Callithrix jacchus

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296189217|ref|XP_002806523.1| PREDICTED: LOW QUALITY PROTEIN: copper-transporting ATPase 2-like [Callithrix jacchus]
    MEKARGEMLQSPEQSFLATLSDPHVTLLSVHKQCFFRKNPGVRHSARPVSTEEEGTSPSEEGEFPQXVLNGTREVSSSQM
    LSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVTTSTIRILGMTCQSCVKSIEDRISSLKGIVSVKVSVEQGSA
    TVNYVPSVLSPQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSL
    SNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTYPKRLFTSANQNINNSETLGNQGNHVVT
    LQLRIDGMH
    CTSCILSIEENIGQLPGIQSIQVSLENKTAQVQYDPSCTSPVSLQRAIEALPPGNFKVSLPDGAEGCGTDH
    GPFSCHSPGFSQRNQVQGTCSTTVIAIAGMTCASCVHSIEGMISQREGVQQISVSLAEGTGTVLYNHSVISPEELSSAIE
    DMGFEASVISENCSTNSLGNHSAGNSMVQTIGGVPVSVQEVAPHAGGLPTIHTPDILAKSPQSTRAVAPQKCFLQIKGMT
    CASCISTIERNLQNKAGILSVLVALMAGKAEIKYDPEVVQPLEIAQLIQDLGFEAAVMEDYTGSDGSIELIITGMTCASC
    VHNIESKLMRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKKSFLCSL
    VFGIPVMALMIYMLIPSSEPHESMVLDHNIIPGLSILNLIFFILCTFVQLLGGWYFYVQAYKSLRHRSANMDVLIVLATS
    IAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKVTATSALAKLMSLQAVEATVVTLGEDNLIIREE
    QVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGAVLIKATHVGNDTTLAQ
    IVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFDVVQKYFPNPNKHISQTEVIIRFAFQTSITV
    LCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDMATLPLRKVLA
    VVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHGGHPPSASHLNEAGSLSKGKDAA
    PQTFSVLIGNREWLRRNGLTISNDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLIT
    GDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGKKVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLI
    RNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPE
    LERYEAQVHGRIKPLTASQVSVHIGMDDRRRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSATVDDGGDKWSLLLNDRD
    EEQYI

    >gi|296189368|ref|XP_002742755.1| PREDICTED: nucleoredoxin-like protein 2-like [Callithrix jacchus]
    MVDVLGGRHLVTCKGAAVEAEVALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSVDGSAQEML
    DFMRELHGAWLALPFHDPYRHELRKRYNVTAIPKLVIVKQNGEVITNKGRKQIREQGLTCLQNWLEAADVFQNFSG

    >gi|296189815|ref|XP_002742931.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial-like [Callithrix jacchus]
    MVAVEGGDKPEGAVRRSLWRQCARLVHGERLGLPSFGPRHQGAETAKMSASLVRATVRAVSKRKLQPTRAALTLTPAAVN
    KIKQLLKDKPEHVGVKVGVRTRG
    CNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFN
    NPNIKGTCGCGESFNI

    >gi|296190409|ref|XP_002743185.1| PREDICTED: endoplasmic reticulum resident protein 44 [Callithrix jacchus]
    MNPALFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFP
    NENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSK
    RNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDK
    CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPV
    IAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLL
    RDRDEL

    >gi|296190552|ref|XP_002743237.1| PREDICTED: thioredoxin-like [Callithrix jacchus]
    MVKQIDSKDAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVASECEVKCMPTFQFF
    KKGQKVGEFSGANKEKLEATINEFV

    >gi|296190910|ref|XP_002743391.1| PREDICTED: prostaglandin E synthase 2-like [Callithrix jacchus]
    MAPAARVARALWPGGCALAWRLSGRPQLLLPTQNRAGFAGSAGGPGPVAAALKGSPRLLGAAALALGGALGLYHTARWHL
    RAQDLHAEHSAAQLSLSSHLQLTLYQYKT
    CPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQVGENSQ
    QLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNDQGKEVTEFGNKYWLMLDEKEAQQVYSGKEARTEEMKWRQWADD
    WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHHLQDNVREDLYEAANKWVTAVGK
    DRPFMGGQRPNLADLAVYGVLRVMEGLDAFDDLMQHTRIQPWYLRVERAITEASPAH

    >gi|296191216|ref|XP_002743531.1| PREDICTED: chloride intracellular channel protein 3-like [Callithrix jacchus]
    MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLCDSEAKTDTLQIQD
    FLEETLGPPDFPSLAPRYREANTAGNDIFHKFSVFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELALEPQLRESR
    RRFLDGDRLTLADCSLLPKLNIVDTVCAHFRQAPIPAELRGVRHYLDSALQEKEFKYTCPHSAEILAAYRPAVHPR

    >gi|296191358|ref|XP_002743594.1| PREDICTED: hypothetical protein LOC100413738 [Callithrix jacchus]
    MAAMAAALRGLGGRFRWRMPAVAGGVRGAAQGAVAGQWDYDLLVIGGGSGGLACAKEAAQLGRKVAVVDYVEPSPRGTRW
    GLGGT
    CVNVGCIPKKLMHQAALLGGLIRDAPHYGWEVAQPVPHDWRKMAEAVQNHVKSLNWGHRVQLHDRMAGAQGRIGR
    RHLGLGGLRPESMDMDAPGDDSVGPGAFYWSKCPYLVAIPVSSWGIPSTEANATMACSLLLGLGCQYSRCLNLALPPSAS
    QAFSQGCDPACARGLWRGHWSCTGLYVASQDCAELASVSAWTPVVNMSLGSLGDRRVAVPTPGPVSWSEPGSRGGSRGAE
    GKGILQGHRAQEHSSLDADRPPAAPKKPQPADKDWQQGSPCA
    CVLWDGAVQIEGALEYGITSDDIFWLKESPGKTLVVGA
    SYVALECAGFLTGIGLDVTVMMRSIPLRGFDQQMSSLVTEHMASHGTRFLRGCTPSQVRRLLDGQLQVTWEDHTTGKEGT
    GTFNTVLWAVGRVPDTRSLNLEKAGVDTSPNTQKILVDSREATSVPHIYAIGDVVEGRPELTPTAVMAGRLLAQRLFGGS
    SDLMDYDKVPTTVFTPLEYGCVGLSEEEAVARHGQEHVEVYHAHYKPLEFTVPGRDASQCYVKMVCLREPPQPVLGLHFL
    GPNAGEVTQGFALGIKCGASYVQVMQTVGIHPTCSEEVVKLRISKRSGLDPTVTGC

    >gi|296191405|ref|XP_002743609.1| PREDICTED: apoptosis-inducing factor 3 isoform 2 [Callithrix jacchus]
    MGGCFSKPKPGAALPTVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLPTPHPYPSPQDCVEAAVCH
    VKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKF
    QVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYD
    RPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENV
    FTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQ
    TEVSELRAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLKQSGISLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLA
    WRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYTGYGESFDDVIIQGDLEELKFVAFYTKGDE
    VIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS

    >gi|296191403|ref|XP_002743608.1| PREDICTED: apoptosis-inducing factor 3 isoform 1 [Callithrix jacchus]
    MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLPTPHPYPSPQDCVEAAVCHVKDLEN
    GQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEK
    EKVYVRASKQALQLQRRTKVMAKCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSK
    SLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTP
    EDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSEL
    RAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLKQSGISLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
    VNIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYTGYGESFDDVIIQGDLEELKFVAFYTKGDEVIAVAS
    MNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWLTGKGS

    >gi|296191407|ref|XP_002743610.1| PREDICTED: apoptosis-inducing factor 3 isoform 3 [Callithrix jacchus]
    MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLPTPHPYPSPQDCVEAAVCHVKDLEN
    GQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEK
    EKVYVRASKQALQLQRRTKVMAKCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVL
    CTLDRHLPYDRPKLSK
    SLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTP
    EDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSEL
    RAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLKQSGISLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
    VNIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYTGYGESFDDVIIQGDLEELKFVAFYTKGDEVIAVAS
    MNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS

    >gi|296191778|ref|XP_002743783.1| PREDICTED: thioredoxin, mitochondrial-like [Callithrix jacchus]
    MDKGICREALRSELSEFAGTESVRVLAQPACLILLYLPATRTPTPSSPPEILRGKLTWWCGPCKILGPRLEKMVAKQHGK
    VVMAKVDIDDNTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

    >gi|296191802|ref|XP_002743786.1| PREDICTED: protein EAN57-like [Callithrix jacchus]
    MEDSRLSNPWPRTQGEQGLDSGHIHGSVNMPFMDFLTEDGFEKSPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAA
    YLCGKPDVAVYDGSWSEWFRRAPLETREAPGFLLSSLPSDRILEGRRPNLSLVLEQIGAQETLRRSALGLVGWVVGMNVE
    AGLSLESPVPQQEAMELGRRPGTTGLTRAHLNDEKGQQDTDPWKTACSSLDTSNFKYQGLSSPLPLPRTASTQGSSLGQC
    HLEEMPPPPPTAASRASLGMDPQSRSPKNGDSRSSSRENRATLREWSQPCQGTDDGPSLGTQDQRSTPTSQKGSIIPNNI
    RHKFGSNVVDQLVSEEQAERAISEVFQGQKKASLWPSRKQSPAGISSIFSDYCDLGYNMRSNLFQGAPEETQSLMKASYT
    PEVIEKSVRDLEQWHGRKTDDLGRWHRKNAMNLNLQKALEEKYVENSKSKGSKY

