Caenorhabditis elegans

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|17507677|ref|NP_490690.1| hypothetical protein F56C11.3 [Caenorhabditis elegans]
    MEIGPDGKPCRACVSVEDMMKKGREMAEKIKKKESETTPSTSTGAKLHGCPVDKDELGRSTWNLLHTMSVYYPEKPTDED
    KDRARSFMSILGKTYP
    CDFCAKDLRKDLKESPPKVESREAFALWMCQLHNKVNEKTGKPKFECRDVMQRWRDGWKDGSCD
    Y

    >gi|17509845|ref|NP_490812.1| GLutaRedoXin family member (glrx-10) [Caenorhabditis elegans]
    MSKAFVDGLLQSSKVVVFSKSYCPYCHKARAALESVNVKPDALQWIEIDERKDCNEIQDYLGSLTGARSVPRVFINGKFF
    GGGDDTAAGAKNGKLAALLKETGAL

    >gi|17510461|ref|NP_491070.1| Glutathione S-Transferase family member (gst-43) [Caenorhabditis elegans]
    MAKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLSLTESLAIIEYLDEAY
    PDPPFLPKELDKRSYSRAIALHIVASIQPLQAINIHKMLNEKEPGYGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLT
    IADINLPSIIYNAKIYKVDMSKYPTITRINEILAEDFRFKLAHPDNQPDAPNKN

    >gi|17510299|ref|NP_491127.1| hypothetical protein Y54E10A.3 [Caenorhabditis elegans]
    MPVINVKDDEDFRNQLSLAGLKSVIVDFTAVWCGPCKMIAPTFEALSNQYLGAVFLKVDVEICEKTSSENGVNSMPTFMV
    FQSGVRVEQMKGADAKALETMVKKYADNSAADSLVAGQMDLTPLVDKKQMECLNESDDTPLGRFLEGNCNLVSDCDEQLI
    ISLPFNQPVKVHSILIKGVSDRAPKKVKVFINLPKTTDFDNATALEPTQMLEFDESSIQGHGQVVALKYVKFQNVQNIQF
    FIENNVGGGDVTELVKLTVFGTPLSALNMNEFKRVAGKAGDAAH

    >gi|17509457|ref|NP_491139.1| hypothetical protein W01B11.6 [Caenorhabditis elegans]
    MVVYDCLTDEDFLQKSEHGIGKKAIYYFYGERCPSCESIKPLFDDLCKKYEKTALVYTYPCYNDDQLTGDAFAVNAVPTF
    VVMNNGEEVTRHVGAEAEKVQELFEKYAV

    >gi|17509965|ref|NP_491142.1| hypothetical protein Y44E3A.3 [Caenorhabditis elegans]
    MSIAIKDDDEFKTIFAEKKTQPVILFFTASWCGPCQMIKPRVEELAAEHKDRLSILKIDVDECDGVGEEYEINSMPTFLL
    IVDGIKKDQFSGANNTKFEEMVKAALQ

    >gi|17511147|ref|NP_491361.1| hypothetical protein ZK973.11 [Caenorhabditis elegans]
    MQKYFLLPLLSLSVLLFVYDTEATNPPTAVLDLSDKFLDVKDEGMWFVEFYAPWCAHCKRLHPVWDQVGHTLSDSNLPIR
    VGKLDCTRFPAVANKLSIQGYPTILFFRNGHVIDYRGGREKEALVSFAKRCAAPIIEVINENQIEKVKLSARSQPSYVFF
    GTSSGPLFDAFNEAASSKFSVARFYSVAPPENDASFRQRVAVFKDNFEIEFNGDIEKLTEWVTRERWPGFLQATSSNLAE
    IGASGKLVVLVVSSESHKFNNTSPIREFHKTAEEASKELRKHPDLWNRFQFAWLDGSDLASQIQMAAVSEPHLFIFNYTS
    YEYYLSEDEPSQMTIKSILTFLEQTSEGIDKETIVAFGGRHLLTRIKRMAFELYWNIAQMFATQPLLSSCLFGVPIAFLS
    IICYSICSADFTVDRDEFYGDEDELIDDEEGEETEHPETDDDHEKAE

    >gi|115532254|ref|NP_001040641.1| hypothetical protein C30H7.2 [Caenorhabditis elegans]
    MAHALREIQAHSILMKNQMLRWLSLLLFCPALLNAEVVSLTSQNFEQTIQANELVFVNFYADWCRFSQMLKPIFLEASEK
    FKDAAPGKIMWASVDADKNNDIATKYHVNKYPTLKLFRNGEAAKREYRSSRSVEALSEFINKQMEVTVKKFIEKNALQAA
    HNPEKNTFIGYFHDENSVEYKNLMNVAMFYRDECEFMVGIGDLNFPGEAPAAGQPPKLVFQPSNKAVNPAQIPFSGDFAT
    YEYLKQWVADKCVPLVREITFQNAEELTEEGLPFMILFKKSDDKVSEKIFTDAIVRELPDQRKAINCLVGDGTIFKHPLS
    HLGKSESDLPVIAIDSFRHMYLFKNFEDVNVPGKLREFVLDLHSGKLHREFHHGPDPVTGNQAPDTEPPPSTFEKLKPAS
    SRYTILDKTEL

    >gi|115532252|ref|NP_001040640.1| hypothetical protein C30H7.2 [Caenorhabditis elegans]
    MLRWLSLLLFCPALLNAEVVSLTSQNFEQTIQANELVFVNFYADWCRFSQMLKPIFLEASEKFKDAAPGKIMWASVDADK
    NNDIATKYHVNKYPTLKLFRNGEAAKREYRSSRSVEALSEFINKQMEVTVKKFIEKNALQAAHNPEKNTFIGYFHDENSV
    EYKNLMNVAMFYRDECEFMVGIGDLNFPGEAPAAGQPPKLVFQPSNKAVNPAQIPFSGDFATYEYLKQWVADKCVPLVRE
    ITFQNAEELTEEGLPFMILFKKSDDKVSEKIFTDAIVRELPDQRKAINCLVGDGTIFKHPLSHLGKSESDLPVIAIDSFR
    HMYLFKNFEDVNVPGKLREFVLDLHSGKLHREFHHGPDPVTGNQAPDTEPPPSTFEKLKPASSRYTILDKTEL

