
    MAMKVLVLGAGGLGCELLKNLARYDYVSEIHVVDLDTIELSNLNRQFLFREQDIGKYKAEVAAHAIGKRVTDKVIVPHVT
    DLTTLDATFYSQFQFVISGLDAIAPRRYVNQVLVDITRASAFEICIPFIDGGVEGLKGHIKTIIPGINACWECSIDTLPH
    ESAMNNPM
    CTVANNPRSLEHIVEYVVLISNPDADLDDLAVCTQLLDQCRQRASQYGIDCSELTLSKMAGIAKRVIPTVST
    TNSIVAAMCCEQLNCIYRDLWDPESSPNFTTINGAEGMYIFSFQYQRNPECTVCSML

    >gi|50286569|ref|XP_445713.1| hypothetical protein [Candida glabrata CBS 138]
    MLLFRTARCQVPTLGRFATHPRIAPSIAMRFQSSGGYASIKQVKTLEEVQKLMKDSNLSVIDFYATWCGPCKAMVPFLSK
    FVDQYKDVKFYKVDVDESPDVAEYYGVSAMPTFVFTKDDDILHKIRGANPKGLAKAIEEFK

    >gi|50286831|ref|XP_445845.1| hypothetical protein [Candida glabrata CBS 138]
    MLRNTALRGVRWGSTSVNTVGARPPFKFMFQKEAKPSTGNSLRATNGKWSSYKLPTPSATTSIPDIRNDTVKSVTLGIHN
    KESPAAKTMAVPVKERAHEGLKTSNKGKKRRLVPHKQLISLTPAAVAHLRSLCQQPEPKLIRISAKHRG
    CAGLSYDLSYI
    DAPGKFDEVVEQDGVRVVIDSKALFSVVGSEMDWVENRLFSKFVFKNPNSKGTCGCGESFMI

    >gi|50287255|ref|XP_446057.1| hypothetical protein [Candida glabrata CBS 138]
    MFRAVSRRGFSSSSYLAAIKKQHDLVIIGGGPGGYVAAIKAAQLGLDTACIEKRGSLGGTCLNVGCIPSKALLNNSHLYH
    QIKSDTKNRGIDVKGDVEINVEQFQKAKDTVVKQLTGGVEMLFKKYKVNYYKGVGSFESENSVKVTPVEGIKGTVEDETI
    IEAKNIIIATGSEVTPFPGIKIDEERIVSSTGALSLKEVPKRLAVIGGGIIGLEMGSVYSRLGSKVTVLEFQPKIGASMD
    GEVAATSQKFLKKQGFNFKLSTKVVSAERNGDVVDIVVEDTKSGKTENIQADVLLVAVGRRPYIEGLGAEKLGLEVDKRG
    RLVIDEQFSTKHPHIKVIGDVTFGPMLAHKAEEEGIAAVEYIKKGHGHVNYGNIPSVMYTHPEVAWVGKTEEQLTEEGIK
    YKVGKFPFIANSRAKTNMETEGFVKILIDAETERMLGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFK
    EANLAAFDKPINF

    >gi|50287581|ref|XP_446220.1| hypothetical protein [Candida glabrata CBS 138]
    MSTSDESINELLEELEQEDERNDDFIDRYRAQRMQEMHDYFGSIQRKKEEGFGKVNYMDNESQVMKITTSTARVVIHFEL
    ETFKK
    CQYMDEKLEEIARNYLSTKFISISVENAPFLVEKLGIKVLPFVICYLNGNECERIIGFNKMGNDPNGFRTSKLEG
    VLMRAGILERRPQDADRISNLRIANKNTDLVSKLREKNDSDTSDLDI

    >gi|50287947|ref|XP_446402.1| hypothetical protein [Candida glabrata CBS 138]
    MSPEEGLTGRKIIYDEDGKPCRSCNTLLDFKFATGTISKAGSVIPAMAATDNSAEELIPGSKTYKKIDPPDVQQLGASSW
    SLLHSIAAKYPKTPSETQQKEMSQFLNIFSHIYP
    CNWCAADFEKYIRENAPKVSSREELGRWMCDAHNKVNVKLGKPKFN
    CDFWEKRWKDGWDE