    >gi|296193064|ref|XP_002744339.1| PREDICTED: peroxiredoxin-6-like [Callithrix jacchus]
    MPGGLLLGDVAPNFEANTTVGPIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLFALSIDSVEDHL
    AWSKDINAYNGEEPTEKLPFPIIDDKNRDLAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEI
    LRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

    >gi|296194100|ref|XP_002744803.1| PREDICTED: glutaredoxin-1-like [Callithrix jacchus]
    MAQEFVNCKIQPGKVVVFIKPTCPYCRTAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLLQLTGARTVPRVFIGKDCI
    GGCSDLVSMQQSGELQTRLKQIGALQ

    >gi|296194595|ref|XP_002745021.1| PREDICTED: probable glutathione peroxidase 8-like isoform 1 [Callithrix jacchus]
    MEPLAAYPLKCSGPRGKVFAVLLSMVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRPVSLEKYKGKVSLVVNVASDCQ
    LTDRNYLALKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKK
    EPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQLIIKKKEDL

    >gi|296194597|ref|XP_002745022.1| PREDICTED: probable glutathione peroxidase 8-like isoform 2 [Callithrix jacchus]
    MEPLAAYPLKCSGPRGKVSLVVNVASDCQLTDRNYLALKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYG
    VTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQLIIKKKEDL

    >gi|296196446|ref|XP_002745837.1| PREDICTED: ubiquitin-like modifier-activating enzyme 6 [Callithrix jacchus]
    MERSETVAASPREEATCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNL
    VLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLT
    EMKLPLQKMINDFCRSQCPAIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLE
    TGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKIFSFEPLERQIKHPKCLIVDFSRPE
    APLEIHTAMLALDQFQEKYNRKPNVGCQKDSEELLKLATSISETLEEKPDVNADIVHWLSWTAQGFLSPLAAAVGGVASQ
    EVLKAVTGKFSPLCQWLYLEAADIVQSLGKPECEEFLPRGDRYDALRACIGDTLCQKLQNLNIFLVGCGAIGCEMLKNFA
    LLGVGTSKEKGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAADATLKINPQIKIDAHLNKVCPATETIYNDEFYTK
    QDIIVTALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPF
    CTLKSFPAAIEHTIQW
    ARDKFESSFSHKPSLFNKFWQTYSSAEEVLQKIQSGHSLEGCFQVIKLLSRRPRNWSQCVELARLKFEKYFNHKALQLLH
    CFPLDIRLKDGCLFWQSPKRPPSPIKFDLNEPLHLSFLQNAAKLYATVYCIPFTEEDLSTDALLNILSEVKIQEFKPSNK
    VVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVLSFEKDDDRNGHIDFITAASNLRAKMYSIEPADR
    FKTKRIAGKIIPAIATTTATVSGLVALEMIKVTGGYPFEAYKNCFLNFAIPIIVFTETSEVRKTKIRNGISFTIWDRWTV
    HGKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPSTEKKYVDLTVSFAPDIDGDEDLPG
    PPVRYYFSHDTD

    >gi|296196513|ref|XP_002806708.1| PREDICTED: LOW QUALITY PROTEIN: phosducin-like protein 2-like [Callithrix jacchus]
    MQDPNEDTEWNDILRDFGILPPKQEPKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFDEEDMQAIETYRKKRLQEW
    RALKKKQKFGELREISGNQYVNEVTNAEKDVWVIIHLYRSSIPM
    CLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNC
    LPTIFVYKNGQIEAKFIGITECGGINLKLEELEWKLAEVGAIQTVLEENPKKDIVDMMVSSIKNTSFHDDSNSSNSDNDP
    HREKYSINSF

    >gi|296197096|ref|XP_002746127.1| PREDICTED: epididymal secretory glutathione peroxidase-like [Callithrix jacchus]
    MTVQLRAVRLLPVLLACFVQASPKQEKMKMDCHRDQKDTIYDYEAIMLNEKEYVPFKRYVGKHVLFVNVATYCGLTAQYP
    ELNALQEELKPFGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPNFQLFEKGDVNGEKEQKVFSFLKHACPHPS
    EILGTFKSISWDPVKVHDVRWNFEKFLVGPDGIPVMRWSHQATVSIVKADIVANLKQFKTQ

    >gi|296197098|ref|XP_002746153.1| PREDICTED: glutathione peroxidase 6-like [Callithrix jacchus]
    MIRQFQASCLVPLFLVSFAQQTLKPEDRKVDCNKNVTGTIYEYGALTLSGEEYIQFKQFAGKPVLFVNVASYCSLTAQYP
    ELNALQEELKSLGVTVLGFPCNQFGKQEPGANSEILLGLKYVRPGSGFVPNFQLFEKGDVNGEKEQKVFTFLKNACPPTS
    DLLGSSNQLFWEPMKVHDIRWNFEKFLVGPHGVPVMRWFHRIPVSTVKADILAYLKPNPRGNGSD

    >gi|296197453|ref|XP_002746287.1| PREDICTED: thioredoxin domain-containing protein 5-like [Callithrix jacchus]
    MPARPGRLLPPLARPSALTALLLLLLGHGGGGRWRARAQEAAAAADGPPAADGGDGQDPHSKHLYTADMFTHGIQSAAHF
    VMFFAPWXGH
    CQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFQTLE
    NWMLQTLNEEPVTPEPKVEPPRAPELKQGLYELSASNFELHIAQGDHFIKFFAPW
    CGHCKALAPTWEQLALGLEHSETVK
    IGKVDCTQHYELCSGNQVRGYPTLLWFRDGEKVDQYKGKRDLESLREYVESQLQRTETGAAETVTPSEAPVLAAEPEADK
    GTVLALTEKNFDDTIAEGITFIKFYAPW
    CGHCKNLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLL
    FRGGKKVSEHSGGRDLDSLHRFVLGQAKDEL

    >gi|296197723|ref|XP_002746400.1| PREDICTED: chloride intracellular channel protein 1-like [Callithrix jacchus]
    MAEEQPPVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI
    EEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDE
    GISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKAL
    K

    >gi|296198300|ref|XP_002746644.1| PREDICTED: chloride intracellular channel protein 5 [Callithrix jacchus]
    MNDEDYSTLYDTIQNERTYEVPDQPGENEDPHYDDVHEYLRPENDFYASQLNTHEYDFVSVCTMKGEESSLASAQSEDRG
    YLLPDEIYSEVQEGQLGQPQEDSAISMEELYSPTQDQQPCPEELQENGSVMKEDLPSPSIFTIQHSNAFSTSKYSSYSDA
    DVLEENKAAHMDPEICLFVKAGIDGESIGN
    CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDV
    KTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEID
    ANICGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAY
    ADVAKRLSRS

    >gi|296200154|ref|XP_002747393.1| PREDICTED: thioredoxin-related transmembrane protein 4-like [Callithrix jacchus]
    MAGGRCSSQLTALLAAWVAAATATAGPDQAALPAEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKN
    GEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKWQSVEPLTGWKSPASLTMSGM
    AGLFSISGKIWHLHNYFTVTLGIPAWCSYIFFVVATLVFGLFMGLVLVVISECFYVPFPRHLSEHSEQNQRSEEAHRAGQ
    LQDAEDDKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEEEDNLAAGVDEDRSEANDQGPPGEDSATQEELEPEETEEAI
    SEQPCPADTEVVEDSLRQRKSQHADKGL

    >gi|296200715|ref|XP_002747720.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like [Callithrix jacchus]
    MASREETVALQAEVARREEELYSLKQRLAAALLAEQKPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRL
    ATASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLPRQVLHGESLTGQAKAFSAAASLRRLNSEVECVPYTQA
    LTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTN
    CA
    DGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRCIRLRSRRLDCAACGERPTVTDLMDYEAFCGSSA
    TDKCLSLQLLSPEERVSVTDYKRLLDSGASHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLGEAIREGKQRT
    QEGAALPIYVICKLGNDSQKAVKILQSLSAAQELDSLTVRDVVGGLMAWAAKIDGTFPQY

    >gi|296201755|ref|XP_002748147.1| PREDICTED: methyltransferase-like protein 2B [Callithrix jacchus]
    MASSYTEGVPAVLADKRQQFGSRLLSDPARVFHHNAWDNVEWSEEQAAAAERKVQENSTQRVCQEKQVDYEINAHKYWND
    FYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKRSEISECRNNEDGPVLIMEEQHKCSSKSLEHKTQVPPVEE
    NVTQKISDLEICADEFPGSSATYRILEVGCGVGNTVFPILQTNNDAGLFVYCCDFSSTAIELVQTNSEYDPFRCFAFVHD
    LCDEEKSYPVPEGSLDIIILIFVLSAIVPDKMQKAINRLSKLLKPGGMMLLRDYGRYDMAQLRFKKGQ
    CLSGNFYVRGDG
    TRVYFFTQGLFFGLWLQLLFSEPGCDDALQICLCFLIRSTGCDAGTLVKR