    >gi|17507915|ref|NP_491995.1| Protein Disulfide Isomerase family member (pdi-3) [Caenorhabditis elegans]
    MIWVQAALVASFLAFASAGGAVLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDC
    TTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESK
    LKDSYLKVADTERDRFSFAHTSNKDIIKKAGYSDDVVVFVPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHETVGFAGIRT
    QGNLFQFEQKPIVIVYYNVDYVKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIVAILT
    NEGKYPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDEQGDVKVAVGKNFKELIMDADKDVLIEFYAPW
    CGHCKSLAP
    KYEELAEKLNKEDVIIAKMDATANDVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISKHSTDGLKGFSRDG
    KKKKKTEL

    >gi|32563627|ref|NP_492564.2| hypothetical protein T05F1.11 [Caenorhabditis elegans]
    MNDLNNGTPLRIVELVSENDHPPERANDEYVQFAQISVVSGIQEELIELVKKKLLESIELQQFIVGRDIEFQEKYIASLT
    DGLSRYNNHNELEEIRNEKLSSEERHFELESARNKLNGLRIQNSNFGRREQKVCSFLSSGFEQVRILSSTAAHDEIRYKV
    NNASWICSINNSLALQKIKLICEKFIELKKKVEITFWSSEIVTLLEKLDQQQKNVAFGMIIEIATWEYENSNNRNLLKLI
    NALLDNDETKKEVLVNCENLFSVETPQIEKCLANLNILVALLLNISLENRIYKEKLEQSICQLIARIFGNRKFRSSHMMS
    IIEVLETVERKFGRFSGKFDNMLSLLESRSHMLERSEQHRVINLIRSRSSHSPIPPEILASAYSSGASIRNVTVIEHSQS
    APNYFPHRTRDEIKREVQMEYERRWRIEEEERLEEIRRKKEEERKKKEEEDEKRRKAEESERVRKLKEEEKRKRVLEEEM
    EMKRKNEEAKIKLEAEMREKAEQAEIKRREEKSRALKKLQKEETNKMEQMNNCTFLQNVPLFRHLHPSGSYSERMLDGKV
    IGLYYSGYW
    CQPSRDFTPILAQFYSQVDKNFEILFISSDRSEQEMNYYLQSSHGDWFHLPFDSPISKHLQQFNTKNAIPT
    LIIIKPNGTVITVDGRDQVSSFLNNPQALVNHWKSV

    >gi|17506887|ref|NP_492598.1| hypothetical protein F26E4.12 [Caenorhabditis elegans]
    MSSVYDFNVKNANGDDVSLSDYKGKVLIIVNVASQCGLTNKNYTQLKELLDVYKKDGLEVLAFPCNQFAGQEPSCEIDIQ
    AFVADKFKFEPTLFQKIDVNGDKQSPLFKFLKNEKGGFMFDAIKWNFTKFLVGRDGKIIKRFGPTTDPKDMEKDIKEALG
    EKL

    >gi|17507705|ref|NP_492913.1| PNG (Peptide:N-Glycanase) homolog family member (png-1) [Caenorhabditis elegans]
    MPVTEVGSLPELNNILERSDANRLIIIDFFANWCGPCRMISPIFEQFSAEYGNATFLKVNCDVARDIVQRYNISAMPTFI
    FLKNRQQVDMVRGANQQAIAEKIRQHYSPTPANPNAASDSEKRFLEQFVKCSNVPRSYQDEVFKALARSVMPEELVGRAM
    TEGPRDEKAILKDLLHWFKTQFFTWFDRPTCPKCTLKCSTDGLQGTPTREEQKEGGASRVEVYICDGCNTEMRFPRYNNP
    AKLLQTRTGRCGEWANCFGLLLAALNLESRFIYDTTDHVWNEVYLLAEQRWCHVDPCENTMDRPLLYTRGWGKTLGYCIG
    YGSDHVVDVTWRYIWDSKKLVTQRNEVRQPVFENFLSKLNSRQAEGQTEPRKRELAVRRVCELMEMMAQEAKNHKIGWEK
    IGDDLGGRITGSEEWRRERGELGESGPKLLAEPIKLAPPTGPAQNYLEFNYDVITDTYSQPPEIGFSAQAFELENVQRVE
    ETDWNMTYLCRKRGDAPGNISWHFDLKSLKKSIEKIEIRMAGIQKFEKGKAMAIACLGDSCMRLPIDCSALTIEDPKNAE
    ILKITATLSGGEGAIGFQQAQIFRTELKRGGGARTESFSVKIWMKN

    >gi|115532378|ref|NP_001040704.1| DNaJ domain (prokaryotic heat shock protein) family member (dnj-27) [Caenorhabditis elegans]
    MRAIVLLSVLISCYLVIAEDYYELLGVERDADDRTIRKAFKKLAIKKHPDRNTDDPNAHDEFVKINKAYEVLKDENLRKK
    YDQFGEKGLEDGFQGGNNYQSWQFYNDNFGIYDDDQEIVTLNRADFQRMVSDSNEIWFINFYSTY
    CSHCHQLAPTWRKFA
    REIEGTIRVGAVNCAEDPQLCQSQRVNAYPSLVFYPTGEFYQGHRDVELMVDFAIQRLKSEVLHLNSENWKALSEDWEPY
    NRLPWVVDMCGGDHIDCLSSTTRRKLSSMLDGLANVATIDCNAEEALCSKFNPITSGVMWFPARKLVKKSQINIESMDAQ
    EISKSVIQYLDELEDISVESLQRLLEGNDPDEPIAVWMLANDAQSTERKDFRRLPALVTTQIFKFDCSKSSEICDELLDK
    TKLPQFMVFKTTGGYEIDYAGSKDFHAASTFIREASKSHIHVLNRDSYEYAISGGEFYIIDYFAPW
    CPPCMKLLGEYRRF
    HTATSEDSMLHTVAIGSLDCVKYKDLCQQAGVQSYPTSIVYTPDGKTHKMVGYHNVDYILEFLDNSLNPSVMEMSPEQFE
    ELVMNRKDEETWLVDFFAPW
    CGPCQQLAPELQKAARQIAAFDENAHVASIDCQKYAQFCTNTQINSYPTVRMYPAKKTKQ
    PRRSPFYDYPNHMWRNSDSIQRWVYNFLPTEVVSLGNDFHTTVLDSSEPWIVDFFAPW
    CGHCIQFAPIYDQIAKELAGKV
    NFAKIDCDQWPGVCQGAQVRAYPTIRLYTGKTGWSRQGDQGIGIGTQHKEQFIQIVRQQLKLDEHDEL

