Candida dubliniensis CD36 uid38659

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|241947997|ref|XP_002416721.1| stress-induced cytoplasmic glutaredoxin, thioltransferase, gl
    MFRTLLTKRLFNTSIMVSSQVKNKVEELIKTKPVFIASKSYCPYCHATKNTIEAITKDAYILELDEIDDGAEIQEALLEI
    TGQRTVPNVFIGGQHIGGNSDVQALKSSDKLDDKIKAAL

    >gi|241948105|ref|XP_002416775.1| methionine sulfoxide, putative [Candida dubliniensis CD36]
    MFKSPAFRTFVRNMSKSDSEWRAILSPEQFRVLRQGGTEAPYTGEYTNTPASDIGYYECAGCKFPLYKANTKFKAHCGWP
    AFYEALPGAIKIYRDESHGMIREEMRCSNCDGHLGHVFKGEGYKTPTDERH
    CVNSVSIKFNPQDPQT

    >gi|241948151|ref|XP_002416798.1| HSP70 interacting protein/thioredoxin chimera, putative [Candida dubliniensis CD36]
    MPIKFVKSIIDFEGYLKNNRLLVLNFTASWCGPCKAIKHVVDQAYGQFQGVEIVRIDLDSQRELASKYSITSVPTFVFIE
    TGKEVDRIQGANPQALISKLQEFNTKANGQKRRGNGTTTEELITQNSSLKDIKPLIPENFEVLNATIDFSGYEVLNCLPL
    YKDSKAKHVVSLGGTDASADKSAVISDSDSQLLFYIPFLNISKIYSILVKVKSTKTYKEVEENTLNVDSDDLDEIQPPNL
    IKVWCNTQSILSFDEASADANAPHVEKLSNNDEDQWFNIKFKFVRFQNVQNLTIFVDGEDEDYHTVIEKIVIVGVNSKSE
    EQ

    >gi|241948915|ref|XP_002417180.1| peroxiredoxin PRDX5, putative [Candida dubliniensis CD36]
    MFAFTRTVPRSQLSLAVRNSLRTYVSIGDKVPATPVFEGSPGNDVNLAEETATGKTILIGVPGAFSPACSSSHVPGYIKN
    IRAFNDKGYQRFFVVAVNDPFVTKAWGEQLLESVAGQQIRFFADSTGAFTKELDLLFDARKAFGNERSKRYALIIEDGKV
    VKSFVEPDNTSVDVSAAQKVLEEA

    >gi|241949241|ref|XP_002417343.1| glutathione peroxidase, putative [Candida dubliniensis CD36]
    MGNESLSNARIYTFKIPDAYNNVIDFNQFQNKVILIVNVASLCGFTPQYKELQSLYEKYHEPGLEILGFPCNQFGNQEPL
    QEKEIVKYCSRNFGVSFPIMKKTKVNIDSDGDESELYKYLKSEKPGQVGFKGVRWNFEKFIINKKGEVVARFSSLITPLQ
    LEGFIEQLLSE

    >gi|241949291|ref|XP_002417368.1| monothiol glutaredoxin, mitochondrial precursor, putative [Candida dubliniensis CD36]
    MFRRSLLSTTKFINKSTNLLSKGNFHGNFQQYRFISTELKDALDKAIITSPVVLFMKGTPEFPQCGFSKATIQILGQQGV
    NPEKFAAYNVLEDSELREGIKEYSSWPTIPQLYINGEFIGGCDIITTMAQNGELAELLEESNALIPEEENEESIQEDDSS
    NTVQSANIKPNRD

    >gi|241949363|ref|XP_002417404.1| ubiquitin-activating enzyme E1-like, putative [Candida dubliniensis CD36]
    MSKDIYLKKILGEECVSRIRNSKILMVGAGGIGCELLKDLVLIGYGEIHIVDLDTVTLSNLNRQFLFRQKDIDKSKSFTI
    ANAVQSFNYLGVKLIPHHGNVMDTKQFPIEWWEQFNYIFNALDNLEARRYVNKMALFLRKPLMESGTTGYAGQIQPIYPY
    YSECFDCHPKETPKSFPV
    CTIRSTPSQPVHCITWAKEFLFRQLFDENDNSNSMNDTNQIRNETDDKEELENLNKEANELI
    ELRSKILSSDSNSFINELLEKIFKVDIERLLNIETLWKTRKKPIPLDMTEYRDALQQLLEQESSSSILTADTKVWTILEN
    IYSLYKSSKSIQKRLKSGNEPFITFDKDDEDTLIFVAAASNLRSFSFGISMKSKFDIKEIAGNIIPAIATTNAIIAGFSS
    LSGTQFFQHQKDLSSSDFSNIFKRASSVFISIRPNKYITGDKLSKPAENCASDSLTARGVVTISIDDLTVLTLDGFIDKL
    ADSYGYIKKDISIQIGKSKLIYDIDFDDYLQTKLKDVPGVANGEIMLIQDDADELENLELYLNIKDDTVEFRLPALELRP
    KKVTSQINHHEESNGEYAKELEGGTILLDDDDDESFGDEIEILDDNDNEGEEEDKLVEPPVKKRKL