    >gi|296202737|ref|XP_002748573.1| PREDICTED: uncharacterized protein C17orf37-like [Callithrix jacchus]
    MSGEPGQTSVAPLPGEVEPGSGVHIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLEN
    GGFPYEKDLIEAIRRASTGEPLEKITNSRPPCIIL

    >gi|296204362|ref|XP_002749294.1| PREDICTED: dnaJ homolog subfamily C member 10 [Callithrix jacchus]
    MGVWLNQDDYIRNLKRIILCFLIVYMALLVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKI
    NRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPG
    CSH
    CHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFQSGMAPVKYHGDRSKESLVSFAMQHVRSTVTEL
    WTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCASQDNLCKSLDITTSTTAYFPPGATL
    NNKEKSSILFLNSLDAKEIYLEVIHNLPDFELLSANTLEDRLAHHRWLLFFQFGKNENSNDPELKKLKTLLKNDHIQVGR
    FDCSSAPDMCSNLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPW
    C
    PPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS
    LTPTTFNELVTQRKHNEVWMVDFYSPW
    CHPCQILMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFYPPK
    SNKAYQYHSYNGWNRDAYSLRVWGLGFLPQVSTDLTPQTFSEKVLQGKTHWVIDFYAPW
    CGPCQNFAPEFELLARMIKGK
    VKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFREEQINTRDAKAIAALIKEKLETLQNEGKRSKDEL

    >gi|296205495|ref|XP_002749793.1| PREDICTED: glutaredoxin-3-like [Callithrix jacchus]
    MAAGAAEAALVAVEEVGSVGQFEELLSLKTKSLLVVHFWAPWAPQCAQMNEVMAELAKEHPQVSFAKLEAEGVPEVSEKY
    EISSAPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFPPSVNEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPR
    CG
    FSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDKICPKAPKLEERLK
    VLTNKASVMLFMKGNKQEAK
    CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKE
    LKENGELLPILRGEN

    >gi|296206165|ref|XP_002750092.1| PREDICTED: selenide, water dikinase 1-like isoform 1 [Callithrix jacchus]
    MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGL
    SLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVT
    GGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
    MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPET
    SGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

    >gi|296206299|ref|XP_002750141.1| PREDICTED: methionine-R-sulfoxide reductase B2, mitochondrial-like [Callithrix jacchus]
    MARLLRLLRGLPLGVAPLRAMRGREGDRGPGAGPGLGEAGCELPLAKSEWQKKLTPEQSYVTREKGTEPPFSGIYLNNKE
    AGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPN
    GQRF
    CINSVALKFKPRKH

    >gi|296206535|ref|XP_002750269.1| PREDICTED: hypothetical protein LOC100403434 [Callithrix jacchus]
    MTMTMTMMMTTRGHALGELLVPGLASVSSQLLHLQEWGRGPQSHTSPQGDPCRSRDHPWSRHPTPPQPLRDNPWARRLPP
    FPPAPGTIPSPPPAPGTTRARCLIPKTMPSPLPSPSRPPPPPGTTPTPLPAPRHPPGPPRGRCPRLAAPRHPRDHPEPAA
    RAPRHPPGPCQTRCPPPAAPRPPRDHPKLAARPPQSPVTPRDYAKPAAGPQPPSAQARTAQLRPLRRGQAGLAYSWIWEP
    GAGNLEKGWAAGALSTVDLARVGACVLKHAVTGEAVELRSLWRERACVVAGLRRFG
    CVVCRWIARDLGSLAGLLEQHGVR
    LVGVGPEALGLQEFLDSGCFAGELYLDESKQLYKELGFKRYSSLSILPAALGKPVHHVAAKAKAIGIQGNLSGDLLQSGG
    LLVVSKGGDKVLLHFIQKSPGDVPQEHILQVLGISAEVCASRPPQCDKEL

    >gi|296207071|ref|XP_002750479.1| PREDICTED: chloride intracellular channel protein 4-like isoform 1 [Callithrix jacchus]
    MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITF
    NSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLP
    DEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEV
    EIAYSDVAKRLTK

    >gi|296207478|ref|XP_002750723.1| PREDICTED: magnesium transporter protein 1-like [Callithrix jacchus]
    MAELWCLWHLLLTVVVAVAFIAPGVFAHPAHGKELLAKKVSQLMSWTKKDRVIRMSETMFYNFVFDEPKNYSVIVMFTAL
    HEFSS
    CVMCKGAAEEFQILANSYQHPGAFTTKVFFAMVDYDESPEVFEALQITLVPNFFHFSAKWEFTTDDIYGLRGRDI
    VADQLAEWVAERTHVSVSLRQPTKNYHGLLKPAILLTLIGGLGYSLKWHRKSISCSILCKFSTLCFVILMISGQIWTYIR
    GEPYAQRDPRTGQKHYISKLSQAQFAAETYIISLLNMCVTLGMLLLDKATTSRTNIIKRKMMCLCGVCLVAIFFSWLLAL
    FRFKIPDYPYSFLFD

    >gi|296207814|ref|XP_002750805.1| PREDICTED: peroxiredoxin-1-like [Callithrix jacchus]
    MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDS
    HFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGVLRQITVNDLPVGRSVDETLRLV
    QAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFCKQK

    >gi|296207947|ref|XP_002750865.1| PREDICTED: thioredoxin domain-containing protein 12-like [Callithrix jacchus]
    METRPRLGATCLLGFSFLLFVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAEST
    EISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQGYIVQGMKEAQERL
    TGDAFREKHLEDEL

    >gi|296207959|ref|XP_002750881.1| PREDICTED: glutathione peroxidase 7-like [Callithrix jacchus]
    MVVVATAAAWLLLWAAACAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFN
    VLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVSPDGKVVGAWD
    PTVSVEEIRPQITALVRKLILRKREDL

    >gi|296208118|ref|XP_002750947.1| PREDICTED: peroxiredoxin-6-like [Callithrix jacchus]
    MPGGLLLRDVAPNFEAYTTVGPIRFHDFLGDSWGILFSHPRDFTPVCTAELSRAAKLAPEFAKRNVKLIARSIGSVEDHL
    AWSKDINAYNGEEPTEKLPFPIIDDKNRDLAILLGMLDPTEKDEKGMPVTAHVVFVFGPDKKLKLSILYPATTGRNFDEI
    LRVAISLQLTAEKRVATPVDWKDGDSVMVLPTTPEEEAKKLFPKGVFTKELLSGKKYLGYTPQP

    >gi|296208231|ref|XP_002750994.1| PREDICTED: thioredoxin-like [Callithrix jacchus]
    MVKQIENKCAFREALNKPGDKPIVDFPATCCKLCKIIKFFHSLSAKYSKVVLLEVDIENCQEVFSDYEVKCISTFYLKTK
    NKKQKVCKFSGTDKKKFEVTINELI

    >gi|296209088|ref|XP_002751393.1| PREDICTED: thioredoxin domain-containing protein 3 [Callithrix jacchus]
    MASKKREAQLQAVVDSQSLWDEMLQNKGLTVIDVYQAWCGPCKAMQPLFRKLKNELNEDEILHFAIAEADNIVTLQPLRD
    KCEPVFLFSVNGKIIAKIQGANAPLVSKKVVNLIDEERKIAAGEMARPQYPEIPLVDLDSEADEEALHESDQESYSIAII
    KPDAVISRKGVEIKRKITKAGFFIEAEDKIVLTEEQVVNFYSRIVDQPDFEEFVSFMTSGLSYVLVLSQRSKHHPPSEET
    EPQPDTEPHKPSEDQPEVKAKVTTGVTKKKRDSLQEYLGSQHESQLCDIEEDAANVAKFLDIFFPDFKKIKRMKLEKILA
    LLRPNLFHERKDDVLHIIKDEDFKILEQRQLVLSEDEAQALCKEYENEDYFKKLIENMTSGPSLALVLLRDNGLEHWKQL
    LGPRTVEEAIEYFPESLCARFAMDSLPVNQLYGSDSLETAEMEIKHFFPLQSTLALIKPHATREQREKILKIIKEAGFEL
    TQVKQILLTPDQAEKIYSKITGKDFYKDLLEMLSEGPSMVMVLTKWNAVAKWRLLIGPTDPEEAKVLSPDSIRAQFGISK
    LRNIVHGASTVYEAKEVINRLFEDFSSENPEEN

    >gi|296209531|ref|XP_002751577.1| PREDICTED: anterior gradient protein 3 homolog [Callithrix jacchus]
    MMLHSASALCLLLVTVSSNLAIAIRKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQGLKRV
    FAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPLLIENMKKALR
    LIQIEL

    >gi|296209533|ref|XP_002751578.1| PREDICTED: anterior gradient protein 2 homolog isoform 1 [Callithrix jacchus]
    MEKISVSAFLLLVALSYTLAKDTTVKPGAKKDTKDSQPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDE
    CPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPSDTALL
    LDNMKKALKLLKTEL

    >gi|296209535|ref|XP_002751579.1| PREDICTED: anterior gradient protein 2 homolog isoform 2 [Callithrix jacchus]
    MEKISVSAFLLLVALSYTLAKDTTVKPGAKKDTKDSQPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDE
    CPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPSDTALL
    LDNMKKALKLLKTEL