    >gi|115532380|ref|NP_001040705.1| DNaJ domain (prokaryotic heat shock protein) family member (dnj-27) [Caenorhabditis elegans]
    MKLLGEYRRFHTATSEDSMLHTVAIGSLDCVKYKDLCQQAGVQSYPTSIVYTPDGKTHKMVGYHNVDYILEFLDNSLNPS
    VMEMSPEQFEELVMNRKDEETWLVDFFAPW
    CGPCQQLAPELQKAARQIAAFDENAHVASIDCQKYAQFCTNTQINSYPTV
    RMYPAKKTKQPRRSPFYDYPNHMWRNSDSIQRWVYNFLPTEVVSLGNDFHTTVLDSSEPWIVDFFAPW
    CGHCIQFAPIYD
    QIAKELAGKVNFAKIDCDQWPGVCQGAQVRAYPTIRLYTGKTGWSRQGDQGIGIGTQHKEQFIQIVRQQLKLDEHDEL

    >gi|193203301|ref|NP_001021648.2| UBA (human ubiquitin) related family member (uba-2) [Caenorhabditis elegans]
    MPSWREKHEKIVQSKILVIGAGGIGCELLKNLAVTGFRKVHVIDLDTIDISNLNRQFLFRKEHVSSSKAATATQVVKQFC
    PQIELTFDHDSIFEKKYNMEFFQAYDIVLNALDNRAARNYVNRMCHAANRPLIDSGSGGYFGQVSVIMRGKTECYECVDK
    PVQQTTYPG
    CTIRNTPSEHIHCTVWAKHVFNQLFGEVDIDDDVSPDMDAVDPDNTEAVTTEKEKEAMKEEPAPVGTRQWA
    ESVDYDAAKVFDKLFLHDIEYLCKMEHLWKQRKRPSPLEFHTASSTGGEPQSLCDAQRDDTSIWTLSTCAKVFSTCIQEL
    LEQIRAEPDVKLAFDKDHAIIMSFVAACANIRAKIFGIPMKSQFDIKAMAGNIIPAIASTNAIVAGIIVTEAVRVIEGST
    VICNSSIATTQSNPRGRIFGGDATNPPNPRCFVCSEKREVFIYVNPDTMTVGGLCEKVLKQKLNMLAPDVMDSATSRIIV
    SSDGDTDDLLPKKLAEVSIEDGAILSCDDFQQEMEIKLFIKKGDRLAGDDFEVARSEKEPEPDDRKRKADGSEEPEAKRQ
    KVEEKDDKNGNEAVAEITETMA

    >gi|17509717|ref|NP_493240.1| hypothetical protein Y18D10A.2 [Caenorhabditis elegans]
    MQMNPNKSPPISINFPLFTMSKFLLFISISAVATASDLVEVFGISRCPDTSKFIHNQLVPFYQNYKGNLSDGLKLDFHAV
    PTGGHQVDGKYVNRCLHGALECALNKLQMCSKKHIKQDWLVTAGCIQGKTAYSAGLKCLPDTEEGKIVQNCAESEEGEYL
    LNDENSYRYNVAPHSAWLPWIQVNGERNRNAEFKLKDFSSVFRLFFEVFLQKCLKRSIKN

    >gi|115532272|ref|NP_001040650.1| hypothetical protein F17B5.1 [Caenorhabditis elegans]
    MTESIDGNPWRILELVAENEYHLEQDNNVDQLEQFSVIPGFQEELVEFAKKKLLDSIEVQQFLVERDIEFQEKNIASLID
    ELSDNQDDESNSKEIHLELKSSKNKYEGLRKKIASFKGRQQKAVGFLNSGLEEIRILTSPNDKFCYKVKNASWRCSVDNS
    IDLQKIKLICEKLIGLEKKMEVTFWTSEIMKLLENLDQRHYAVAFGIIIGMATWEYENSEKYHLLALIHLSIGRDETKTD
    VLLYWENWENESIEQSIVSLRILMIFYMKISIDDLECRENFEFRICQVIVFILEHKEFESSHLTMITELLGSIEQRFGNF
    TEMCDIMFTHFEAKAQMFDSYEAKMLVFMRNEHLSLLQTQHIDQCMDTLNILILLYLKIKIDKWTYREIIEQRISQFIIC
    ILEHTEFQSIHLTLIIQHLESIEQQFGCFSGKFDNMFKIFELKLQILDRPEQERVSKWIKSLSLRSSISEFSSEHSHSTV
    TVIEHSEKTYELEQNVRIDLEETLKLEKRIEEVSIEESKKKQEKLELKQREEEEARIKEEEEKQRKILEEEARKKQEEEE
    ARLKAEEELKIYEEEKRKKELEEERKKKEELEIKRKAEEEKKKKALEEEKKRKIAEEKARQKQEKERKKQANKCTFLQNF
    TFIRHQHPSQTYNERVLDGKVVGLYFSAHW
    CPPSRDFTPVLAQFYSQVEDNFEILFVSSDNNTQEMNFYLQNFHGDWFHL
    PLNLCNSMKHRNTKNHIPALIIMKPDGTVITDDGRNLVSQWINDPKALVNHWKAMLN

    >gi|17509547|ref|NP_493398.1| hypothetical protein W04A4.3 [Caenorhabditis elegans]
    MKPAKQSIFVTMVMIYSVILIITIFTPVQQIHVDIIDITGFAKCALTTKWFRTQLAPFLGNLTAKKGPKNLKMVYHPLSI
    GQKKGNGTAVATCENGWLECQLNKLQCCTKKYSRNVTDFEILAVLECIQGKQWFGKALDCLQPRNLQTL