    >gi|50288207|ref|XP_446532.1| hypothetical protein [Candida glabrata CBS 138]
    MSIRSIYNGRLPVLLRSARYLHGSRAVLGPAVSNERPTNTVAFKFSFNKPRKETSPVSAKWSSHRMPSKEVLQEQAQVIK
    AKEEEKKVATEKFIKENMIELKEPEAVEKVQDTPTNKATATAKASDSSAPAKKKGKRRILRPRKAVITLSPKAIYHLKAL
    LDEPEPKLIRVGAKNRG
    CSGLTYDLQYITEPGKFDEVVEQDGVKIVIDSKALFSVVGSEMDWVDDKLASKFVFKNPNSKG
    TCGCGESFMV

    >gi|50288295|ref|XP_446576.1| hypothetical protein [Candida glabrata CBS 138]
    MTDYVKEAKDMVANNRLFQFSASWCPDCVYARSIWNKYHVENQIHVFDIGSLDKEIQAKWRDAFEEVLGVRNLPTIVVDG
    KVWGTETRLHEVEDNGSLSDELTKMGFKL

    >gi|50288475|ref|XP_446667.1| hypothetical protein [Candida glabrata CBS 138]
    MRMHAIALLISLIVGVFSITTEELDRLKDEDGIIAVTDANYAQISKGLEDYYNVLFITMRSTNDEGVALCKICLDFEDNY
    RNVVRLFQSQFPDKKVYFFSSDVQETRQIVRDMDLKNVPHAVVYPPKKDGEVYSWAKTPFYKYELVDKEVSNPLHFGSFL
    GKIMEVEITIPQEFDVQEFLTYFVICTAIFVVLKRVVLPIVGNKGLLFSIVLAFGILLPSIAGFKFTQINGIPFIARDGK
    GNIMFFSGGTGWQFGIEVVTVSAMYVAMSIVVTLLVYWKKLCKGNDNANVLGSLFCACLMFFLVHTTLAAIRLNSPSIHL
    NSSAYMSLLNY

    >gi|50288495|ref|XP_446677.1| hypothetical protein [Candida glabrata CBS 138]
    MVAQVQKPAPTFKKTAVIDGVFDEVSLDKYKGKYVVLAFVPLAFTFVCPTEIVAFSEAAKRFEALDAQVLFASTDSEYSL
    LAWTNVPRQDGGLGPVDIPLLADTNHTLSRDYGVLIEEEGIALRGLFIIDPKGIVRHITINDLPVGRNVEEALRLVEGFQ
    WTDKNGTVLPCNWTPGAATIKPTVEDSKEYFKNVK

    >gi|50288575|ref|XP_446717.1| hypothetical protein [Candida glabrata CBS 138]
    MEGGRREIEGRRHFLKRNMVAEITNQDQFTELTTQNVQDKLIAIYFHTSWAEPCKAISELYRAISEDESNKDVSFLAVDA
    DEQAEIAELFEISAVPYFVLIRNGTILKELSGANPKEFLAALEECRRAGTESKSKESNGAVEDDEDSEDSEEETEEEMNM
    RLTKLVNAAPVMLFMKGNPSEPK
    CGFSRQIVGILREHQIRFGFFDILRDDTVRTNLKKFSDWPTFPQLYINGEFQGGLDI
    IKESLEEDPDFFQHTIRVNN

    >gi|50288889|ref|XP_446874.1| hypothetical protein [Candida glabrata CBS 138]
    MVSVKSLALAIGVASAIQLPDAIAPDSSNIIKANISQFATHVKENPIVMVEFFTPWCTHSKMLQPRLSEAATIVKGVKIP
    ILQVDCTQYGVLCDQQMIDFYPTLKVYKNHRLVGAENYKGSQAGNEIANYLLNLKNNPVTNITSAQEVEKMKSETDMPIV
    HNRGNLEIDEILRSVALDMSEKFAFIRDTVASENGTLEMYFPGTNRTAVYDGPQPPTEESISIWMHMENLPFFADIEAAD
    FKNYMATKLPIAYFYYSTPQELNDFTGLFNELGEKYRGKLNFVGMNPHKFQEHLKLLNLKQRFPLFVIHNVNNNLKYTLD
    QFTDESDKVMKKLESEDIKKLVEDFVEGKAQPIIKSEPIPKTQDSVLYKLVAKTHNDFVYNNDKDVFVKYYAPW
    CQHSKA
    FRPVLEEIAELFGSNPETKEKIVFAEVDSTANDIIDFPVAGYPTLVLYRAGSKPGSQPIIFEGKRSLENVLDFIKSHSTS
    NLDGQALLEKQKQDEAKAIEDAQAAEAAEAVNAQAQAANADQKAFNNEIKDEL