    >gi|296209967|ref|XP_002751790.1| PREDICTED: dihydrolipoyl dehydrogenase, mitochondrial isoform 2 [Callithrix jacchus]
    MQSWSRVYCSLAKRGHFSRVSHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTC
    LNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKN
    QVTATKADGSTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
    AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTK
    NLGLEELGIELDPRGRIPVNTRFQSKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVA
    WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
    ARVCHAHPTLSEAFREANLAASFGKSINF

    >gi|296209969|ref|XP_002751791.1| PREDICTED: dihydrolipoyl dehydrogenase, mitochondrial isoform 3 [Callithrix jacchus]
    MQSWSRVYCSLAKRGHFSRVSHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCVEKNETLGGTC
    LNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKIDEDTIVSSTGALS
    LKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGK
    IDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQSKIPNIYAIGDVVAGPMLAHKAED
    EGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTD
    RVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

    >gi|296211948|ref|XP_002752627.1| PREDICTED: methyltransferase-like protein 7B-like [Callithrix jacchus]
    MDVLVPLLQLLVLLLTLPLHLLALLGCWQPLCKTYFPYLMAVLPRKSNHKMESKKRELFSQIKGLMGASGKVALLELGCG
    TGANFQFYPAGCRVTCLDPNPHFEKFLTKSMAENRHLQYEQFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRNVLQEV
    QRVLRPGGVLFFWEHVAEPQGSWALMWQQIVEPTWKHIADGC
    CLTRETWKDLEKAGFSEVQMERQPSLFKWLPVGPHIMG
    KAVK

    >gi|296212260|ref|XP_002752755.1| PREDICTED: methionine-R-sulfoxide reductase B3, mitochondrial-like [Callithrix jacchus]
    MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCV
    VCGTPLFKSETKFDSGSGWPSFHDVISSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY
    CINSAALSFT
    PVDSDGAAAEGGSGVASPAQADKAEL

    >gi|296212750|ref|XP_002752974.1| PREDICTED: thioredoxin reductase 1, cytoplasmic isoform 1 [Callithrix jacchus]
    MGCVDCKAVAVDTPPELQTKGKNGGGRRRSAKDHHPSKTLPENPAAFTSTDTADPRALLQAYIDSHSVVIFSRSTCTRCT
    EVKKLFKSLCVPYFVLELDQTEDVRALEGALLELAAETDLPIVFVKQRKIGGHGPTLKAHQEGRLQKLLKMNGPEDLPES
    CDYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGT
    CVNVGCIPKKLMHQAALLGQALQDSRNYGW
    KVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYL
    GIPGDKEY
    CISSDDLFSLPYCPGKTLIVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFI
    RQFVPIKVEQIEAGTPGRLRVVAQSTNNEEIIEGEYNTVLLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPY
    IYAIGDILEGKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWP
    LEWTIPSRDNNKCYAKIICNTKDSERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRS
    GASILQAGC

    >gi|296212753|ref|XP_002752975.1| PREDICTED: thioredoxin reductase 1, cytoplasmic isoform 2 [Callithrix jacchus]
    MEDVRALEGALLELAAETDLPIVFVKQRKIGGHGPTLKAHQEGRLQKLLKMNGPEDLPESCDYDYDLIIIGGGSGGLAAA
    KEAAQYGKKVMVLDFVTPTPLGTRWGLGGT
    CVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNH
    IGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEY
    CISSDDLFSLPY
    CPGKTLIVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLR
    VVAQSTNNEEIIEGEYNTVLLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKVELTPVAIQ
    AGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICN
    TKDSERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC

    >gi|296213817|ref|XP_002753431.1| PREDICTED: protein disulfide-isomerase A3 isoform 1 [Callithrix jacchus]
    MRLCRLTLFPGVALLLAAARLAAASDVLELTDDNFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPL
    AKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLKTEEEFQKFISDKDASVVGFF
    KDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEHDDNGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI
    FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTT
    GEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPDSNDGPVKVVVAENFDEIVNNEDKDVLIE
    FYAPW
    CGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
    QREATNPPVIQEEKPKKKKKAQEDL

    >gi|296213819|ref|XP_002753432.1| PREDICTED: protein disulfide-isomerase A3 isoform 2 [Callithrix jacchus]
    MRLCRLTLFPGVALLLAAARLAAASDFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKI
    FRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLKTEEEFQKFISDKDASVVGFFKDSFSEAHSEFLKAASNLRDNYRFA
    HTNVESLVNEHDDNGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYY
    DVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRD
    GKALERFLQDYFDGNLKRYLKSEPIPDSNDGPVKVVVAENFDEIVNNEDKDVLIEFYAPW
    CGHCKNLEPKYKELGEKLSK
    DPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL


    >gi|296214875|ref|XP_002753895.1| PREDICTED: glutaredoxin-related protein 5, mitochondrial-like [Callithrix jacchus]
    MVRRGKFPGVGETRDTSALFRRPALQHSDTPHRTHCAGSRPGQQQLGGAAGLLVKDKVLVFLKRTLEQSQCGFSNTVMHI
    LRPHSIRDYKAYKVLDDLELRHGIKDYSNWPTIPRANLNGESVRGCNILLQMCQNGDLIGELRKLGIHFTLLDKKKDQGS
    K

    >gi|296215002|ref|XP_002753945.1| PREDICTED: thioredoxin-related transmembrane protein 1-like [Callithrix jacchus]
    MAPSGSLAVPLAVLVLLLWGPPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNV
    AKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPDSVLMSSMSALFQLSM
    WIRTCHNYFIEDLGLPVWGSYTIFALVTLLSGLLLGLCMIFVADCLCPSKRRRPQPYPSKKLSESVKPLKKVEEEQEADE
    EDVSEEEAERKEGTNKDFPQNAIRQRSLGPSSATDKS

    >gi|296215032|ref|XP_002753955.1| PREDICTED: ERO1-like protein alpha [Callithrix jacchus]
    MGRGSGFLIGLLGAVWLLGSGHGEQQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVN
    LKRPCPFWNDISQ
    CGRRDCAVKPCQSDEVPVGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDD
    SSDNFCEADDIQSPDAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGKSEENTFYSWLEGL
    CVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLP
    FFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDRKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLW
    GKLQTQGLGTALKILFSEKLIANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH

    >gi|296215506|ref|XP_002754155.1| PREDICTED: iron-sulfur cluster assembly 2 homolog, mitochondrial-like [Callithrix jacchus]
    MAAVRGLSLTAATQKVVTHWPKGRLLAASLGLRARREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCS
    GFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSVKL

    >gi|296215598|ref|XP_002754197.1| PREDICTED: maleylacetoacetate isomerase-like [Callithrix jacchus]
    MQAGKPVLYSYFRSSCSWRVRIALALKGIDFEMVPVNLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLE
    ETRPTPRLLPQDPKKRASVRMISDLIASGIQPLQNLSILKKVGEVSKDLREETKLTWAQNAITSGFNALEQILQSTAGKY
    CVGDEVTMADLCLVPQVANAERFKVDFTPYPTISCINKRLLALEAFQLSHPCRQPDTPTELRA

    >gi|296215841|ref|XP_002754322.1| PREDICTED: hypothetical protein LOC100405283 [Callithrix jacchus]
    MEDHRWYGPRLLRLCVGVLVVSLMAPGPSMVFLERERIIGFFIRSGGPNEDHRGTGRTTAGRGGLRLVSLGPRAIVGFGE
    RAGMSGSLRRAAAALLRWGRGAGGGGFWVPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQ
    CGFSNAVVQIL
    RLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK


    >gi|296218281|ref|XP_002755344.1| PREDICTED: thioredoxin-related transmembrane protein 2-like isoform 2 [Callithrix jacchus]
    MAILAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCNGLPTQREDGNPCDFDWREVEILMFLSAIVMMKN
    RRSMFLMTCKPPLYMGPENIKYFNDKTIDEELERDKRVTWIVEFFANWSND
    CQSFAPIYADLSLKYNCTGLNFGKVDVGR
    YADVSTRYKVSTSPLTKQLPTLILFQGGKEVMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQ
    PVAPSPTSVSDAESKKDK

    >gi|296218659|ref|XP_002755522.1| PREDICTED: peroxiredoxin-5, mitochondrial-like [Callithrix jacchus]
    MGLATLCVLRRPAGFVLFGGAAGQFVATGAAAAARAAARRRGEGGWASGGVRSFSRVAAAMAPIKVGDAIPAVEVFEGEP
    GNKVNLAELFKGKKGVLFGVPGAFTPG
    CSKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVE
    PDGTGLTCSLAPNIISQL