    >gi|241949589|ref|XP_002417517.1| Cu-transporting ATPase type-1, putative [Candida dubliniensis CD36]
    MQKIIINFANIHCDKCEGIIRKVLSRYYKIREETNLNANLKASEVIFKLENNEVTLYGNDLIDFQGDMKRLIKSLGKAGF
    DILSWDLYNGDETVSSSQMVNTNIQGADEPDGFIDIVGMYHKFINSRNKKKHLNYCKVCQESQQHKKKSMDSDYASSSEA
    TVVEIPHQEFRASFLVTGMT
    CASCAQSITDNLRSILGESKNEDEPNFSVNVIQQSVVVIIPNKQIINKIVDAINDMGFDC
    KLIEVLPVQRSVNTKVTALIGGMTCAACANSIDSAVKELPFILESGINVVTKAAQFVLEDDGGSNIAKLKETIEDCGFDF
    ELLSTEKVNYTSGKQKPRSINLKVNGMFCNHCPDIITQYLTNYGDAVVINDPISLDHPVIKFTYVPSQTLKTRKILFDLN
    HLKDDGNGGYIITPDEKGAFECEIIKPVTVDEHVRKLAHREVVGLAIRLTIATLFAIPTFIFGIVAMSLLPKHHSFRVWV
    EDPIWVGNVSRNSWILFILATPVYFFAADTFHRKAIKEIKSLWFHKNSFKSRLLKFGSMNLLMSLGTTVAYFASIVLIGL
    SASQKPKTHHGLHTTYFDSVVFLSFFLLIGKLLQSYSKSKTADAISELSKLKQTEATLIEDDKDTRVDIQLLEIGDQIRI
    GTGESPPVDCVLVEGSTEFDESALTGESTPVKHQEGHQIFSGTVNIGNSSVVGKVTSLEGDSLLNQIVNTVRDGQMRKAP
    MERTADLITGYFVPLIISCAVITWVIWLALGYSGALPQSYLDIDVGGWTVWSLEFAIAVFVVACPCGIGLAAPTALFVGS
    GLAAKNGILAKGGGVAFQDGANVNIVCFDKTGTLTKGELTITDFHFPDKNIVARTFALQAARDLEVPSHHPLGKAVKSFI
    AGYDRNSLTANKIPQVETVPGKGLKGQIIYDEGDDIWNEYKPTQAILGNEKLMEENNIEFTEKERQWLDKWKGECKSVIL
    VGLQCESYFKDSKFHLVFIMAARDQLRPETKKVIEFLKHKDIECWMITGDNKLTADAIAKEIGIENVVSEVLPDEKEAQI
    KKIRQLKSSGKKEPVIAMIGDGINDAPALASADVGIALSSGADLAVTSSDFILLNKIHPLVSLATLLDICSKVFQRVKLN
    FGWSLVYNLIALPIAAGVIYPYKNSRLDPVWASAAMALSSVSVVLSSLALKLYKPSLKAEDFGIGNNTESELSPNEV

    >gi|241949731|ref|XP_002417588.1| endoplasmic oxidoreductase protein 1, putative; endoplasmic oxidoreductin 1 precursor, putative [Candida dubliniensis CD36]
    MKFFRLISLLIAQFIINTTIAVSPVSAILPKSSFTPFDSPEFCSQIITSTCNTTFTYIDELNKEIRPYLSELVKTSYFRY
    FKVNLDKQCRFWNAQHF
    CASENCAVEILEDFNWSQVTNDNLKPSGLGKISLPDKSSIDNPIETEEVQTCEDLDYSEIDDD
    HHCVYVNLVNNPERFTGYGGNQSFDVWKAIYSENCFPNTNPMSMTNNDDGGEQCIEKNLFYRLVSGMHASIAVHLSREYL
    NSETGEFYPNLKVFMERVGMHNDRLSNIYFNYALVSQAIVKLSEILPLREFIQSGYDDITPAQKQHLLANNDVESVEVYD
    RLLLDDIIPSLESNVVFNTTNLFDNTNLKDEFRSRFRNISAIMDCVGCDRCRMWGKIQTIGYGTALKILFEDDNYDNHNL
    KFRRIEIVALINTFDRLSKSIESINMFKEMYLQHLKDVAEGLTQPGVYDNIQNKKPGNGFAFPFVSPLPQKKIDPTNSQK
    NQPQSTDKKRLTLEEIAHTKPEDRTFIEDFRLSFNEVWQALKFVLTSYQRFPEVLGRFTLVQLNEWWNKLLGKPTVYEYE
    SAIDVDAQQYTQVIG