    >gi|50289223|ref|XP_447042.1| hypothetical protein [Candida glabrata CBS 138]
    MIVKRLFRTMAPVAKHFDYLVIGGGSGGVASSRRAASYGAKTLLIEGKALGGTCVNVGCVPKKVMWYASDLATRLTHAHE
    YGLAQNVPLSKESITFNWPEFKKKRDAYIHRLNGIYENNLKKEGVEVVFGWAKFNKDGNVEVTKHDNTTEVYSADRILVA
    TGGKPVYPEKVPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSDSHLVIRGKTVLRKFDEIIQNTVTDY
    YVEEGINVHKETNVDKVEKDEKTGKLSVHLTNGQVLEDVDELIWTMGRRSLLGIGLENVGVKLNDKEQIITDEYQNTNVP
    NIYSLGDVSGRVELTPVAIAAGRKLSNRLFGPEQYRNDKLDYTNVPSVVFSHPEAGSIGLTEDEAIKQYGKDNIKVYTSK
    FTAMYYAMLEHKSPTRYKIICEGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEELVTMR

    >gi|50289333|ref|XP_447097.1| hypothetical protein [Candida glabrata CBS 138]
    MKLSYLLLAGIVAGEGNSTNNQTNWTTENHFCAMDKDLMISPSCNVTFTELNVINKSIRKNLVSLVRTDFFKYFKIDPDK
    QCTFWDNNDGL
    CFSRDCMVDVVTDWDSLPEIWQPEVLGGLDEAQDASGSDEKEWTFLDDLCAESQQQSKPKPLLDVDDNN
    YCDINDFSGENAVLVDLTKNPERFTGYGGQQSSQIWTSIYGENCSPLGKDLVKSGKASQDEVSMARDVFFRFVSGLHASI
    GTHLSNDHLNTENGKWEPNLDLFMLRVGNFPDRVTNIYFNYAVIAKSLWKIKPYLSRIEFCNDYDDPVKSKILSIVSKLD
    SSIFNEDLLFQNDLSSSLKNEFRARFKNVTKIMDCVHCDRCKLWGKVQTTGMATSLKILFDLDEADESSKQKFVDKLTKY
    ELIALFNTFDKLSESVEYINNFEKLYKRREGGDSYTNFFQNNFFKILEKMKKGWSTINDSVSNNKEYNNSAQNSESISDP
    SEESMTSLVKDAVEEVKNTTKSSLSDNDEFLTAKLSENNENIEENKLEDKLNEQEAFADLKMPIRKKKLTKKKSNGTLDI
    WINAWHTETHNVMEAIKFILRSYIDLPRNLWRLTIVTVNKLWNNFVGVANYVSEEPGEEIIYDLDFQ

    >gi|50289663|ref|XP_447263.1| hypothetical protein [Candida glabrata CBS 138]
    MDSQSSFYDLSPHDKDNNEFPFSNLKGQVVLIVNVASKCNFTPQYNDLQYLHEKYSYRGLKIIGFPCNQFGQQEPENDEV
    IQKFCLSNYGVSFKILKKIKVNGPNADPVYTYLKNEMPSQIGLKVIRWNFEKFLVDKHGRVRHRYSSLTSPKSLQRTIDQ
    LLDDK

    >gi|50289665|ref|XP_447264.1| hypothetical protein [Candida glabrata CBS 138]
    MSPFHQLRPVDGQGNIYPFEMLKGKVVLIVNTASNCGFTPQYIELENMYQKYKNEGFEILGFPCNQFGHQEPGSDAEIQK
    FCSSKYKVTFPIMKKIDVNGPYEDPVFKYIKEQKPGMLGLKGIKWNFEKFLIDRQGNVVLRASSLTKPSTLNETIEKLLK
    N

    >gi|50289747|ref|XP_447305.1| hypothetical protein [Candida glabrata CBS 138]
    MNHKKVVIIGSGPAAHTAAIYLARAEIKPTMYEGMLANGIAAGGQLTTTTEIENFPGFPDGMTGSELMDRMRAQSTKFGT
    EIITETIAKVDLSSRPFKLWTEFNEDGEPITTDAIVIATGASAKRLHIPGEETYWQQGISA
    CAVCDGAVPIFRNKPLAVI
    GGGDSACEEAQFLTKYGSKVYLIVRKDHLRASTIMQRRAEQNDKIEILYNTVTLEAQGDGKLLNNLRIKNVKTNEETDLP
    VNGLFYAIGHTPATKIVEGQVETDETGYIKTIPGSSLTSVPGVFAAGDVQDSKYRQAITSAGSGCMAGLDAEKYLTELE