    >gi|71997014|ref|NP_001021848.1| hypothetical protein ZC334.7 [Caenorhabditis elegans]
    MHYIHTFLATFLLPILADTLLTADLTTGHQASAAAVFQSEPSSDYFSTSDFSTTSPRQYPTDEADEELYALQKAAKPQFY
    PRPQNNYGGYGGYRPNPPQPFGYSYVGYINRQARRYPVMMYTLIQ
    CVPCQRAKHLLATTYGDIPSHFLELVGDEDWQRQL
    QVDLLKVTRQATFPYVFVCGNFIGGSSDLFNMHHSGQLRQALNNCMSRNG

    >gi|71993035|ref|NP_001021704.1| Endoplasmic Reticulum Oxidase family member (ero-1) [Caenorhabditis elegans]
    MREPLLQLIVLSLIIIVVNTQFESGRLCFCKGFEAVEPCDCSKPQTIDKLNNHRIYEKVQKLLKKDFFRFYKVNMDKTCP
    FWADDRQ
    CGTNQCGIAFCDDEVPAGLRRRNAVNMEAAAVKEEEDDDAEKCADAGNNIDPMDRTLHDDEKRQLDAMDHHDD
    GLEDKFCEIEDDESDGMHYVDLSKNPERYTGYAGKSPQRVWKSIYEENCFKPDPKFDKNFLTNPSNFGMCLEKRVFYRLI
    SGLHSAITISIAAYNYKPPPPSLGQFGSQMGTWFRNTEMFAGRFGTKWSWEGPQRLRNVYFIYLLELRALLKAAPYLQNE
    LFYTGNDVEDAETRKAVEDLLEEIRAYPNHFDESEMFTGVESHARALREEFRSHFVNISRIMDCVECDKCRLWGKVQTHG
    MGTALKILFSDLPHSHYKQDSSKFQLTRNEVVALLQSFGRYSSSILEVDNFREDMYPGESVMNTAADGPPRKSNKIDL

    >gi|17534953|ref|NP_494711.1| Prion-like-(Q/N-rich)-domain-bearing protein family member (pqn-48) [Caenorhabditis elegans]
    MKNPAIQFSLLLVLGVAVQNTESQYRQHQPSYPQNYQNHNYNAHQQHYHQQQQQQQHAHQQKQASQQQQQQQYPYNNYPS
    PNAIKAYQAAYPSVPHASVFNQPTHQICDIPPDLWCDSPQSAQQCGVQRQCDGLRHRRQPIKITLIYEAL
    CPYCQKFIAN
    QLGSVFNQFQGQLILELVPWGNSRIMRDGSFSCNHGQKECDANRLQSCVIDILKVKGALPFIVCFERNIQHYGVEHAMQT
    CSAFIRSQYRQIRQCYDGPRGVQLQREAAQKTMSTRPNPILEVPYLLINDYTPSVDMNNLNVMLLPQLLAKWTKLTHKQ

    >gi|17537401|ref|NP_494757.1| hypothetical protein Y52E8A.3 [Caenorhabditis elegans]
    MPQFLKGVTLENREGDELPAEEHLKGKIIGLYFSASWCPPCRAFTPKLKEFFEEIKKTHPEFEIIFVSRDRNSSDLVTYF
    KEHQGEWTYIPFGSDKIMSLMQKYEVKTIPAMRIVNDQGEVIVQDARTEIQNKGENVEGLWAEWMALIK

    >gi|17533113|ref|NP_494877.1| hypothetical protein F11G11.9 [Caenorhabditis elegans]
    MAVDMIVEPKWVVQNFGNIRILDASWTFKPKADVAEYKAKYYNKFGVGMNELKNPEYLAEHINGAAHFNFDIAYYPSEDE
    RFTLYTPEEFSSYVKRLGVFNGDHLVIYGRGKDGGMAAASRAYWTFRYYGYTTVSVLNGGIEAFKLAQGVVQSDSKAEGI
    RCKDAIHFPIGEVCAAKGFKKKTDCDQAFAAKGIKVGDTVVIS
    CGIGLSASAICLAAARSGIVAKLYNGGVHELAYKAPQ
    HLNMRVTLLLHAITVLRCTYIHFTFLYAIVIKIERIV

    >gi|193204376|ref|NP_001122604.1| PeRoxireDoXin family member (prdx-2) [Caenorhabditis elegans]
    MYRQMSKAFIGKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTD
    SVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRL
    VQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFKKH

    >gi|32565831|ref|NP_872052.1| PeRoxireDoXin family member (prdx-2) [Caenorhabditis elegans]
    MSKAFIGKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFS
    HLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAF
    QFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFKKH

    >gi|17533973|ref|NP_495540.1| hypothetical protein F43E2.5 [Caenorhabditis elegans]
    MAYLERAYFGLQCFWGESAWAKLKGVVVTRVGYAGGKQPNPTYKNIKDHTEITEITFDPKVIEYSKLTNFFWKHHNPAER
    RKKQYQSAILYVNDDQKKVAEETLKVAKDKHGDIETYIEPLDKFYQAEDYHQKYWFRQKKILFDELSLLDTQVAEGELAT
    KLNAYCAGFQDFHDLERLAKEYGLKDSFVNKVKDYALSGGDPRNCHA