    >gi|296219624|ref|XP_002807448.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin domain-containing protein 11-like [Callithrix jacchus]
    MSECRGRGGGSSSSEDAEDEGGGGGGPAGSDCLSPSPAPATASSAGRLRHGLRGVSLMACRRPELLCGAVALGCALLLAL
    KFTCSRAKDVIIPAKPPVSFFSPRSPVLDLFQGQLDYAEHVRRDSEVVLLFFYAPWCGQSIATRAEIEQAASRLSDQVLF
    VAINCWWNQGKCRKQKHFFYFPVIYLYHRSFGPIEYKGPMSAVYIEKFVRRVMKPLLYIPSQSELLDFLSNYEPGVLGYF
    EFSGSPQPPGYLTFFTSALHSLKKALESTSSPRVLISFTRECKWHXETKIIYVLDYLGTVRFGVITNKHLAKLVSLVHSG
    SVYLHRHFNTSLVFPREVLNYTAENICKWALENRETLFRWLRPHGGKSLLLNNELKKGPALFLFIPFNPLAESHPLIDEI
    TEVALEYNNCHGDQVVERILQHLRRVDAPMLESLALEPPAQLPDPPLITASPCCNTVVLPQWHSFSRTHNVCELCVNQTA
    VGVKPSSVSMPQCSFFEMAAALDSFYLKEQTFYHVASDSIECSNFLTSYSPFSYYTACCRTISRGVAGFIDSELEAPTIA
    FSSFEKKCEVDAPSSIPHIEENRYLFPEVDMTSTNFTGLSCRTNKTLNIYLLDSNLFWLYAERLGAPSSTQVKEFATIVD
    MKEESHYILDPKQALMKLTLESFIQNFSVLYSPLKRHLIGSDSAQFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPW
    CG
    F
    CPSLNHVFIQLARNLPMDTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCNRKDLSVKYPEDVPITLPNLLRFILHHSDH
    SSSPQNVANSPTKECLQSEAVLQQGHISHLEREIQKLRAEISSLQRAQGQVESQLSSARRDEHRLRQQQRALEEQHSLLH
    THSEQLQALYKQKTRELEELARKLQELADASENLLTENTWLKILVATMERKLEGRDKTESLAAQREVRSEQPEPSGAPRL
    PGSPPPANASATLASERSSENRTD

    >gi|296220243|ref|XP_002756224.1| PREDICTED: uncharacterized protein C10orf58-like [Callithrix jacchus]
    MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLENEPRTLKAKELWEKNGAVIMAV
    RRPG
    CFLCREEAADLSSLKPKLDELGVPLYAVVKEHIKTEVKDFQPYFKGEVFLDEKKKFYGPQRRKMMFMGFIRLGVWY
    NFFRAWNGGFSGNLEGEGFVLGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEQK

    >gi|296220917|ref|XP_002756694.1| PREDICTED: thioredoxin-like [Callithrix jacchus]
    MTKNHISIGSNCSSDPSSQDGKQIDSKDAFQEAMDAAGDKLVVVDFSATWYGPCKMIKPFFNSLSEKYSSVGFLEVDVDD
    CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

    >gi|296221168|ref|XP_002756473.1| PREDICTED: glutathione S-transferase omega-1-like [Callithrix jacchus]
    MYPTGGSRDRGPPSSHVKLVLTEKGKACPDGWANLQRAIAKLRRRATYFLNRLQTSEELAPLCDTMSGESARSLGKGSAP
    PGPVPEGLIRVYSMRF
    CPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDE
    AYPGKKLFPDDPYEKACQKMVFELFSKVPSLVGSFIRSQNKEDCAGLKEEFRKEFSKLEKVLTNKKTTFFGGSSISMIDY
    LIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSVKDWQGFLELYLQNSPEACDYGL

    >gi|296221170|ref|XP_002756474.1| PREDICTED: glutathione S-transferase omega-2-like [Callithrix jacchus]
    MHLQAISTSAQSWKTQGVIFSPAEIQDLGLSASVPKPPPLFHLNGKAVPVAPIWLDCWQYRLPSAPPEPSSSKTESGTRG
    ARQSTADSGARGSGGQPPGGDCERRAMLRRLETLPENAARALGKGSQPPGPVPEGLIRIYSMRF
    CPCSHRIRLVLRAKGI
    RHEVVNINLKNKPEWYYTKHPFGQIPVLETSQCQLIYDSVIACEYLDDAYPGRKLFPYDPYQRAWQKMLLELFCKVPHLT
    KKCLVALRCGRECTGLKAALHQEFCNLEEILEYQNTTFFGGACISMIDYLLWPWFERLDVYGIADCLSHMPALRLWISAM
    KQDPTVCALLTDKCVFQGFLNLYFQDNPDAFDFGLD

    >gi|296221249|ref|XP_002756652.1| PREDICTED: NHL repeat-containing protein 2 [Callithrix jacchus]
    MAAPGARSRSLSGLLPAQTSLEYALLDAVTQQEKNSLVYQYLQKVDGWEQDLSVPEFPEGLEWLNTEEPISVYKDLCGKI
    VILDFFTYC
    CINCIHLLPDLRALEHTYSDKDGLLIISVHSAKFPNEKVLDNIKSAVLRYNITHPVVNDADASLWQELEIS
    CWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKDRGQIRDDKIGIKLYKDSLPPSPLLFPGKVTVDQVTNRLVI
    ADTGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNTIYVADTENHLIRKIDLEAEKVSTVAGIGIQ
    GTDKEGGAQGEQQPISSPWDVVFGTSGPEVQRDDILWIAMAGTHQIWALLLDSGKLPKKNELTKGTCLRFAGSGNEENRN
    NAYPHKAAFAQPSGLSLASEDPWSCLFVADSESSTVRTISLKDGAVKHLVGGERDPMNLFAFGDVDGVGINAKLQHPLGV
    TWDKKRNLLYVADSYNHKIKVVDPKTKHCTTLAGTGDTNNVTSSSFTESTFNEPGGLCIGENGQLLYVADTNNHQIKVMD
    LETKMVSVLPIFRSENVVVDGPFLVEKQKTLPKLPKSAPNIRLSPMTACAGQTLQFKLRLDLPSGSKLTEGVPSCWFLTA
    EGNEWLLQGQIPSGDIENISNQPTVSLQIPKDCLSLEAIVSISVFLYYCSADSSACMMKAVLFSQPLQITDTQQGCIAPV
    ELRYVF

    >gi|296221338|ref|XP_002756684.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like isoform 1 [Callithrix jacchus]
    MAAAVRRLLRSSVARHVSSLPWGISATAALRPAVCGRTSLTNILCSGSGQAKFFSSSSSYHAPAVTQHAPYFKGTAVVNG
    EFKDLSLDDFKGKYLVLFFYPLDFTFV
    CPTEIIAFSDKVNEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIAL
    LSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
    KPSPDASKEYFQKVNQ

    >gi|296221340|ref|XP_002756685.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like isoform 2 [Callithrix jacchus]
    MAAAVRRLLRSSVARHVSSLPWGISATAALRPAVCGRTSLTNILCSGSGQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVL
    FFYPLDFTFV
    CPTEIIAFSDKVNEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLE
    GPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPDASKEYFQKVNQ

    >gi|296221352|ref|XP_002756704.1| PREDICTED: thioredoxin-like [Callithrix jacchus]
    MVKQIESKVAFQEALEAASEKLVVVNFSATWYGPCKQIKPSSHSLSEKNSHMVFFEVHVDDCQDLASECEAKCMPTFHHR
    ARSTFQFFKKGQKVGEFSGANKEKLEASINELV

    >gi|296221472|ref|XP_002756763.1| PREDICTED: methylated-DNA--protein-cysteine methyltransferase-like [Callithrix jacchus]
    MLGQPALLEHFASRRLQVLAVRTVCDLVLGKMDKTCEMKRTTLDSPLGKLELSGCEQGLHKISFLGQGTPAADAMEVPAP
    AEVLRGPEPLKQCAAWLNAYFQQPEAIEELPVPALHHPVFQQESFTRQVLWELLKAVKFGEVVSYQQLAALAGNPKAARA
    VGGAMRSNPVPILIP
    CHRVVCSSGAMGNYSGGLAVKEWLLVHEGHRVGKPALGRSSRRAGAWLRAVGPTSGSPPAGPN

    >gi|296221476|ref|XP_002756760.1| PREDICTED: glutaredoxin-3-like [Callithrix jacchus]
    MAAGAAAAAVGAVEEVGSVGQFEELLSLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKEHPQVSFAKLEAEGVPEVSEKY
    EISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFPPSANEHLKEDLNLRLKKLTRAAPCMLFMKGTPQEPR
    CG
    FSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELVGGLDIIKELEASEELDKICPKAPKLEERLK
    VLTNKASVMLFMKGNKQEAK
    CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKE
    LKENGELLPILRGEN

    >gi|296221641|ref|XP_002756839.1| PREDICTED: peptide methionine sulfoxide reductase-like isoform 1 [Callithrix jacchus]
    MLSATRRARQLLHSLFAVPRMGDSASKIVSPQEALPGRKEPIPVAAKHHVNGNRTVEPFPEGTQMAIFGMGCFWGAERKF
    WVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHISFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIY
    PTSAKQMEAALSSKEDYQKVLSEHGFGPITTDIRERQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPMGIKK

    >gi|296221896|ref|XP_002756954.1| PREDICTED: tumor suppressor candidate 3-like [Callithrix jacchus]
    MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAP
    PRNYSMIVMFTALQPQRQ
    CSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRP
    KRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
    AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLG
    LVVFFFSFLLSIFRSKYHGYPYSDLDFE