    >gi|50289755|ref|XP_447309.1| hypothetical protein [Candida glabrata CBS 138]
    MTDQDLLAQIELLKKENAQLKEKLKSQDDEQLSLEEYSRYGRQMIVEGTGGVVGQLRLKKAKVLVVGAGGLGSPSLPYLV
    GAGVGTIGIVDNDIVDTSNLHRQTIHNTAKVGMLKCESAKQVLKDLNPHVNINTYPVRLGPENAFSIFADYDIVMDCTDT
    PLTRYLISDVAVNLGKTVVSASGLGTEGQLTILNFNNIGPCYRCFYPVSPNPYAVSS
    CQEGGVIGPCIGLVGTMMAVETL
    KIIMGVYNNENFEPFLLSYSGFPIQSLRRFKMRGRQSKCQTCGDAPVITKEAIESGIIDYNIFCGSRNYNVCAEGERLTA
    KEFDENYGPEFSGNNKVLLDVRPSHHFDISHFNNAVNIPLKELRDMDGDISTLQSRIPNINKNSEVVVL
    CRYGNDSQLAT
    RMLKDEFGITNVKDVAGGFFKYIDDVDQSIPKY

    >gi|50290031|ref|XP_447447.1| hypothetical protein [Candida glabrata CBS 138]
    MLTGVLFTILYFLSHFSGPSSADSAFRQVGPGSRNSKGGGNLGPPIMEAEMNGNTNNIEKAEAGNKAMDTTSNSGTSNEN
    AQLPGSKDQTDSNSNSLSNKEGQEDAEEAADAEYSPAKEFQKLVKSAPIVIFSKSY
    CPFSKNLKKLLDKNYRLDPAYVAV
    EVDQHPNGDKLYSYIKKLTGRNTVPNLIANGDSKGGFDDMLALHNSNELESKLIEWGVGELQVSKV

    >gi|50290311|ref|XP_447587.1| hypothetical protein [Candida glabrata CBS 138]
    MRFSLILAVLAVAFAEIIPIESIDQFYDLANKDGTYTVVKYYTEWCSHCKKLKSVYKELDEQLSSESNLNAPIQFVEVDC
    DTYGSTICKRLPGYPIVEVVKPPTLDANTTVTDTPTLFERVKRAIFGENTWTISDDRIVRFEGSRSVNPLQGFITMVVNK
    DVMKRQLMDIIEGRPIEAQDKVLNAIKEYYNELEHNNLVHERARLERILKTNDDGQLDIVKGQLELINLLETTNEIVDEL


    >gi|50290725|ref|XP_447795.1| hypothetical protein [Candida glabrata CBS 138]
    MLYSYLWSFMWLLAIACARPPPKVDERNDKPPRGFPLPLNKKNFEVELSNGFHLVEFYSPYCSHCKNLAPIWEDTWVSFR
    EEGKKLNMKLSQVNCVESGDICHKEDIRAYPTIRLYGPDGFLEEYHGKRTKEEFLKFARKSIMEYGDTDDLILPSLSKLL
    SGKDFSQLISGKSTKPMLVSFWPTSDMQEDSSVETKFNNCPKCEIYQRKWNLINNAVDGLGVDSGHLNCGSEQNLCERLG
    FADLASSAKSGGNVKPRLALIIPKKVTNNLFIYPEGQDVSNQADVLDFIKRISVNSEAAEISESEIIDYSRNSMPLFSEF
    VHTNAKKVHSGQNIYIIFCYNHKTVVPEDFTILEHLVEPLASRPNTYLRKFNGTIPELTKKVYDPFYQVVNYNDSEPRKE
    LNEEFQTMAAVTEYPTFLIIKEGELQTHVFNGFSTTEMRNLDTILDWIDDTIVPSLPKLTWDNFEEMLNVNPSKYRTMAI
    LLMSTKWEYDDKVNAAQKFFTSFLDYEHVRMQKMFEIVQQERLKKANAIEKMREKQENTKNILAKMRQEISHPNDRKVQY
    MYLDLAKDERLLKRLGVHNANIAPNQVLLIDKARKTLYAENHFEERLTGKDTYGIREALLSINIPEKCQLSTILRAQHLK
    IKLQKKIKIPHVKVSNGSNSNILYFFAILLLLVLLRKSPVYRMVSRKWHSHRASYQANTSYSKLEAQD