    >gi|241949853|ref|XP_002417649.1| conserved hypothetical protein [Candida dubliniensis CD36]
    MLKTSIRTLKRMTNSKLIELPKSSSFTQRIKPDKRVPSVEVALENDGNITNTPRNINHGGFTWVLPTPRDDYEFIIANPS
    AMKDLGLSLDEMEDPVFQSIVSGEFYQDKVTFAKENFPMPYAQAYAGWQFGQFAGQLGDGRVANLFEVPKAVPDGENRDK
    YEIQLKGAGKTPFSRFADGKAVLRSSIREYIISEHLHAIGIPTTRALSLTYLPSTLAQRHGAERCAIVARFAESWIRMGT
    FDLYRWRGDREGIRDLSDYVIDELFTINGVKFQNFERIVSTGPDFFKSTDKSLGELTDYDKMYYETVVRNAETTAICQSY
    GFLNGVLNTDNTSILGLTIDFGPFSIMDKYNPNYTPNSEDHEGRYGYRNVPTAIWWNLTRLGEDLAELVGAGNDLLKDPS
    FKQGIKEEWEDSIIKRATKIIEIGGEIYQHAFTKKYVETFFNRLGISHQLIDAQNPEIQRTDVIVPMLDVLFKIQTDFNL
    FFLKLQSLDLESGDYASIAEKEFLPDYDFNTYRQHKDDLIKQISEWLISYHELRNKTKQYESTPDPAKYNPKFLPRNWIL
    DQVIQQAESSRGAETTYLEKLQKMSSNPYDETKWGDELKELEQSWLLQGNKGDQYAMLQCG
    CSS

    >gi|241949891|ref|XP_002417668.1| MPT synthase sulfurylase, putative; molybdenum cofactor synth
    MSEPSKEELLAKIAQLEFENNQLKQQQHGLKSKNEQFCKIDENFSLDEYKRYGRQMIVPQFGSLESQIKLKNSKVLVVGA
    GGLGSPALLYLSSAGIGTIGIIDHDTVDTSNLHRQVIHNTEMVGEFKCISAQNYIKKLNPHVIVDVYPTTLSNDNAFDII
    SQYDLVLDCTDHPAVRYLINDVCVLLGKTIVSGSGLKSDGQLTVLNFANSGPCYRCFYPQPPSPASVTS
    CSDGGVIGPAI
    GLVGVAMAVETIKIITGYYTKDNFVPFLTSYSGYPQQQLRAFKMRKRQKDCAVCGENPQISRRIIEDGTINYKTFCGRVT
    FDPIDDKFRISPKDYDRVVQNKQRHILLDVRPREQFQITHLPNAINVQWDPVFRKADTIQQYLPEDSTKDNEIYVV
    CRFG
    NDSQLAAKKLLDLGYSNVRDIIGGLDKWSDDVDSKIPKY

    >gi|241950695|ref|XP_002418070.1| peptide met(o) reductase; peptide methionine sulfoxide reductase; protein-methionine-s-oxide reductase [Candida dubliniensis CD36]
    MVSTISPTILKTPTSKLINLSAGCFWGVENVFRKQFTNKGLVDIKVGYANGKPSISNVTYEKVCTGTTNYAETVQISYEP
    SQLKLAEILDIFFKMHDPTTVNSQGPDVGTQYRSAIFTFDDEDKSLALKIRDQFQKEWYPNHKIATTIESIYNWYDAEDY
    HQNYLTKNSGGYECPTHFIRTKPKI

    >gi|241952244|ref|XP_002418844.1| protein disulfide-isomerase precursor, putative [Candida dubliniensis CD36]
    MKLSILSSLAFLTTTTAAAVVAGSEANPLVADQVTNDEPKRQSDAGSNSQPKMDVPPTLSMKEFDKLTQEKLVLVEFFSP
    Y
    CHHCKEFAPTWKETYIKFITEYPDLNIEMKQVNCIESGDLCERENIDFYPNILLYAPAVDKNGKKTGKSKNIDSYPRNL
    DRNVENIIKYLREATAEYDSGAINLPSSSQLLDVDTMSKIMEGNISTPMFVSFFPATAKQWESIEHRGRLGFSNCEDCLP
    AKQIWDRLSNKVLSISDTGHFMCRDHREVCDKLKITTNSEPQFIMFLPESIGAIRFDYNDYVDVNRMKWWVQKLFQNSQF
    EVVSARGITEVMEYTKVLSHEPIAQFYPLKSKVTVVFYYDVDKVTKEDEEILPHLLKTIQESPFNIQLHKGKHKKIEENV
    LTMGQNLIDYINYDENDKYEFDKSLQVITTLTTKPTILVFKDNSLLADVYQSLSPEDMKTYDKVESFINSIQYPLYGQLT
    PQLASYYFKKNEKYQDHKVVVLFTDLQDLKGTDNQLYKLSLAAHEYHHLKQKYYFDKFKQSNQGNAAAVEKLQEQNQETI
    DALKELRQVIPEIWENDQVLFTFIDLPNAYKQFRGVKGWKLNPNNYQVGDVVVLSKDNRYYWNKDTQGNKLTNEPKVLKN
    VLMSLLAKDDQLKAAIVGSPYGGVLGFMDYVHDYGVFGYIGFFLSIYIVGFLALRLGRRSSRRWLFKRPSSSTPSSGGII
    GNNNFMPKKD