    >gi|296221934|ref|XP_002756967.1| PREDICTED: glutathione reductase, mitochondrial-like isoform 1 [Callithrix jacchus]
    MALLPRALSSGGRPSWRRAARASRGFPLPPPFPAAATHALSRVMACRQEPQPQGPPPSAGAVVSYDYLVIGGGSGGLASA
    RRAAELGARAAVVESHKLGGT
    CVNVGCVPKKVMWNTAVHSEFLHDHGDYGFSSCEGKFNWRVIKEKRDTYVSRLNTIYQN
    NLTKAHIEIIHGHAVFTSDTKPTIEVSGRKYTAPHILIATGGMPSSPHESQIPGASLGITSDGFFELEELPSRSVIVGAG
    YIAVEIAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTSSGLEVSLVTAVPGRLPVM
    TTISDVDCLLWAIGRDPNSKGLSLNKLGIKTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEN
    KEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGKENVKIYSTSFTPMYHAVTKRKTKCVMKMVCAYEEEKVVGIHMQ
    GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR

    >gi|296221938|ref|XP_002756969.1| PREDICTED: glutathione reductase, mitochondrial-like isoform 3 [Callithrix jacchus]
    MALLPRALSSGGRPSWRRAARASRGFPLPPPFPAAATHALSRVMACRQEPQPQGPPPSAGAVVSYDYLVIGGGSGGLASA
    RRAAELGARAAVVESHKLGGT
    CVNVGCVPKKVMWNTAVHSEFLHDHGDYGFSSCEGKFNWRVIKEKRDTYVSRLNTIYQN
    NLTKAHIEIIHGHAVFTSDTKPTIEVSGRKYTAPHILIATGGMPSSPHESQIPGASLGITSDGFFELEELPSRSVIVGAG
    YIAVEIAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQGIKTDDKGHIIVDEFQNTNVKGIYAV
    GDVCGKALLTPVAIAAGRKLAHRLFENKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGKENVKIYSTSFTPMYHA
    VTKRKTKCVMKMVCAYEEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR

    >gi|296221936|ref|XP_002756968.1| PREDICTED: glutathione reductase, mitochondrial-like isoform 2 [Callithrix jacchus]
    MALLPRALSSGGRPSWRRAARASRGFPLPPPFPAAATHALSRVMACRQEPQPQGPPPSAGAVVSYDYLVIGGGSGGLASA
    RRAAELGARAAVVESHKLGGT
    CVNVGCVPKKVMWNTAVHSEFLHDHGDYGFSSCEGKFNWRVIKEKRDTYVSRLNTIYQN
    NLTKAHIEIIHGHAVFTSDTKPTIEVSGRKYTAPHILIATGGMPSSPHESQIPGASLGITSDGFFELEELPSRSVIVGAG
    YIAVEIAGILSALGSKTSLMIRHDKVKEVKKTSSGLEVSLVTAVPGRLPVMTTISDVDCLLWAIGRDPNSKGLSLNKLGI
    KTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFENKEDSKLDYNNIPTVVFSHPPIGTVGLTED
    EAIHKYGKENVKIYSTSFTPMYHAVTKRKTKCVMKMVCAYEEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVA
    IHPTSSEELVTLR

    >gi|296221940|ref|XP_002756970.1| PREDICTED: glutathione reductase, mitochondrial-like isoform 4 [Callithrix jacchus]
    MALLPRALSSGGRPSWRRAARASRGFPLPPPFPAAATHALSRVMACRQEPQPQGPPPSAGAVVSYDYLVIGGGSGGLASA
    RRAAELGARAAVVESHKLGGT
    CVNVGCVPKKVMWNTAVHSEFLHDHGDYGFSSCEGKFNWRVIKEKRDTYVSRLNTIYQN
    NLTKAHIEIIHGHAVFTSDTKPTIEVSGRKYTAPHILIATGGMPSSPHESQIPGASLGITSDGFFELEELPSRSVIVGAG
    YIAVEIAGILSALGSKTSLMIRHDKGIKTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFENKE
    DSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGKENVKIYSTSFTPMYHAVTKRKTKCVMKMVCAYEEEKVVGIHMQGL
    GCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR

    >gi|296222183|ref|XP_002757089.1| PREDICTED: glutaredoxin-related protein 5, mitochondrial-like [Callithrix jacchus]
    MERPSKRQLYHPRGARLRRRQSTLYIKKQKTRAIVGFGERAGMSGSLRRVAAALLRWGRGAGGGGFWGSGAGGGGSAEQL
    DALVKKDKVVVFLNGTPEQPQ
    CGFSNAVVQILRLHGVRDYAAYSVLDDPELRQGIKDYSNWPTIPQGYLNGEFVGGCDIL
    LQMHQNGDLVEELKKLGIHSALLDKKKDQDSK

    >gi|296222224|ref|XP_002757096.1| PREDICTED: thioredoxin domain-containing protein 2-like [Callithrix jacchus]
    MDIDKELVMESVKPGAPGKPEMRLGTKEETNEGDANESSLEVLSSNVPLLTLDFLDTTQAKEKVFLPMVSHTFHMPTEES
    DAPQQGDDLSESSANTSQPKQNDLPKSSAKPIQPKLGTIPKSSAKPIQPKLGTIPKSSAKPIQPKLDSIPKSSAKPIQPK
    QGDTSKSSVKTIQPKLGNIPKSSVKPSQPKSPEETIQAKEGDIPKSQEETIQAKESDITKSPEETIQAKESDITKSPKEA
    IQPKEGDIPKLPEEAIQPKEGDIPESPEEAIQPKEGDILIKPEEETTESLEGDMVKMILSKEDFEAALKEAGQKLVAVDF
    SATW
    CGPCRTIRPFFHALSEKHEDVVFLEVDADGCEEVVRDCAVMCVPTFQFYKKEEKVDEFCGALKEKLEAVIAELK

    >gi|296222706|ref|XP_002757317.1| PREDICTED: thioredoxin-like protein 1-like [Callithrix jacchus]
    MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFL
    FFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESD
    CDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
    VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH

    >gi|296222850|ref|XP_002757365.1| PREDICTED: protein disulfide-isomerase TMX3-like [Callithrix jacchus]
    MAAWRCRAALRLCATVVLLDMVVCKGAVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVG
    KMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYIGGE
    SPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYLAMDGFLLY
    ELGDTGKLVAIAVIDEKNTSVEHTRLKSIIQEVARDYRDLFHRDFQFGHMDGNDYINTLLMDELTVPTVVVLNTSNQQYF
    LLDRQIKNVEDMVQFINNILDGIVEAQGGDSIWQRLKRIVFDAKSTVVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTAD
    TDGGYIEERYEVSKSENENQEHKEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD

    >gi|296223053|ref|XP_002757463.1| PREDICTED: thioredoxin domain-containing protein 9-like isoform 1 [Callithrix jacchus]
    MEADASVDMFSKVLENQLLQTTKIVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKKVVCHFYRDSTFR
    CKILDRHLVILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALVKDGKTQDYVVG
    FTDLGNTDDFTTETLEWRLGCSDILNYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

    >gi|296223055|ref|XP_002757464.1| PREDICTED: thioredoxin domain-containing protein 9-like isoform 2 [Callithrix jacchus]
    MEADASVDMFSKVLENQLLQTTKIVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSER
    DFFQEVKESKKVVCHFYRDSTFR
    CKILDRHLVILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALVKDGKTQDYVVG
    FTDLGNTDDFTTETLEWRLGCSDILNYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

    >gi|296223082|ref|XP_002757470.1| PREDICTED: phosducin-like protein 3-like [Callithrix jacchus]
    MERCCWVRERMHGALSVLLLLQQMCPQNSETGTKKDGKMEGVPEEERRRKALASALTRPGSSLGGAGEEAWRRCARAQKG
    AEGQGRRGTTGLSDWKQDAGKLEPGTGLEAAASRLSHWARGRRWKPALREARAPPALGRPGVSRPRAGAVREGGRGPNGT
    HGLGVPPLCARSRKPRSSRTTYPRNLSQPGPLKDPNTDTEWNDILRKKGILPPKESLKELEEEAEEEQHMVQQSVVTTYE
    DMTLEELKDHEDEFNEEDERAIEMYRRQRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPL
    CAL
    INQHLSGLASKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAVKTDLE
    ENPKKQIEDVLLSSVRRSVPTWRDSDSDGD

    >gi|296224489|ref|XP_002758076.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Callithrix jacchus]
    MALLGLGLVSSALFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGA
    VDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKK
    DVIELTDDSFDQNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
    KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVL
    LKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGG
    GAFPSIVEKEPWDGRDGELPVEDDIDLSDVELDDLGKDEL

    >gi|296224491|ref|XP_002758077.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Callithrix jacchus]
    MVPNSAPVYLMMLCGIIPLHSPALLLEIRVYMILGLVSSALFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYA
    PW
    CGHCQRLTPEWKKAATALKDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR
    QLVKDRLGGRSGGYSSGKQGRGDSSSKKDVIELTDDSFDQNVLDSEDVWMVEFYAPW
    CGHCKNLEPEWAAAASEVKEQTK
    GKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCE
    EHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALL
    KGSFSEQGINEFLRELSFGRGSTAPVGGGAFPSIVEKEPWDGRDGELPVEDDIDLSDVELDDLGKDEL