    >gi|50291295|ref|XP_448080.1| hypothetical protein [Candida glabrata CBS 138]
    MQMFNFSRLVALLLVLVNVSLALSPKQFNKERLKYKDSIIDLNDRNWGRLLANPKESYLVTVFTATGRQYGCTMCTELAE
    HYETVVRSWFADHPDGISKNDGSKSLFFAKVDAVDQNVPELFQKFNVEQVPRIIIYEPGKGDPQYKFLDIQLSGENVVET
    LIAGIKESTDVQDFEIHEEINWSSVTITGVATFATVLLVKKQSTLALKIFTSRYVWGFGTIFFIIAMLGGHMFNRIRNTP
    EAGMDKLKNVIYILPGQISGQYAIETQIVGLLYAVLCALIVALVMVVPNVSKKLSGPENAKETAQVIVTILTAVFIYMFF
    AAFTKVFEVKYTGYPYTLLKLFNFFGK

    >gi|50291403|ref|XP_448134.1| hypothetical protein [Candida glabrata CBS 138]
    MEDLLYSFVVTDITSALVFVRRQTDALVYASLGLNKKQLLKGARTAFNQLSKKSAIHYNFKQIEVESEQEHVEKFQDTVN
    KFTKLLEGHIVKDLHYEYMFGTSLQHRIWDELVKIPHGKVTTYKEIADKLKIKNGSRAIGSGIGSNNIAIVIP
    CHRVVCS
    NGTLSGYKWSTSLKRKLLEREHVYASNKKDALNKDTKISLMKYKYSA

    >gi|50291611|ref|XP_448238.1| hypothetical protein [Candida glabrata CBS 138]
    MSKETGEIDESLYSRQLYVLGKEAMLKMQLSNVLIVGLRGLGVEIAKNVALAGVKSLTLFDPEKAVLQDLSTQFFLSESD
    IGRRRDEVTRGKLAELNSYVPVKTLESLNDDDLKQFQVVVATETVSLEDKIKMNNICHNSGVKFIATETRGLFGQAFVDL
    GDEFSVIDQTGEEPRTGIVSDIEPDGTVTMLDDSRHGLEDGNYVKFSEVQGLEKLNDGTLYKVEVLGPFAFRIGSVKDLG
    EYKKGGIFTEVKVPKTLSFKTLQESLSEPEYVFSDFAKFDRVGQLHLGFQALHQFALKHQGELPRTLNDEDANEVLKLVT
    DLAAQNPNVLGSEDAEINEKLIRELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQYMYFDSLESLPDPKQYPRT
    AENTAPINTRYDNQIAVFGIDFQRKLANSKVFLVGSGAIGCEMLKNWALMGLGSGPDGRIIVTDNDSIEKSNLNRQFLFR
    PKDVGHDKSDVAARAVSSMNPDLEGKITPMTDKVGPDTENIFDDAFWEGLDFVTNALDNIDARTYVDRRCVFYRKPLLES
    GTLGTKGNTQVIIPRLSESYSSSRDPPEKSIPL
    CTLRSFPNKIDHTIAWAKSLFQGYFADAAENVNLYLNQQDYVQQLMK
    QSGDVKGTLESIAESLNNKPNNFDDCIAWARLEFEKKFNHDIKQLLYNFPADAKTSTGEPFWSGSKRAPTPLVFDVNEPD
    HFHFIVGAANLRAFNYGIKGDDGEPDVNYYNSVLTHVDVPEFSPNKNLQIQVNDEDPDPNAGSQNDNLDQLAASLPDPKT
    LNGFQLAPVEFEKDDDTNHHIEFIAACSNCRALNYSIEVADRQKTKFIAGRIIPAIATTTGLVTGLVNLELYKVVDGKDD
    IEVYRNGFVNLALPFFGFSEPISSPKGKYNDKTYDKIWDRFDINGDIKLSDLIDHFEKVEGLEITMLSYGVSLLYASFFP
    PKKLKERLNLPITELVKLVTKKDLSSHLKTMILEICADDKEGEDVEVPYVTIHL