    >gi|25147430|ref|NP_495615.2| hypothetical protein B0495.5 [Caenorhabditis elegans]
    MLRALAPITVIRMTSTYKNRLGQEKSPYLLQHANNPIDWYPWGQEAFQKAKDNNKPIFLSVGYSTCHWCHVMEKESFENE
    ATAKILNDNFVAIKVDREERPDVDKLYMAFVVASSGHGGWPMSVFLTPDLHPITGGTYFPPDDNRGMLGFPTILNMIHTE
    WKKEGESLKQRGAQIIKLLQPETASGDVNRSEEVFKSIYSHKQSSFDSRLGGFGRAPKFPKACDLDFLITFAASENESEK
    AKDSIMMLQKTLESMADGGIHDHIGNGFHRYSVGSEWHIPHFEKMLYDQSQLLATYSDFHKLTERKHDNVKHVINDIYQY
    MQKISHKDGGFYAAEDADSLPNHNSSNKVEGAFCAWEKEEIKQLLGDKKIGSASLFDVVADYFDVEDSGNVARSSDPHGE
    LKNKNVLRKLLTDEECATNHEISVAELKKGIDEAKEILWNARTQRPSPHLDSKMVTSWQGLAITGLVKAYQATEETKYLD
    RAEKCAEFIGKFLDDNGELRRSVYLGANGEVEQGNQEIRAFSDDYAFLIQALLDLYTTVGKDEYLKKAVELQKICDVKFW
    NGNGYFISEKTDEDVSVRMIEDQDGAEPTATSIASNNLLRLYDILEKEEYREKANQCFRGASERLNTVPIALPKMAVALH
    RWQIGSTTFVLVGDPKSELLSETRSRLNQKFLNNLSVVHIQSEEDLSASGPSHKAMAEGPKPAVYMCKGFVCDRPVKAIQ
    ELEELFNKF

    >gi|71980565|ref|NP_001021886.1| ThioRedoXin [see also xtr] family member (trx-1) [Caenorhabditis elegans]
    MSLTKEPILELADMSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELATTHKGIIFCKVDVDEAEDLCSKYDVKMM
    PTFIFTKNGDAIEALEGCVEDELRQKVLEHVSAQ

    >gi|71980562|ref|NP_001021885.1| ThioRedoXin [see also xtr] family member (trx-1) [Caenorhabditis elegans]
    MLKRCNFKNQVKYFQSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELATTHKGIIFCKVDVDEAEDLCSKYDVKM
    MPTFIFTKNGDAIEALEGCVEDELRQKVLEHVSAQ

    >gi|17537933|ref|NP_495668.1| hypothetical protein ZK669.2 [Caenorhabditis elegans]
    MCQLIPSTFCSHSYLSDSFSNESAAHKVKKMMPRLSIQLIFATWILPFVLGQNLLEIYKAMMADQASRAKTPPINIEFFG
    ESL
    CPDTTRYFRNHIMPVWTSLQASSTINITYHPFGLASCRRSAETGIRCNCQHGPAECQLNMLQACVISTLQVPQLYLP
    IVNCMQGKNKFSSAVDDCIVNFRPRPDLDENFMARCAQSQLGAKLMMQHGYRQKEVASELDWVPWILINGRRSQAAENQL
    KTIVCQFSETSKQEYCKTQEELIF

    >gi|17537935|ref|NP_495669.1| hypothetical protein ZK669.3 [Caenorhabditis elegans]
    MRRLNGVFICLILFITKISYAKDKGANGDMVNIVAFGEGRCSDTSYWMKWHWLPMWRMLGSTGRINFDYHPYGIKTTCVD
    SESADDVVCDCHHGNRECLLNQLQACVIEALPNFEDYMEVVTCIQGKQNISMAAEVCFEGPTKLDRTKMMECAESRHGRK
    LFSDQENIVAQMAPEMDWAPWILINGTRYKEAEEDLWQFLCDRFIDPRPIHCPKKIVY

    >gi|17535651|ref|NP_496154.1| hypothetical protein R53.5 [Caenorhabditis elegans]
    MAFLGYGAAAALGGALVYANLPTYLTIGAVAPTFAHLAAAKLVPIRGGPKEKEVVERNEQFTADSLFKKGPIMVMAVRRP
    G
    CMLCRREAAELHTLLPLLKEKGIELAAVVHETRGANEFKSWFSGGDVYLDTDRTFYGPNERWLPVWMGFLRFGTYSNVY
    KAKKAKVEGNMEGEGRLLGGVYLIANNDIVFTHLEKEWGDAADIKEVRAAVEKFSEKSK

    >gi|17535459|ref|NP_496200.1| hypothetical protein R05H5.3 [Caenorhabditis elegans]
    MSELLAGTKLINQDSEELDAGEHLKGKVVGLYFSASWCPPCRQFTPKLTRFFDEIRKKHPEFEVVFVSRDREDGDLREYF
    LEHMGAWTAIPFGTPRIQELLEQYEVKTIPSMRIVKPNGDVVVQDARTEIQDKGNDPEALWEEWLAFYD

    >gi|17533805|ref|NP_496397.1| hypothetical protein F37H8.5 [Caenorhabditis elegans]
    MDTTCRCLLTPTIQPVLLKMLYRLVAAILLLGAVQATINCAAIPTSLWCSNKDLEAKCGFASFCDKHRAATHNQKINITV
    LIEAL
    CPDCQNFLTKQLYPIVFKNFANYVNIELVPFGNAKVLEDGTIKCQHGEEECSINKFEGCFIDSMQDQSPLPTLSC
    IEESLQKKVEFADAVQQCFEKLQIGGDIQRLTQSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIINGVSLTSFQGFQ
    NQLPTLLCEWYSGDKAIPYCEAALKLKYKKASIRSFF

    >gi|17537611|ref|NP_496599.1| hypothetical protein Y57A10A.23 [Caenorhabditis elegans]
    MRSLLLLALVSASAYASFDKIKDSIQNPLARGFGDDIAWVKWEDAIETALDTDKPIFLLIHKSWCHACKALKKTFQQSNA
    KKAFKKLSEHFVMVNTEDDDEPFEEEYRPDGKYIPRLLFLDKNGDLLQEFKNKKAEYKNYAYYYSSPADILNSMKDVLKH
    FGVDIPEAKRGDKLKPKKPEGKKKEL

    >gi|71998452|ref|NP_496981.2| hypothetical protein Y54G11A.9 [Caenorhabditis elegans]
    MLTQKIGRLMACTVTRQAHRMLTEQEIKVTNKAASRLKEVVDNGERLRLEVDGGGCSGFEYKIRLDKKINNDDLLWKSSE
    NGAEIVVDELSLGFLKGATVDFVEDLMKSSFRIVNNPIAEKGCSCGSSFAPKMD