    >gi|296225263|ref|XP_002758417.1| PREDICTED: glutathione S-transferase omega-1-like [Callithrix jacchus]
    MSGESARSLGKGSAPPGPVPEGLIRVYSMRFCPFVERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQG
    QLIYESAITCEYLDEAYPGKKLFPDDPYEKACQKMVFELFSKVPSLVGSFIRSQNKEDCAGLKEEFRKEFSKLEKVLTNK
    KTTFFGGSSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSVKDWQGFLELYLQNSPEACDYG
    L

    >gi|296225638|ref|XP_002758586.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit isoform 1 [Callithrix jacchus]
    MADGEEPEKKRRRIEELLAEKMAVDGGCGDSGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGL
    GCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFH
    IIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIA
    SMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVI
    AAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSP
    AITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|296225640|ref|XP_002758587.1| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit isoform 2 [Callithrix jacchus]
    MADGEEPMAVDGGCGDSGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFR
    QIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRW
    INGMLISLLNYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPM
    CTIASMPRLPEHCIEYVR
    MLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATS
    AYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLY
    LQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

    >gi|296226095|ref|XP_002758800.1| PREDICTED: protein disulfide-isomerase A5 [Callithrix jacchus]
    MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAAENHLRLLSTVAQAVKGQGTI
    CWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHIDIEK
    DFRRLLKKEERPLLVMFYAPW
    CSVCKRMMPHFQKAATQLRGHAVLAGMNVHSSEFENIKEEYSVRGYPTICYFEKGRFLF
    QYDNYGSTAEDIVEWLKSPQPPQPQVPETPWADEGGSVYHLTDEDFDQFLKEHSSVLVMFHAPW
    CGHCKKMKPEFEKAAE
    ALHGEADSSGVLAAVDATINKALAERFHISEFPTLKYFKHGEKHEVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVL
    HLVGDNFRETLKKKKHTLVMFYAPW
    CPHCKKVIPHFTAAAAVFKDDRKIACAAVNCVKDKNQDLCQQEAIKGYPTFHYYH
    YGKFTEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL

    >gi|296226477|ref|XP_002758949.1| PREDICTED: ubiquitin-like modifier-activating enzyme 1-like [Callithrix jacchus]
    MSSSLLSKRRRVSGPGSELDSDCSSAYSVMSEVPSGPTQGMSKNNTEIHIDEDLYSRQLYVLGHEAMKYLQTSSVLVSGL
    RGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEASQSRLAELNGYVRVCTYTGPLVEDFLSGFQ
    VVVLTNTPLESQLQVGEFCHSRGIKLVVADTRGLFGQLFCDFGKDMILRDSNGEQPLSAMVSMITKDSAGVVTCLDEARH
    GFESGDFVSFREVQGMCELNDIHPIEIKVLGPYTFSICDTSSFSDYIGGGVVSQVKVSKKISFKSLLASLAEPDFVITDC
    AKYSRPAHLHIGFQALHQFCTQHSRPPRPHNEEDATELVTLAQAVNARALPSVRQGNLDVDLIRKLAHVAAGDLAPINAF
    IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKADLMEDRCLPRQNRYDGQVAVFGSDLQEKLAKQKYFVVGAGAIG
    CELLKNFAMIGLGCGEGGRITVTDMDTIEKSNLNRQFLFRPWDVSKFKSDTAAAAVRQINPHIRVMSQQNRVGPETECIY
    DDDFFQNLDAVASALDNVDARLYMDSRCVYYRKPLLESGTLGTKGSVQVVIPFLTESYSSSRDPPEKSIPI
    CTLKNFPNA
    IEHTLQWARDEFEGLFKQSAENVNQYLTNPKFMEQTLRLPGNQPLELLEHVHCSLVLQRPDTWADCVTWAYHQWHTQYSH
    NIQQLLHNFPPDQLTSSGTPFWSGPKRRPHPLIFDVSNPLHLDYVMAAANLFAKTYGLIGSRDRASVVTLLQSVHVPTFI
    PKSGVQIHVSDQELQSTSASVDDSRLEELKATLPSPEKLAGFKMYPTDFEKDDDSNFHMDFIMAASNLRAENYDIPPADR
    HKSKLIAGKIIPAIATTTAAIVGLVCLELYKVVQGHRKLHSYKNSFINLALPFFSFSEPLSPPCHQYYNKEWTLWDRFDV
    QGMQPDGKEMTLKQFLAFFRMEHKLEITMLSQGVSMLYSVFMPATKLKERLDQPITEIVSRVSKQKLGHHVRTLVLELCC
    NDESGEDIEVPYVRYVTC

    >gi|296228620|ref|XP_002759894.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial-like [Callithrix jacchus]
    MSASLVPATVPAVSKRKLQPTRATLTLTPAAVNKIKQLLKDKPEHVGVKGGVRTRGCNGLSYTPEYTKTKGDSEEEVIQD
    GVRVFIEKKAQLTLLGIEMDYVEDKLSSSRKAGGSLGAHCINHVTVTCLMYGCLLDSPNRGSVSGLKLTVWRGPFPRGLT
    RE

    >gi|296229407|ref|XP_002760224.1| PREDICTED: thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1-like [Callithrix jacchus]
    MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQ
    MGKRGLQATQLARDLGYTGARHYAGAYREWLEKEA

    >gi|296229510|ref|XP_002760355.1| PREDICTED: phosducin-like [Callithrix jacchus]
    MEEAKSLSLEEDFEGQATHTGPKGVINDWRKFKLESEDSDSTPPSKKEILRQMSSPQSRNSKDSKERVSRKMSIQEYELI
    HKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKITTIVVHIYEDGIKG
    CDALNDSLTCLAA
    EYPIVKFCKIKASNTGAGDRFSLDVLPTLLVYKGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREVHTLEHTKI
    EEEEDIE

    >gi|296229655|ref|XP_002760436.1| PREDICTED: sulfhydryl oxidase 1 [Callithrix jacchus]
    MQTKRNISGSFSEEGVTFVIRALGSAWRPALNLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFSKNGSGAVFPVAGADV
    QTLRERLIDALESHHDTWPPACPPLQPAKMKEIDGFFARNNEEYLALIFEKGGSYLGRESPEQLGAGVPVVAANCPLPML
    MESRSFYTAYLQRLSGLTREVPQTTVAPTTVNKIAPTVWKFADRSKIYMADLESALHYILRIEVGRFSVLEGQRLVALKK
    FVAVLAKYFPGQPLVQNFLHSVNEWLKRQKRRKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFH
    FLTVQAARQPVDHSQEAAKAQEVLQAIRGYVRFFFG
    CRDCAGHFEQMAAASMDQVGSPDAAALWLWSSHNKVNARLAGEV
    LLQKGWADAFPGQHWVRGWWLWLTLWDSSRGCREGWPYLGYRHLQPQQHPDSSK

    >gi|296229779|ref|XP_002760406.1| PREDICTED: peroxiredoxin-6-like [Callithrix jacchus]
    MPGGLLLGDVAPNFEANTTVGPIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHL
    AWSKDINAYNGEEPTEKLPFPIIDDKNRDLAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEI
    LRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

    >gi|296229966|ref|XP_002760504.1| PREDICTED: glutaredoxin-2, mitochondrial-like [Callithrix jacchus]
    MLLRRAALAGTRLVRSRSGRAGWLDGAAGAAASGMESNTSSSLENLATAPVNQIQETISNNCVVIFSKTSCSYCTMAKKL
    FHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

    >gi|296230906|ref|XP_002760933.1| PREDICTED: ERO1-like protein beta [Callithrix jacchus]
    MSKGVRRAGAGHGAAAAVQLLVTLSFLPSVVEAQVTGVLDDCLCDIGSIDTFNTYKIFPKIKKLQERDYFRYYKVNLKRP
    CPFWAEDGH
    CSIKDCHVEPCPESKIPVGIKAGHSNKYVKMANKTKELEDCEQANKLGAVNSTLSNQSKEAFIDWARYDDS
    RDHFCELDDERSPAAQYVDLLLNPERYTGYKGTSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLC
    LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFKRRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPY
    FERSIVDLYTGNVEEDADTKALLLNIFQDTKSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWG
    KLQTQGLGTALKILFSEKEIQKLPENSPSKGFQLTRQEIVALLNAFGRLSTSITELQNFKVLLQHSR

    >gi|296231484|ref|XP_002761165.1| PREDICTED: thioredoxin-like protein 4B-like [Callithrix jacchus]
    MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDVLSKTSSDLSKMAAIYLVDVDQTPVYTQYFDISYIPS
    TVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