    >gi|50291653|ref|XP_448259.1| hypothetical protein [Candida glabrata CBS 138]
    MVKQITSVSEFDSAIAVDKLVVVDFFATWCGPCKMIAPMIEKFAAEYSTADFYKLDVDELPEVAQKNEVSAMPTLVLFKN
    GKEVAKVVGANPAAIKQAIANNV

    >gi|50292055|ref|XP_448460.1| hypothetical protein [Candida glabrata CBS 138]
    MAKRIGRFHGSHIVRAIAALTLVGLVWYFFNTDSSMSVSAPMAGRLRDTVEPVSNVEKSGSGVSQEDKMKAIDDATIMPL
    MEDKQAKVELGRASWKYFHTLLARFPDKPTKEERQKLKTFLELYAELYP
    CGECAYHFVKLMDKYPPQTSSRTAAALWGCH
    VHNIVNEYLKKPEYDCSTILEDYDCGCGDTSVKNNKVTVEKEGRQHG

    >gi|302309828|ref|XP_002999578.1| hypothetical protein [Candida glabrata CBS 138]
    MISIDFSNLIVIIAVLLLTRYISQKFYSSLGNKMVSQDTVNSVKNMIGQKKIFVASKSYCPYCRAAKQTLFEELKVPMDK
    AVVLELDEIEEGSDIQQALAEINGQNTVPNIYIDGQHIGGNSDLQKLKQTGKLQPLLQKVLA

    >gi|50292125|ref|XP_448495.1| hypothetical protein [Candida glabrata CBS 138]
    MVAQVQKPAPTFKKTAVIDGMFEEVSLDKYKGKYVVLAFVPLAFTFVCPTEIVAFSEAAKRFEALDAQVLFASTDSEYSL
    LAWTNVARKDGGLGPVDIPLLADTNHKLSRDYGVLIEDEGIALRGLFIIDPKGIVRHITINDLPVGRNVEESLRLVEGFQ
    WTDKNGTVLPCNWTPGSATIKPTVEDSKEYFKEANSKN

    >gi|50292365|ref|XP_448615.1| hypothetical protein [Candida glabrata CBS 138]
    MSLFKLITPCAFVELTKASKKVVPVDSTWYLPNLKRDGKQEFMDVERIPGAVYFDIDDIRDSASEFPHMAPDLATFNEGM
    SQLGVNKEDILVVYDRIGNFSAPRCAWTLVMLGHPEVYLLNNFNAYKKEGYPLDTTKWTKLTQYPKSNYKSETNLCPENV
    ITYEQMLELVKSGELKKKYNVYDARALNRFEGKAPEPRPDISSGHVAGVQPLPFTEILDQPDLTFPQEQVDMEKKVQEAF
    KKLNNTYDPSKPTIVM
    CGTGVSACIIRTALEHSGVKDIKLYDGSWVEWVLRSDPKLIAKDRE