    >gi|241952310|ref|XP_002418877.1| thiosulfate sulfurtransferase, putative [Candida dubliniensis CD36]
    MSKSFLTTITPSAYRVLLSTSNPTKRVIPIDATWFMPNDPKNAKQEFIKERIPGSKFFDLDYYIDKNSLYPHMLPKDLSI
    IEQIYSNLNLNLNDSLVIYDKLGIFSSPRIAWTFSLFGHNKVYLLDNYLNYKQSQYPLDKNPPPPEQLSPPQAPQQLSPE
    NQNDNDIVKLDAKQFKQNYKQQVIEYEELLQLIENKNLKDYLLLDARSLNRFIGKINEPRPGLSSGHIPGAINLPFNSLL
    KNNSTKQFKSKQEIINIFQTLLNNHNNNHNHNNHNNHNNNNNRFDDLIERKIYPKGIIVM
    CGTGVTAVILKFAIECILKL
    NLPVRVYDGSWTEWASRAPSEYIQKDV

    >gi|241952541|ref|XP_002418992.1| nuclear thiol peroxidase, putative; peroxiredoxin, putative; thioredoxin peroxidase, putative [Candida dubliniensis CD36]
    MPELRRSARVAARPTKEPEAAVEQPPTKKAKTTSTNTAKPNAGLEIGEKIPEITLLNQDGKEINLAEVAKGSKYVVIFAF
    PRASTSG
    CARQVSGFRKLDKDYKDVAIFGVSSDSIKAQKTFQTKQSAEYDLLSDPEKKLIGALGAKKHPSGIIRSHWIFV
    DGVLKVKQIQVSPEVSFTSAEEEIKKFINENENSKEATENDTIKEELKEEPQQDNSKEVNDDNTKQTDEKATESAQDEVK
    NVSEESKGLVEKSTEEPKTEAPAI

    >gi|241952657|ref|XP_002419050.1| protein disulfide-isomerase precursor, putative [Candida dubliniensis CD36]
    MKLLSTTLLLYFFSTSLVLSYTTSNIIQANDNNLQSLIKTPGKFSFVDFYADWCRHCKKISPIIDELSELFIDYPEIQII
    KINGDKDGKKMSKKYVDIGYPTLLFFYDDGEKKIEFDGIRDLNSLSNFIQQLSGIRLKNESEKGAVNNIEEKESSSNVNG
    VVEQTNNKLIELTPDNFDEKISQSPISIVSFGASW
    CKYCQELDPALDKLANEVYIRDIDDNKIMIGHLIIDQYKDNSIDE
    RYNIQDLPTVLFFRRNGNGDDDLQTPLVYKGKKNFYNLLNDINKFTGLNRDSQGNLNNDAGIIKEISQLIKNFNSDDHDH
    NDDGDELEIYDQLEKFKTTTTSGGGSGSGSGSSGGDDVEYYEKLINAKEYIPIELSRINNILQNDIDKLNGITIDSLTKR
    ANILKSLL

    >gi|241953591|ref|XP_002419517.1| peroxiredoxin, putative; thioredoxin peroxidase, putative [Candida dubliniensis CD36]
    MAPVVQQPAPGFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFASTDSEYTW
    LAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEGVALRGIFLIDPKGILRQITINDLPVGRSVEESLRLLEAFQ
    FTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK

    >gi|241953621|ref|XP_002419532.1| peroxiredoxin, putative; thioredoxin peroxidase, putative [Candida dubliniensis CD36]
    MAPVVQQPAPGFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVKKFAEKDAQVLFASTDSEYTW
    LAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEGVALRGIFLIDPKGILRQITINDLPVGRSVEESLRLLEAFQ
    FTEKYGEVCPANWHPGDETIKPSPEASKEYFNKVNK

    >gi|241953635|ref|XP_002419539.1| oligosaccharyltransferase complex subunit, putative [Candida dubliniensis CD36]
    MQIVNYIIGLLLYFEVALCSSRSAIKLTELAKESDNYIIDVYNSDLSILEGPRDYFTVLIFTSSNAAHNCKQCEGVKNVV
    AKVARSWFSDHVDSHLLTFINIDLNDPKNGKLFNLIGLQTVPHIWLVAPNPSRDYGDPNKILEDAHLEFKMPQVPQDKQA
    LEFAQFLSEQLQKPILIRDEDALAKFIKTFVITFSVIVIIRKKGPSRITATKKKTILSLVAIAIVLLFTCGYQFTIQNSV
    PFVAKSDKGGVVLISGGQYYQFGIETFLVGANYASLAGALLLLTYIGRYKVTEKSFIASEDIKVFLVLFVTISIYLLYSC
    LTSIVLRKDQGYPYSFTKLF