    >gi|296232121|ref|XP_002761461.1| PREDICTED: hypothetical protein LOC100391926 [Callithrix jacchus]
    MAEAAEPEGGASGPQGPPEGPAPLAERSGEPGAGGPGAEEREASEGAEEATRGAAAVKEAGGGGPDRVRGAEAHGTRGAQ
    GEAEAEEGAPEGAKVPPGGEEASGALQVEGANPGRGVQGEDSEEAQGAPGDSAVAERQEEAEHRPQESEGSAPGASGDAV
    DAEGPAGDTGDAERPAGNFVEAESRAGDRVDAEGLAGDSVEAESRAGDRVDAEGLAGDSEDAEGLAGDSVEAESRAGDSL
    DAESRAGDSVDAESRAGDSVEAEGPAGDSVDLEGPAGDSVDLEGPAGDSVELEGPAEDSMDAEGPAGGVRQVSSEPQEGG
    DRSLQPQAEAIEVAAGESAGHSLGELAPDAAEEAEAPGEKGSEEAAPRDGGADADAGEDGVRDGPQQELGEEEERRERSP
    EGPSEEAAAGGEEERPDCCPDGDALRGAAEPQAELSNHLAEEGPTEGGDVAARENGSREDGEASEERAPGQEHDITLYVK
    AGYDGESIGN
    CPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAPPRY
    PKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEVYEKNLLKALKKLDSYLNSPLPDEIDAYSTEDAAVSVRKFLDGDEL
    TLADCNLLPKLHIIKIVAKKYRDFEFPSDMTGIWRYLNNAYSRDEFTNTCPADQEIEHAYSDVAKRMK

    >gi|296233039|ref|XP_002761827.1| PREDICTED: peroxiredoxin-2-like [Callithrix jacchus]
    MASGNAHIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQ
    FTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFVIDGKGVLRQITVNDLPVGRSVDEALRLVQ
    AFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

    >gi|296233281|ref|XP_002761946.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Callithrix jacchus]
    MALPPLLLFLPPLLLLLDVPTAAVQASPLQALDVFGNGPPVNQKMGSLYLRKQLKESIPAEAAQLVNVTLYYEALCKGCR
    TFLIRELFPTWLMVMEILNVTLVPYGNAQEQNVSGRWEFRCQHGEEECKFNKVEACLLDELEMDLAFLTIVCMEEFDNME
    ESLPLCLQLYAPDLSPDTVMKCAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLQDMSQLLALVCQLYQGKKPDT
    CPPSTSSLRSVCFK

    >gi|296233516|ref|XP_002762047.1| PREDICTED: SUMO-activating enzyme subunit 2 [Callithrix jacchus]
    MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESV
    LQFYPKANIIAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYE
    CHPKPTQRTFPG
    CTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
    KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYAR
    LFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVL
    EGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
    QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAE
    DAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEDSSNNTDVSEEERSRKRKLDEKENLSAKRSRIEQKEELDDVIALD

    >gi|296235130|ref|XP_002762771.1| PREDICTED: peroxiredoxin-4-like [Callithrix jacchus]
    MEALQMLAATTPAHGRHLRLLLLPLLLFLLPAGAVQGLETEERPRNREEECHFYAGGQVYPGEASRVSVADHSLHLSKAK
    ISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFV
    CPTEIIAFGDRLEEFRAINTEVVACSVDSQFTHLAWI
    NTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
    HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

    >gi|296235356|ref|XP_002762866.1| PREDICTED: ubiquitin-like modifier-activating enzyme 1-like [Callithrix jacchus]
    MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLR
    GLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPHLAELNSYVPVTAYTGPLVEDFLSGFQV
    VVLTNTPLEDQLRVGEFCHSRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHG
    FESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVMTDFG
    KFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDATELVALAQAVNARALPAVQQGNLDEDLIRKLAYVAAGDLAPINAFI
    GGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDREALTEDKCLPHQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGC
    ELLKNFAMIGLGCGEGGEIVITDMDTIEKSNLNRQFLFRPWDVTVSTSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIYD
    DDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPI
    CTLKNFPNAI
    EHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSNN
    IRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATLLQSVQVPEFTP
    KSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPPADRH
    KSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQ
    GLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCN
    DESGEDVEVPYVRYTIR

    >gi|296235841|ref|XP_002763069.1| PREDICTED: magnesium transporter protein 1-like [Callithrix jacchus]
    MSKCLKMMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYS
    SAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYA
    GPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVA
    ETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKTF

    >gi|296235849|ref|XP_002763072.1| PREDICTED: copper-transporting ATPase 1 [Callithrix jacchus]
    MDPNMGANSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAILHNPDP
    LPVLTDTLFLTVTASLTLPWDRIQSTLLKTKGVTDIKIYPQQRTLAVTIIPSVVSANRIRELVPDLSLDTGTLEKKSGAC
    EDHSMAQVGEVTLKMKVEGMT
    CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKK
    QPKYLKLGAIDVERLKNTALKSSEGSQQRSPSYTNDSTATFIIDGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAVVK
    YNASSITPECLRKAIEDLSPGQYRVSISSEFESTSNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVIS
    KKPGVKSIRVSLANSNGTIEYDPLLTSPETLREAIEDMGFDATLSDVNEPLVVIAQPSSETLLLTSTNEFYTKGMTPVQD
    KEEAKTSSKCYIQVTGMT
    CASCVANIERNLRREEGIYSILVALMAGKAEVRYNPTVIQPPMIAEFIRELGFGATVIENAD
    EGDGVLELVVRGMT
    CASCVHKIESTLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSASH
    LDHKREIRQWRRSFLVSLFFCIPVMGLMIYMMVMDHHFATLHHNQTMSKEEMINFHPSMFLERQILPGLSIMNLLSFLLC
    VPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPVTFFDTPPMLFVFIALGRWLEHI
    AKGKTSEALAKLISLQATEATIVTLDSDNFLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMP
    VAKKPGSTVIAGSINQNGSLLIRALMLEQIPTLSSIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLLVWIVIG
    FLNFEIVETYFPGYNRSISRTETILRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKV
    VVFDKTGTITHGTPVVNQVKVLTESNRISQHKILAIVGTAESNSEHPLGAAITKYCKQELDTETLGTCIDFQVVPGCGIS
    CKVTNIEGLLHKDNWKIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNAFNAQQYKVLIGNREEWMIRNGLVINNYV
    DDFMTEHERKGRTAVLVAVDGKVFHKLCCGLRHALRPESLHCSVLHQERQAASAVGVYLSRDGLPRQRLAASAGRPPPPR
    LPASPGRPTAWRPVSFYTWEFPRSVGNKDQSGNAALTHRLRIQRELQSWVGITKVFAEVLPSHKVAKVKQLQEEGKRVAM
    VGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFM
    PIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVN
    YSRASINSLLSDKRSLNSAVTSEPDKHSLLVGNFREDDDTTL

    >gi|296236800|ref|XP_002763475.1| PREDICTED: chloride intracellular channel protein 2-like [Callithrix jacchus]
    MSGLRPSTLVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELK
    TDFIKIEEFLEQTLAPPRYPHLSPRYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDP
    DSAEEPTVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
    NVAKQKS

    >gi|296238508|ref|XP_002764187.1| PREDICTED: protein disulfide-isomerase isoform 3 [Callithrix jacchus]
    MLRRALLCLALAAAVRVGADAPEEEDNVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIR
    LAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTGAAEAIDDVPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRN
    NFEGEVTKESLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAEGFKGKILFIFIDSD
    HTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVG
    KNFEEVAFNEKKNVFVEFYAPW
    CGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTV
    IDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL

    >gi|296238504|ref|XP_002764185.1| PREDICTED: protein disulfide-isomerase isoform 1 [Callithrix jacchus]
    MLRRALLCLALAAAVRVGADAPEEEDNVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIR
    LAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVI
    GFFKDVESDAAKQFLQAAEAIDDVPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKESLLDFIKHNQLPLVI
    EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAEGFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLI
    TLEEEMTKYKPESDELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFNEKKNVFVEFYAPW
    CG
    H
    CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
    GDDDDLEDLEEAEEPDMEEDDDQKAVKDEL

    >gi|296238506|ref|XP_002764186.1| PREDICTED: protein disulfide-isomerase isoform 2 [Callithrix jacchus]
    MLRRALLCLALAAAVRVGADAPEEEDNVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIR
    LAKVDATEESDLAQQYGVRGYPTIKFFKDVESDAAKQFLQAAEAIDDVPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRN
    NFEGEVTKESLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAEGFKGKILFIFIDSD
    HTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVG
    KNFEEVAFNEKKNVFVEFYAPW
    CGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTV
    IDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL

    >gi|296218279|ref|XP_002755343.1| PREDICTED: thioredoxin-related transmembrane protein 2-like isoform 1 [Callithrix jacchus]
    MAILAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCNGLPTQREDGNPCDFDWREVEILMFLSAIVMMKN
    RRSITVEQHIGNIFMFSKVANAILFFRLDIRMGLLYITLCIVFLMTCKPPLYMGPENIKYFNDKTIDEELERDKRVTWIV
    EFFANWSND
    CQSFAPIYADLSLKYNCTGLNFGKVDVGRYADVSTRYKVSTSPLTKQLPTLILFQGGKEVMRRPQIDKKGR
    AVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVAPSPTSVSDAESKKDK

    >gi|296222921|ref|XP_002757397.1| PREDICTED: thioredoxin-like protein 4A-like [Callithrix jacchus]
    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
    VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

    >gi|296233245|ref|XP_002807866.1| PREDICTED: LOW QUALITY PROTEIN: nucleoredoxin-like protein 1-like [Callithrix jacchus]
    MASLFSGRVLIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQ
    DPTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFSNWXEAAEVLD
    RNFLLPEDLEDQEPRSLTECLRRRKYRVEKAARGGRDPGGGGVSPFCPLLPAYS