    >gi|50292777|ref|XP_448821.1| hypothetical protein [Candida glabrata CBS 138]
    MLSSDPYDPMEDAYETSGNIPDYAHDELYHNSENKSWGQVVPGKVGLYDPDYEHDACGVGFVANVNGLQSHKIVSDARSL
    LCNMTHRGAVSSDGNGDGAGILVGIPHGFIKREFKLDLGIEVPERGQYAVGNVFFKKDDSDDETLSEKSKAEIRVMQQKF
    EDTARNFNLNVVGWRNVPHDSSILGDVALSREPVILQTLVVPLDSNELVEFNETVFKTNLYLFRKFITKQFKPEDCFYVC
    SLSNSTIVYKGQLTPNQVYNYYHDLTNAHFESHMALVHSRFSTNTFPSWDRAQPLRWVAHNGEINTLRGNKNWMRSREGV
    MVSETFKDKLDSLYPIIEEGGSDSAALDNVLELLTINGTLSLPEAIMMMVPEAYHSDMDSDLKAWYDWAACLMEPWDGPA
    LLTFTDGRYCGAILDRNGLRPCRYYVTSDDRVICASEVGVIPIDNSLVLQKGKLKPGDVFLVDTQQGQIVDTKKLKSDFS
    KREDFKSWLSKVIKLEDLLQKTENCEPEDFVLNAPSLKVQSDPRLLAHGYTFEQFSMLLTPMALTGKEALGSMGNDAPLA
    CLNQDPVLLYEYFRQLFAQVTNPPIDPIREANVMSLDCYVGPQGNLLEMHPSQCERLLLKSPILKWNEFKAIQNIEKVNP
    SWSVANIDITFEKSEGIEGYINAVERITKDASIAIEEGKKILIISDRRMGEHRVALSSLLAVSSIHHHLIRNKQRTEVAL
    ILETGEAREIHHFCVLLGYGCDGIFPYLAMETLIRMNREGLVRNVNNDDHDLTDQELVENYKHAIDSGILKVMSKMGIST
    LASYKGAQIFEALGIDSSVIDLCFTGTSSRIKGVTFEYIAQDAFSFHEKGYPSRMTITRSVNLPETGEYHWRDGGYKHVN
    DPTAIAALQDSVRHKNDDAWSLYVKKEMEAIKDCTLRGLLELDFENSTPIPIEQVEPWTEIARRFASGAMSYGSISMEAH
    STLAIAMNRLGAKSNCGEGGEDAERSLVHPNGDTMRSAIKQVASARFGVTSHYLSDADEIQIKIAQGAKPGEGGELPAHK
    VSKSIAKTRHSTPNVGLISPPPHHDIYSIEDLKQLVYDLKCANPRAGVSVKLVSEVGVGIVASGVAKAKADHILISGHDG
    GTGASRWTSIKYAGLPWELGLAETHQTLVLNDLRRNVVVQTDGQLRTGFDIAVAVLLGAESFTLATIPLIVMGCVMLRRC
    HTNTCAVGIATQDPYLRSKFKGQPEHVINFFYYLIQDLRQIMARLGFRTIDEMVGHSEKLRRRADANPKVINIDLTPILT
    PAHTIRPGVATRFTKKQDHKLHTRLDNKLIDEAEVTLDKGLPVNIDANIVNTDRALGSTLSYRVSKRFGENGLPRDTIVA
    NINGSAGQSFGAFLASGITFILDGDANDYVGKGLSGGIIVVRPPKNSKFKSDENVIVGNTCFYGATSGTAFIAGSAGERF
    AVRNSGATIVVERVKGNNAFEYMTGGRALVLSQLESINAFSGATGGIAYCLTSDYDAFLSKINKETIELEHLEDPVEIAY
    VKNLIQEHYNFTKSELASNILGNFNHYLKKFVKVIPSDYKKVLLKEAEEKAKEKENATAEYLKKLGSPAEPGLDATNGEV
    AKMQAAKRQAISRAVISNKSTLHEPKVLDLEEAVPDAKQMEKNAEKVVKMNGFMKYNVRHEGHRDPATRTKDWKEFTKPV
    SKRDAKYQTARCMDCGTPFCQSDTGCPLSNIIPKFNELVFKNQWKLALDKLLETNNFPEFTGRVCPAPCEGACTLGIIED
    PVGIKSIERIIIDNGFKEGWIIPTPPSTRTGRRVAIIGSGPAGMACADMLNRAGHSVTVFERADR
    CGGLLMYGIPNMKLD
    KSIVQRRLDLLSAEGIEFVTNTEIGKDITVDELKSNYDSVVYAIGSTIPRDLPIKGRELKNIDYAMNLLTENTKALLSND
    LETIRKQIEGKRVLVIGGGDTGNDCLGTSVRHGAKSVVNFELLPQPPNERAKDNPWPQWPRIMRVDYGHAEVKEHYGRDP
    REYCILSKEFIGDEEGNVTGIKTARVEWKKSQSGVWQMVEVPNSEELYEADIVLLSMGFVGPELLNNDTNIKKTRRGTIE
    TLSHSSYNIDGGKMFAAGDCRRGQSLIVWAIQEGRKCAAAVDEFLMGDTYLPGSGGIVKRDYRLLEELAATV

    >gi|50293755|ref|XP_449289.1| hypothetical protein [Candida glabrata CBS 138]
    MSVVDIDNVEQFLDLARTKAGNKLVVLFFYMPWMKSCRVLKEVVLALSRSVGKKHSTFLQINIEGNRDIVSLLGITQVPA
    FFLVRKGVVIKALSGVDPREFLAAYHECVDNSNCYDHDLDEDSQDIKSDDTLQEPEDFYSEDTESLDKLVNAAPVMVFIK
    GSPSDPK
    CGFSRQMVNILRSHQIRFGFFDILKDKITRQQLKDYSDWPTFPQLYINGEFEGGLDIVKESLLEDPDFFNKKL
    SL