    >gi|241953653|ref|XP_002419548.1| ubiquitin-activating enzyme, putative [Candida dubliniensis CD36]
    MSDNMQIDSPSPQEIDEGLYSRQLYVLGKEAMLKMQNANVLIIGLNGLGIEIAKNIALAGVKSLSLYDPKPVSITDLSTQ
    FFLSESEIGQPRDVASREKLAELNSYVPINVVDNINEETLLKFKCIVSTNISLEEQVKINNITHANNIGYINADIKGLFG
    QIFVDFGDKFTVIDQTGEEPLSGIVSDIEKNGTVTMLDDNRHGLQDGDYVKFAEIEGMPKLNDGNPHKVEVLGPYAFKIK
    IDDSYGEYVKGGLYTQVKVPKDLSFEPLTKQLAAPEYLISDFAKFDKPAQLHLGFQALHAFQTKHQGELPAPYSEQDATE
    AFRYAEELATQNPSILGEDKLDEKYLKELFYQARGDIPGVVAFYGGLIAQEVLKNCSSKFTPIKQWLYFDSLESLPSETE
    YPRNEENNKPIGSRYDGQIAVFGKAFQEKIANLKVFLVGSGAIGCEMLKNWAMMGLGSGPEGKIFITDNDSIEKSNLNRQ
    FLFRPKDVGKNKSDVAALAVQHMNPDLKGKIDSKLDKVGPETEDIFDDKFWSQLNIVVNALDNVEARTYVDRRCVFYKKP
    LLESGTLGTKGNTQVVIPNLTESYSSSQDPPEKSIPL
    CTLRSFPNKIDHTIAWAKSLFQGYFADSPESVNLYLSQPNYVE
    QTLKQNPDIKGTLESISKYLNNRPYTFEDCIKWARQEFETKFNHDIQQLLYNFPPNAKTSTGAPFWSGPKRAPKPLEFDI
    NNKDHLDFIIGGANLLAFIYGLKEPNATIDDFKKVLEQVVIEPFQPKSGVEIAATDAEAEEQANNLSGSIDDEQIRKIAA
    SLPEPSTLAGYRLTPIEFEKDDDTNHHIEFITAASNCRALNYGIETADAHKTKFIAGKIIPAIATTTALVTGLVCLELYK
    VVDGKDDIEQYKNGFINLALPFIGFSEPIKSAEGKYNNKKFDQIWDRFELNGDITLQELLDHFEKEEGLTISMLSYGVSL
    LYASFFPPKKVKDRLGLKLTSLIKEVSKKEVPSHVKHLIFEICCDDEEGEDVEVPYICVKL

    >gi|241953729|ref|XP_002419586.1| iron sulfur assembly protein, putative [Candida dubliniensis CD36]
    MLGTRYMVITKRISTLQLFKSPILNGTVIGTLRYNSTKSTTTTNSGNTGTNSSRLKPSSFAFPSAQPPSTIPSTNDSTTT
    LQQEDINDFKATNLIHGQTNLSFAITERASKKLNEISQQDNEDSGLIIQVESGG
    CHGFQYNLKLTNIDKELQEVENNDDL
    MVFERDQGKVIMNESSLMILQDSKLDYTKELIGSQFKIVDSPYTSSACGCGSSFDFDFDKLSQKEG

    >gi|241954344|ref|XP_002419893.1| peroxiredoxin type-2, putative; thiol-specific peroxiredoxin, putative [Candida dubliniensis CD36]
    MTDGKFPTNIEPKYIPYSKDHSSLIACASPVPLDLKSLFQNSTVVVTAVPGAFTPTCTEQHIPDYLKHLKDFKDKGVKKI
    IVLSANDPFVMAAWAKALGYTDEENYVIFATDPNASISKELGDGFVADLTSAGMGLRLQRYASIVVNGEITYLETEDSLG
    FSEISSAETILKRIHN

    >gi|241954404|ref|XP_002419923.1| monothiol glutaredoxin, putative [Candida dubliniensis CD36]
    MGVIEIESEQQFTELTKADPSKLIALYFHTPWAGPCKTMNQVFKTLADSKESDNSIIFLSINADELSEISEIFEVSAVPY
    FILIRNQTILKELSGADPKEFIQALNQFSNNSNSTSINNDNIQGSINNNSNNTTTTNTNNNNNNNNNINTTEVEESEEAL
    NERLNKLTKAAPIMLFMKGSPSSPQ
    CGFSRQLVAILREHQVRFGFFDILKDDSVRQGLKKFSDWPTFPQLYINGEFQGGL
    DIIKESIEDDEKFFEHALEA

    >gi|241955134|ref|XP_002420288.1| 6-O-methylguanine-DNA methyltransferase, putative; DNA repair methyltransferase, putative [Candida dubliniensis CD36]
    MQSLYYSVFDTDVCTVLVVLNQDGCICYASLGKPAVELKRIMVKDFQSLSYQLKPLSTMKGDKAQIDKSVEKFKLLVEKP
    SVSQDIKIQIVFGTPFQRKVWKELIKIPAGEIRTYKELADSLGTHSRVVGNCCGANRVAVLIP
    CHRVVGANHKLTGYRWG
    KSYKEYLLKQEGIDI

    >gi|241955327|ref|XP_002420384.1| glutaredoxin-like protein precursor, putative; thiol oxidoreductase, putative [Candida dubliniensis CD36]
    MTGVRQLRIIALTAFILGLIFTLHKVGSNAASLVHAQASDQQPNKHNTKTSTYTATNEDLVANLIDSKNDAETDDKINQK
    ISKDQDEAINGNKNSNKETTKVKSDNGEYDPISDLIKIRSLSPMTIFSKSY
    CPFSKKIKQLLLEKYDITPAPNVVELDRY
    EYGAELQSYLAEKSGRRTVPNVLVGKSFESRGGCDEFEKLHKDNDLIKLLVEWGSGRLQVAKKNTPSNA