    >gi|17535473|ref|NP_497078.1| hypothetical protein R05H10.5 [Caenorhabditis elegans]
    MASVHGITVKNAQGEDTPLSNYQGKVLIIVNVASQCGLTNSNYNQFKELLDVYKKDGLEVLAFPCNQFGGQEPSCEIDIA
    AFVADKFKFEPTLFQKIDVNGDNTAPLYKFLKQEKGGFLVDAIKWNFTKFLVGRDGHVIKRFSPTTEPKDMKKDIEAALQ
    AKL

    >gi|25144449|ref|NP_741069.1| Glutathione S-Transferase, Omega class family member (gsto-3) [Caenorhabditis elegans]
    MVLPGNCSTSAALCMQFLTQLASVAIDQAYQPPQQPAYNPHEKLFVSYRSVPPPGSSPSSAAVPIRFSSYSSVGSNIRGL
    NSPTLHPGSIEPPLTPGNYRLYSMRF
    CPYAQRVLIYLAKKNIPVEVVNVNPDRSPNWYLPKSPIGRVPALEINGKVVWES
    NVIVEYLDELFPTNTILPRDAYEKAHQKILVERLSPIMNALFEFYGSSNNPQAQRQNDMNVHSALRNSENLLRDTFYGGR
    QPGYADYLMWPFLERLQLLTMSPNSQFRYFPGLHYPKIGAYIARMQNQPEVLGFCKHDFFLKKTGEKIW

    >gi|25144453|ref|NP_741070.1| Glutathione S-Transferase, Omega class family member (gsto-3) [Caenorhabditis elegans]
    MVLPGNCSTSAALCMQFLTQLASVAIDQAYQPPQQPAYNPHEKLFVSYRSVPPPGSSPSSAAVPIRFSSYSSVGSNIRGL
    NSPTLHPGSIEPPLTPGNYRLYSMRF
    CPYAQRVLIYLAKKNIP

    >gi|71983419|ref|NP_001021220.1| hypothetical protein C46F11.2 [Caenorhabditis elegans]
    MLRFRCILSTSRSIMSGVKEFDYLVIGGGSGGIASARRAREFGVSVGLIESGRLGGTCVNVGCVPKKVMYNCSLHAEFIR
    DHADYGFDVTLNKFDWKVIKKSRDEYIKRLNGLYESGLKGSSVEYIRGRATFAEDGTVEVNGAKYRGKNTLIAVGGKPTI
    PNIKGAEHGIDSDGFFDLEDLPSRTVVVGAGYIAVEIAGVLANLGSDTHLLIRYDKVLRTFDKMLSDELTADMDEETNPL
    HLHKNTQVTEVIKGDDGLLTIKTTTGVIEKVQTLIWAIGRDPLTKELNLERVGVKTDKSGHIIVDEYQNTSAPGILSVGD
    DTGKFLLTPVAIAAGRRLSHRLFNGETDNKLTYENIATVVFSHPLIGTVGLTEAEAVEKYGKDEVTLYKSRFNPMLFAVT
    KHKEKAAMKLVCVGKDEKVVGVHVFGVGSDEMLQGFAVAVTMGATKKQFDQTVAIHPTSAEELVTMRGGVKPE

    >gi|71983429|ref|NP_001021221.1| hypothetical protein C46F11.2 [Caenorhabditis elegans]
    MSGVKEFDYLVIGGGSGGIASARRAREFGVSVGLIESGRLGGTCVNVGCVPKKVMYNCSLHAEFIRDHADYGFDVTLNKF
    DWKVIKKSRDEYIKRLNGLYESGLKGSSVEYIRGRATFAEDGTVEVNGAKYRGKNTLIAVGGKPTIPNIKGAEHGIDSDG
    FFDLEDLPSRTVVVGAGYIAVEIAGVLANLGSDTHLLIRYDKVLRTFDKMLSDELTADMDEETNPLHLHKNTQVTEVIKG
    DDGLLTIKTTTGVIEKVQTLIWAIGRDPLTKELNLERVGVKTDKSGHIIVDEYQNTSAPGILSVGDDTGKFLLTPVAIAA
    GRRLSHRLFNGETDNKLTYENIATVVFSHPLIGTVGLTEAEAVEKYGKDEVTLYKSRFNPMLFAVTKHKEKAAMKLVCVG
    KDEKVVGVHVFGVGSDEMLQGFAVAVTMGATKKQFDQTVAIHPTSAEELVTMRGGVKPE

    >gi|17554386|ref|NP_497746.1| Protein Disulfide Isomerase family member (pdi-1) [Caenorhabditis elegans]
    MSLSVSFIFLLVASIGAVVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAADLLKEEGSDIKLAK
    VDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTVTTVESVEQLEELKGKTRVVVLGYFKDA
    KSDAATIYNEVADSVDDAFFAVAGSAEVAAAASLNEDGVALIRTDGDDSETSTIAEAEITNTIALKQWLHAYKLSAVTEF
    THESAQEIVGGDLKKFHFLIIRKSDSSFDETIAKFTEVAKKFRAKIVFVLLDVDVEENARILEFLGVDAKNTPANRIVSL
    ADQVEKFKPQEGEDFEAFTNSYLEGKSAQDLKAQDLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPW
    CGHCKQLV
    PVWDELAEKYESNPNVVIAKLDATLNELADVKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSASESETASQ
    DHEEL

    >gi|133904683|ref|NP_497886.2| hypothetical protein R07E5.4 [Caenorhabditis elegans]
    MLVLLVAFLFPVLLQAQQVNVTIFTESQCPYCTKLLREQIWPFYVNRPGIMNLQIVPFGKGDCTYDYNRNFHCTCMHGAT
    ECDLNRLQNCAISYFPRRHLGLVTCLQGLTTLREGFSKCLSRLSPNTQRKLIECATTQTGELLNYYSMVNTHRAGVRIWP
    TMYVNGVFFDRSYPVEHKLCEHTAWC