    >gi|50294005|ref|XP_449414.1| hypothetical protein [Candida glabrata CBS 138]
    MAVRESNLVKILGDEGYQKLRSTKCLLVGAGGIGSELLKDLVLMEVGEIHVVDLDTIDLSNLNRQFLFRQKDIKKPKSAI
    AVNAVQSFSNSKLVPYQDNIMDTNVFPLHWFQQFDIIFNALDNLAARRYVNKMTQFLSIPLLESGTSGFDGYIQPIIPGK
    TECFDCTKKETPKTFPV
    CTIRSTPSLPVHCIVWAKNFLFGQLFSSSANDIANEQMNEQDWGTDDVEEINRIKNETNELKE
    LQNIIISGDKSRIRDIISKLFIQDIEKLLLIENLWKTRAKPVALTPKQLQESEQLGDVNHLNLNEIWDLETQIAKFTQIT
    SKLMDRYNTESAIDFDKDDQDTLEFVATAANIRAHIFHIPVKSVFDIKQIAGNIIPAIATTNAIIAGLSSLMSLRVLNLL
    KYAKVDKPTDINMAFTAKASNLAQNRYLSNPKLVSPNKKCAVCSKVIRGVFKVTKNQMEKHSFMDFINALTSTSKLSDDI
    SILDATTQRLLYDYDFEDLAEKKLVDLSLKNGSVLLITDEEEEAGLTKQIMEYYIEISDESEDKIEQLSLPQIIPQFSIP
    SETADENGGGDMLQNDSLMTSNDQTTPIVVSESDAVENGNNKRPLTEELEYQSIKSRKLNPIEDDDELVILD

    >gi|50294279|ref|XP_449551.1| hypothetical protein [Candida glabrata CBS 138]
    MWKRIVDAWNGNATSPSTPGVNTYDFEGMKKVAMQHDPSTVLVDVREPSEFSVVHIPGSINVPYRSHPEGFSLDPVTFKQ
    TFGYEKPPVSNHLIFY
    CASGRRGSMAREVAAKNGYTNLSEYPGSMNDWVAKGGDRLAL

    >gi|50294281|ref|XP_449552.1| hypothetical protein [Candida glabrata CBS 138]
    MFKRVVSISRGRVSPIRLVGLNRSANMIRYLSTNGPKAYNFEDIKQLVQHPDPKKVLVDVREPEELKECKLPNSINIPLK
    SAPGALGLPEEEFQELFHIEKPPKDKELIFF
    CALGVRAKTSEELARSYGYESTGVWEGSMKEWKEKGGDKIKV

    >gi|50294285|ref|XP_449554.1| hypothetical protein [Candida glabrata CBS 138]
    MKVYLLTLLVYIASVFAQDQSFYKDDPNIIELTPSNFDRVVHNTNYTTLVEFYAPWCGYCKQLKNTIHSLGKASDSIFQV
    AAVNCDKASNKQLCGEYGVEGFPTLKVFKPGKAGKTAVKKHASETYMGERKLAPLINFIKAKIKNHVKKLTSADMVSKLV
    NSQSSNKYAVVLFSKQSSIPVTYKSIAIDWLDRVKFYCYLNTKKTLVESLKSFESESAEIIGPLVDRIGKLSAGKDKSLL
    VLIDKENQKISVLEDKITKSNVAKFIIDNTSLKPKEGPYSKRDDYLAKLKLNKKKKTQVQNDEL

    >gi|50294506|ref|XP_449664.1| hypothetical protein [Candida glabrata CBS 138]
    MFATRLLGKSALLGTTSTRMVFRSQMARYMSTETKKAIEGAIASAPVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKF
    AAYNVLEDPELREGIKEFSNWPTIPQLYVNKEFIGGCDVITSMARSGELADVLEEANALVPEEKEEGTD

    >gi|50294878|ref|XP_449850.1| hypothetical protein [Candida glabrata CBS 138]
    MAAPQVNEKFDVKDIKFQYIDFDQSVSHDACAMPSTTSWSDFLAKNKTVVITGAPAAFSPTCSISHIPGYISKLSDLEAK
    GVDQVVVVTVDNPFANEAWAKNLGVQNTKHIKFATDAGAELVRHLGYELKVGEGVYWSGRWTVIVKDGVVVYAGNESNPA
    SDVTVSSVEEALKHL