    >gi|241955333|ref|XP_002420387.1| glutathione reductase, putative [Candida dubliniensis CD36]
    MFTKSIISKSTTRLTQLTRQLSTTMAPTLTKNSLKHFDYLVIGGGSGGVASARRAAKYGAKVLLIETKFKKLGGTCVNVG
    CVPKKVMWYTADLAHKKHDLYAYGLDKDQESIKYGDFDWAKLKHKRDAYVSRLNGIYENNLKREKVDFAYGFAKFINSDG
    EVEVTLSGDQTLPFLDDGKTYKEGEKLVFSADKTLIATGGTAIVPPSVPGAELGTTSDGFFALEKQPKKVAIVGAGYIGV
    ELSGVFSSLGSETHFFIRGDTVLRNFDEVIQNTVTDYYIDNLGINIHKQSTITKIEGSKDSKKVVHLKDGTSVEVDELIW
    TIGRKSLIDIGLDKVGVKLNDKLQIVADEYQVTNNPKIYSLGDVVGKVELTPVAIAAGRRLSNRLFGGPEFAKDKLDYNN
    IPSVIFSHPEAGSIGLSTKEAIEKYGEENLKIYQSKFTAMYYAMMDDQKDKSPTVYKIICAGPEEKVVGLHIVGDSSAEI
    LQGFGVAIKMGATKKDFDNCVAIHPTSAEELVTMT

    >gi|241955441|ref|XP_002420441.1| thioredoxin, putative [Candida dubliniensis CD36]
    MLQNIETKQQFSSALQNKDDMIVLDFFDECSHCSDLNDKLDEFSNMYGAQNIRFYKVNIEEDRELAEDYKVSSIPTTLFF
    KKGKVFDKVVGPEPNEIKKVLDKNLLGWSGRPSHSTKT

    >gi|241955665|ref|XP_002420553.1| thioredoxin reductase, putative [Candida dubliniensis CD36]
    MVHHKVTIIGSGPAAHTAAIYLARAEIKPTLYEGMLANGIAAGGQLTTTTDIENFPGFPNGIGGSELMEKMKEQSQRFGT
    EIITETISKVDFSKRPFKLWTEWNEDAEPITTDAVIIATGASAKRMHLPGEETYWQQGISA
    CAVCDGAVPIFRNNPLAVI
    GGGDSACEEAIFLTKYASKVFLLVRRDVLRASTIMQKRVTNNDKIEVLWNTEALEAKGDGKLLKSLRVVNNKTKEEKDLQ
    VNGLFYAIGHIPATKIFADQLKTDEAGYIQTTPGTASTSIEGVFAAGDVQDKIYRQAITSAGSGCMAALECEKFISEQEA


    >gi|241955947|ref|XP_002420694.1| member of the protein disulfide-isomerase family, putative; thioredoxin, putative [Candida dubliniensis CD36]
    MFFNHLLALVHILILVSAGSQADEYASDPNIFELTPSNFDKVVHKSNYTTLVKFYAPWCGYCQKLQPVYHKLGKYINKDA
    KYSINIASVNCDKDYNKQLCSQYQVRGFPTLMVFRPPKYEKGKQVKLQKHASEVYQGERSVKSITKFLTSRLKNYVKKFH
    NIKSDGVAEWLAEDKPSVLLISNANSVSPLLKSLAIDFLDRVKVGMISKFNDEPHKLVIGDKEIEVPSTSKSMLFYFNKE
    KGELVAYTKSEKLNDKVKITEWIIEQTQQQPAEGPLSKKENKYYYKYRTGKKKIEHDEL

    >gi|241956071|ref|XP_002420756.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferas
    MKISVILFMVTLWSLVLGGLTNNELLKIVKNRRNKVLELNDENFENILNGQRDYHLIALLTSEAPNLNCVLCRELAPEYS
    VVANSWFQDHPNGVAEVELTEQEEKDGKKQPKNIYFFKSEFKDSRKLFSILQLQNIPKMFYFPPTKHLGPNNYLKEKVEY
    QFFQGDHKELLKNWLIEVTDHRFNLYIPVNKTKIAINAIGTFITVLLLRVFSKQVIQVITSRVIWCAGSIISVILFTTGY
    MFNQIRGTPYVMEHRDGRTEYFAPGQQAQFGVETQIMSFLYGFLSILVIVLVKRAPEVKNQSANLILVATVSSLIFVLFS
    LLLSIFGVKGLGFPYRFINFF

    >gi|241956252|ref|XP_002420846.1| NEDD8-activating enzyme E1 catalytic subunit, putative; ubiquitin-like protein-activating enzyme, putative [Candida dubliniensis CD36]
    MVFDNVRDISSIEPLISNIGPYNEFPEEYNSDDSFKALQESKILIIGAGGLGCEILKNLAMVGFKNLYIIDMDTIELSNL
    NRQFLFRMKDIGKSKAEIAAQFVRDRIDDPSLKIESYFTKIQNKPIEFYQQFNLVISGLDSIEARRWINATLISLVQQGY
    MIPLIDGGTEGFRGQSRVIIPTVTSCFECSLDLLSPKVTYPV
    CTIANTPRLPEHCIEWATQIEWNNKFAGKKLDGDNPEH
    IEWVYQTALERANEFNIDGVTKHLTLGVVKNVIPAIASTNAIIAASCCNEAFKLITDSNPILHNYMMYTGDDSIHTYTFE
    HSKKLHCICSS

    >gi|241956314|ref|XP_002420877.1| hydrogen peroxide resistance protein, putative; peroxiredoxin, putative; thiol peroxidase, putative [Candida dubliniensis CD36]
    MSEFYEFAPNDIKGSPYSLKKLQGKIVLVVNVASKCGFSPQYKGLQDLKQKFADQPVEIIGFPCNQFGHQEPGTNEEIEK
    YCREYFGVTFPVLSKIETNGKNAEPVYKYLKSQKPGLLGLHRVMWNFEKFLIDQDGNVVARFSSFTKPETIGLQIEEMLK
    HQA

    >gi|241956316|ref|XP_002420878.1| hydrogen peroxide resistance protein, putative; peroxiredoxin, putative; thiol peroxidase, putative [Candida dubliniensis CD36]
    MSKFYELAPKDAKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNKKFADQPVQILGFPCNQFGHQEPGTNEEIGS
    FCSLNYGVTFPVLDKIEVNGDNTDPVYKYLKSQKSGVLGLTRIKWNFEKFLIDQNGKVIERFSSLTSPESIGARIEELLK
    K

    >gi|241956318|ref|XP_002420879.1| hydrogen peroxide resistance protein, putative; peroxiredoxin, putative; thiol peroxidase, putative [Candida dubliniensis CD36]
    MVKSNIESTWETMESTFSEIQNKFHEIYKPIETNEPEPEEDNRNIKSESLDITDDSTLSVSPITQLLYLARSKFYDLTPL
    DNNKSPYPFKNLRGKVVLIVNVASK
    CGFSFQYNGLEQLNKQFANDEFVLLGFPCNQFLWQEPGTNDQIVTKCKKKYDVTF
    PILDKINVNGEQADPVYKYLKAQKEGLWGTNRVKWNFEKFLVDKNGRVVERYSTFTRPLAIIPKIEQLLKS

    >gi|241956608|ref|XP_002421024.1| iron sulfur assembly protein, putative [Candida dubliniensis CD36]
    MMIATRRQSLQLTKRYISNHATKNKRFIQTIPISTNTGSNSFLSKLHQSEDNDVPTSKWARHTLSFPKTETSNTTPQPPV
    RKSRTSRFANKSTSTNDIKQFNSTTPTSQSNIIEITSDPEIQKASNKITSTSASVPTEIKSAATPSVTPKKKRVLRPRKA
    LITLTSSAVQHLQGLLDQPDPKLIRIGVRNRG
    CSGLTYNLEYVDKPGKFDELVEQDGVKVLIDSKALFSIVGSEMDWLDD
    KLSSRFIFKNPNSKGTCGCGESFMV

    >gi|241957309|ref|XP_002421374.1| FAD-linked sulfhydryl oxidase, putative [Candida dubliniensis CD36]
    MIFIRRSLFSALTLVGIIGVIYFMSNSSNTIETSINNISSLTKDDLLPKFNQQPQQQQQQLSQPAPNKPLEEIDTDESVE
    QEPPKGKESDNVLQNKEKFTDIPFMPKMANETLKAQLGNASWKLFHTILARYPDEPTDQERSTLENYIYLFAQVYP
    CGDC
    ARHFTKLLAKYPPQTKNRKTAALWGCYVHNIVNEKLHKPEYDCTTILEDYDCGCGDDEKEKDYTLKGESMDHLRQIKIDS
    KKDKQRGG

    >gi|241957375|ref|XP_002421407.1| glutaredoxin, putative; glutathione-dependent disulphide oxidoreductase, putative [Candida dubliniensis CD36]
    MSSILAWGFNLWYQPPPPTAQTEKEIEHTINSHKIVIYSKTYCPFCDETKRLLNEQYPQESYEVINLNILDDGLTIQNQL
    YATTGQYMVPIIFINGQHVGGNSEVQKLHTDGKLQELLNP

    >gi|241957377|ref|XP_002421408.1| glutaredoxin, putative; glutathione reductase, putative; thioltransferase, putative [Candida dubliniensis CD36]
    MSSLIGWLSSWFQSEPATPELKKEIESNINSHKILVYSKSYCPYCTSTKSLLQSLNQDYKVIELDQIPKGSAIQNGLQEL
    TGQRTVPNIFINGKHIGGNSHIQALHSQGKLKPLFG

    >gi|241957433|ref|XP_002421436.1| alkyl hydroperoxide reductase, putative; peroxiredoxin type-2, putative; thiol-specific peroxiredoxin, putative [Candida dubliniensis CD36]
    MSFKEGSKFPEGVEFSYIPIQLDDLELINPLKCDVTSQLKLDNLLTKLSTTDTPNLLIVSVPGAFTPTCTESHLPPYLEN
    LTKLHDKKIGAIVVLATNDQFVVNAWGKVLIKAYVEKNSGKFPEVIFASDGGFSNKYGLAGDRGGIIRNKRYAAIIDSKT
    KDVIFLGVETEKGVQNSGIDAVLAKL

    >gi|241957487|ref|XP_002421463.1| mitochondrial peroxiredoxin, putative; thioredoxin peroxidase, putative [Candida dubliniensis CD36]
    MSQQPHLRLGSTAPDFKADTTNGPISFHEYIGDSWAILFSHSGSFTSVCSSELSAFAKLEPEFTKRGVKLLAISPDPVEE
    NSGWIDDMEDFSGSRVKFPIIADPDRRISVLYDMIDYQDATNVDDKGLNMTIRAVFIIDPKKTIRLIMTYPASTGRNTAE
    VLRVVDSLQLVDRQKVITPINWVPGDDVFVHMSVPDDEARVLFPKYRAIKPYIRLTPLEKEDK

    >gi|241957563|ref|XP_002421501.1| protein disulfide-isomerase precursor, putative [Candida dubliniensis CD36]
    MKFWTYSTKVLATLLAVVSLTQASGPTDGDAVADPNSAVVKLTSENFASFIEENLLILAEFFAPWCGYCKMLGPEYSKAA
    DSLNESHPKIKLAQIDCTEDEALCLEHGIRGYPTLKIIRDGDSKSAEDYQGPREAAGIADYMIKQSLPAVQFPETFEELD
    TLIDAQTKPFVLQINPTEDGNSTFNKVANQKRKDYVFINVEDKQVIKDLNKKFKNVDITGKKPSYLVVQPKQFDEVAKFD
    GKKIDVESLTEFIGVEAVPYFGEINQDTYMTYMTSPLPIAYYFYNNAEQREAIADDLTKLGKKYRGKLNIVGLDASLFGR
    HAEVINMDPEVVPLFAIHHISDNKKFGVNQTEYPEGPSFKVIEKFVADYFADKLTPIIKSEPLPTEEEKSANPVVKLVAH
    NYKDILDQTDKDVFVKYYAPW
    CGHCKKLAPTWEELAEIFGSNKDDAKVIVADIDHTNNDVDVPYNIEGYPTLLMFPANGK
    IDKKTGIREPIVFEGQRELDTLIEFIKEKGALNVDGVELKAKLDEEKATKEEEEVEEEEDVSAASSAPAEEKENVEHDEL


    >gi|241958290|ref|XP_002421864.1| mitochondrial FAD-linked sulfhydryl oxidase, putative [Candida dubliniensis CD36]
    MSTTETKEKTESGGKPEVGVTGRKIVYDKDGKPCRTCNSLLDFQFASGKIKKSPVLHESKKENKPELESYPQDEPPDVTE
    LGKSSWTLLHSIAATYPETPTTKQQQDMKSFINLFSGFYP
    CWFCAEDFQKYITKNEPKTGNQEELGRWLCEAHNEVNKKL
    NKPQFNCDLWKKRWKDGWDNEE

    >gi|241958986|ref|XP_002422212.1| thiosulfate sulfurtransferase, mitochondrial precursor, putative [Candida dubliniensis CD36]
    MFALKKSTTSIIKTVVAPTSSRYLSSITFRSIPRSFHNATKSSLFNGLKATPRFYSVLTESPEAKVYKYDDVKDVAVHPE
    KHPDSILVDVREPTEFGDGHIPGALNIPFKSSPGALDLPEEEFQEHFGFSKPSTDKELIFY
    CLGGVRSTAAEELANTFGY
    KKRGNYLGSWEDWVQHENKKN

    >gi|241959062|ref|XP_002422250.1| dihydrolipoamide dehydrogenase, putative; dihydrolipoyl dehydrogenase, mitochondrial precursor, putative [Candida dubliniensis CD36]
    MLRSFKSIPANGKLAQFVRYASTKKYDVVVIGGGPGGYVAAIKAAQLGLNTACIEKRGALGGTCLNVGCIPSKSLLNNSH
    LLHQIQHEAKERGISIQGEVGVDFPKLMAAKEKAVKQLTGGIEMLFKKNKVDYLKGAGSFVNEKTVKVTPIDGSEPQEVE
    ADHIIVATGSEPTPFPGIEIDEERIVTSTGILSLKEVPERLAIIGGGIIGLEMASVYSRLGSKVTVIEFQNAIGAGMDGE
    VAKQSQKLLAKQGLDFKLGTKVVKGERDGEVVKIEVEDVKSGKKSDLEADVLLVAIGRRPFTEGLNFEAIGLEKDNKGRL
    VIDDQFKTKHDHIRVIGDVTFGPMLAHKAEEEGIAAAEYIKKGHGHVNYANIPSVMYTHPEVAWVGLNEEQLKEQGIKYK
    VGKFPFIANSRAKTNMDTDGFVKFIADAETQRVLGVHIIGPNAGEMIAEAGLALEYGASTEDISRTCHAHPTLSEAFKEA
    ALATFDKPINF

    >gi|241959548|ref|XP_002422493.1| thioredoxin, putative [Candida dubliniensis CD36]
    MVHVVTEVNEFKTLLKENNLVIVDFFATWCGPCKMIAPLLDKFQSEYTNIKFLKIDVDQLGSLAQEYNVSSMPTLILFKN
    GEEVNRVIGANPAAIKQALASLA