    >gi|17554494|ref|NP_497892.1| PeRoxireDoXin family member (prdx-3) [Caenorhabditis elegans]
    MFSSAVRALCRTVPTVATRQLSTSRALLSLRPLGPKNTVPAFKGTAVVDGDFKVISDQDYKGKWLVMFFYPLDFTFVCPT
    EIIAYGDRANEFRSLGAEVVACSCDSHFSHLAWVNTPRKDGGLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLID
    PSGTVRHTTCNDLPVGRSVDETLRVLKAFQFSDKHGEVCPADWHEDSPTIKPGVATSKEYFNKVNK

    >gi|115532750|ref|NP_001040891.1| GLutaRedoXin family member (glrx-21) [Caenorhabditis elegans]
    MGGVTSKVNVDVVQEQVKKDPVVMYTKTSCTFCNRAKDLFSDVRVAYKEVNLDTLKASQPDDYLGIVNGLVYTTRQTSVP
    QIFVCGRFIGGYTELDALRNSGHLFEAIAQCTGENSPKE

    >gi|115532752|ref|NP_001040892.1| GLutaRedoXin family member (glrx-21) [Caenorhabditis elegans]
    MYTKTSCTFCNRAKDLFSDVRVAYKEVNLDTLKASQPDDYLGIVNGLVYTTRQTSVPQIFVCGRFIGGYTELDALRNSGH
    LFEAIAQCTGENSPKE

    >gi|17552020|ref|NP_498410.1| Temporarily Assigned Gene name family member (tag-170) [Caenorhabditis elegans]
    MAANIQQQFGEQLLRAAQVVEEQIDQEMNKLENLEEDDLEVIRRQRMEQMKKAQKDRIEMLSHGHGKYEEVADEKEFFEA
    TKKSDKVVCLFYLPGNFR
    CKIVDKHFEILARKHVGTRFIHVNAEKVHFLTTRLNIRVIPSIAIVVKQQTVDYIRGFDELG
    GKDEFTTETMENRLARSEVLTVEKKHTAPAKKKIIRSGVEEYDNEEDW

    >gi|71984476|ref|NP_498534.2| ectopic membrane RuFfLes in embryo family member (rfl-1) [Caenorhabditis elegans]
    MVSVDPLATERWRSIRRLTDRDSAYKVPWFVPGPENFEALQNTKILVIGAGGLGCELLKNLALSGFRTIEVIDMDTIDVS
    NLNRQFLFRESDVGKSKAEVAAAFVQQRVVGCQVTAHNCRIEDKGQEFYRKFSIIICGLDSIPARRWINGMLCDLVLEMA
    DGKPDENTIIPMIDGGTEGFKGNARVIYPKFTACIDCTLDLYPPQVNFPL
    CTIAHTPRLPEHCIEYIKVVVWPEEKPFEG
    VSLDADDPIHVEWVLERASLRAEKYNIRGVDRRLTSGVLKRIIPAVASTNAVIAASCALEALKLATNIAKPIDNYLNFTQ
    IHGAYTSVVSMMKDDNCLTCSGGRLPFEVSPSSTLESLIIRLSERFHLKHPTLATSTRKLYCISSFMPQFEQESKENLHT
    SMKDLVSDGEEILVSDEALSRALTLRIQLI

    >gi|17557049|ref|NP_498691.1| hypothetical protein ZK686.3 [Caenorhabditis elegans]
    MLLAVYESAQQQTLEDKVQNLVDLTSRQSIVKFNMDKWKTLVRMQPRNYSMIVMFTALSPGVQCPICKPAYDEFMIVANS
    HRYTSSEGDRRKVFFGIVDYEDAPQIFQQMNLNTAPILYHFGPKLGAKKRPEQMDFQRQGFDADAIGRFVADQTEVHVRV
    IRPPNYTAPVVIALFVALLLGMLYMKRNSLDFLFNRTVWGFVCLAITFIFMSGQMWNHIRGPPFMITNPNTKEPSFIHGS
    TQFQLIAETYIVGLLYALIAIGFICVNEAADQSNSKDRKNAGKKLNPLSLLNIPTNTLAIAGLVCICVFFSFLLSVFRSK
    YRGYPYSFLFA

    >gi|17552382|ref|NP_498728.1| Glutathione S-Transferase, Omega class family member (gsto-1) [Caenorhabditis elegans]
    MVLTGVTSKAIRKGDAEPPLSKGSFRVYNMRFCPWAERAMLYVAAKGIEAEVVNLNVTDKLEWYWTKHYQGKAPAVEHNG
    KVVIESGFIPEYLDDAFPETRILPTDPYEKVQQKLLADRLTAVAHAVPLLFAVMRDRTLKDEKQRKVFEVLKQAENLLAN
    DFYAGSQPGYPDYLSFPFFEKIWWSASLDGVVDLPTIEFPGEEEYPKLTKWFQKMISSDVVQSVTQSLEHGAAFMNAYAT
    HQELNYDLGL

    >gi|25144092|ref|NP_498775.2| hypothetical protein C14B9.2 [Caenorhabditis elegans]
    MMFDRRFFALVVLLCVSAVRSTEDASDDELNYEMDEGVVVLTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASS
    KVSIPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPNDYDGGRDEAGIVEWVESRVDPNYKPPPEEVVTLTTENFDDF
    ISNNELVLVEFYAPW
    CGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRFDYNGPR
    EAAGIIKYMTDQSKPAAKKLPKLKDVERFMSKDDVTIIGFFATEDSTAFEAFSDSAEMLREEFKTMGHTSDPAAFKKWDA
    KPNDIIIFYPSLFHSKFEPKSRTYNKAAATSEDLLAFFREHSAPLVGKMTKKNAATRYTKKPLVVVYYNADFSVQYREGS
    EYWRSKVLNIAQKYQKDKYKFAVADEEEFAKELEELGLGDSGLEHNVVVFGYDGKKYPMNPDEFDGELDENLEAFMKQIS
    SGKAKAHVKSAPAPKDDKGPVKTVVGSNFDKIVNDESKDVLIEFYAPW
    CGHCKSFESKYVELAQALKKTQPNVVLAKMDA
    TINDAPSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLKKFMTKHGVKSFQKKDEL

    >gi|115532652|ref|NP_001040841.1| Glutathione S-Transferase, Omega class family member (gsto-2) [Caenorhabditis elegans]
    MTVLAGVNSKIVKNGCWNHSYLQHAILPVAQRALIYASVKNIPSDVINVHLQEKPDWYFSKHYKGQVPTLEHDEGKKHVI
    ESAVIPEYLDDIYPETRILPTDPYEKVQQKLLLDRISGQVSPAFYGVVQAVKNPDLREEKFADIKKAYDNAEQLLTGDFY
    SGTSKPGFVDYLLYPNIQRAYWAAHIVPDFPLEAESFPGPNYPRLSKWYKALESIPEVAAASQPTENGVGFFKDYLGGSP
    NYDYGFIPHVITRLTFISFYVHLSSSKINFKNLHCRTIAERRSMSVLSGLNTKVVKNGDPAPAPPASGTIRIYNMRY
    CPW
    AQRALIFASLKKIPTEVINIHLDQKPDWFFTKHYKGQVPALEHDEGKKIVIESAVIPEYLDDIYPEPRIIPTDHYEKVQQ
    KLLLDRISGQLSSAFYGVVQAAKISDLLKEKLVELAKAYDTAEELLTGDFYSGTSKPGFVDYLIYPNIQRAFWTSHIIKD
    FPLKVESFPGPNYPKLSKWYKRLDSIPEVIATSQPTETAVEFFKSWIIGAPNFDYGL

    >gi|115532656|ref|NP_001040843.1| Glutathione S-Transferase, Omega class family member (gsto-2) [Caenorhabditis elegans]
    MSVLSGLNTKVVKNGDPAPAPPASGTIRIYNMRYCPWAQRALIFASLKKIPTEVINIHLDQKPDWFFTKHYKGQVPALEH
    DEGKKIVIESAVIPEYLDDIYPEPRIIPTDHYEKVQQKLLLDRISGQLSSAFYGVVQAAKISDLLKEKLVELAKAYDTAE
    ELLTGDFYSGTSKPGFVDYLIYPNIQRAFWTSHIIKDFPLKVESFPGPNYPKLSKWYKRLDSIPEVIATSQPTETAVEFF
    KSWIIGAPNFDYGL

    >gi|115532648|ref|NP_001040839.1| hypothetical protein C02D5.2 [Caenorhabditis elegans]
    MSKYLRTSHPSPLICRPILTFSSLHILTAFLISGNSSYINWSVTIILLILGLYACHRFLNMKKLTRDAQEPLLPHIRPST
    RNKIRKYIYGTIFILSIFLLYRSLNSPDTSKHGIGRNGDFIEYEPKAGPTIKEPVENIVKLDVYMEAQ
    CPDTSRFFRQQL
    KKAWDILGRLNRIELNVIPFGKARCTEKGNDFECQCQHGPTECQINQLMNCVIDRFGFPHRYLPGVLCMQGKYSLDEAMK
    CVTENYPSEYERMRECASGTRGRRLLALSGQKTASLTPAIDFIPWIVINGSRNSDALYDLTQNVCEAMQPMPSACKDYLR
    SLQ

    >gi|115532650|ref|NP_001040840.1| hypothetical protein C02D5.2 [Caenorhabditis elegans]
    MKKLTRDAQEPLLPHIRPSTRNKIRKYIYGTIFILSIFLLYRSLNSPDTSKHGIGRNGDFIEYEPKAGPTIKEPVENIVK
    LDVYMEAQ
    CPDTSRFFRQQLKKAWDILGRLNRIELNVIPFGKARCTEKGNDFECQCQHGPTECQINQLMNCVIDRFGFPH
    RYLPGVLCMQGKYSLDEAMKCVTENYPSEYERMRECASGTRGRRLLALSGQKTASLTPAIDFIPWIVINGSRNSDALYDL
    TQNVCEAMQPMPSACKDYLRSLQ

    >gi|17553450|ref|NP_498954.1| hypothetical protein F44E2.6 [Caenorhabditis elegans]
    MTTKKFRMEDVGLSKLKVEKNPKDVKQTEWKSVLPNEVYRVARESGTETPHTGGFNDHFEKGRYVCLCCGSELFNSDAKF
    WAGCGWPAFSESVGQDANIVRIVDRSHGMHRTEVRCKTCDAHLGHVFNDGPKETTGERY
    CINSVCMAFEKKD

    >gi|115532676|ref|NP_001040853.1| hypothetical protein F44E2.6 [Caenorhabditis elegans]
    MEDVGLSKLKVEKNPKDVKQTEWKSVLPNEVYRVARESGTETPHTGGFNDHFEKGRYVCLCCGSELFNSDAKFWAGCGWP
    AFSESVGQDANIVRIVDRSHGMHRTEVRCKTCDAHLGHVFNDGPKETTGERY
    CINSVCMAFEKKD

    >gi|17557007|ref|NP_498971.1| ThioRedoXin Reductase family member (trxr-2) [Caenorhabditis elegans]
    MLLSTFKRHLPIRRLFSSNKFDLIVIGAGSGGLSCSKRAADLGANVALIDAVEPTPHGHSWGIGGTCANVGCIPKKLMHQ
    AAIVGKELKHADKYGWNGIDQEKIKHDWNVLSKNVNDRVKANNWIYRVQLNQKKINYFNAYAEFVDKDKIVITGTDKNKT
    KNFLSAPNVVISTGLRPKYPNIPGAELGITSDDLFTLASVPGKTLIVGGGYVALECAGFLSAFNQNVEVLVRSIPLKGFD
    RDCVHFVMEHLKTTGVKVKEHVEVERVEAVGSKKKVTFTGNGGVEEYDTVIWAAGRVPNLKSLNLDNAGVRTDKRSGKIL
    ADEFDRASCNGVYAVGDIVQDRQELTPLAIQSGKLLADRLFSNSKQIVRFDGVATTVFTPLELSTVGLTEEEAIQKHGED
    SIEVFHSHFTPFEYVVPQNKDSGFCYVKAVCTRDESQKILGLHFVGPNAAEVIQGYAVAFRVGISMSDLQNTIAIHPCSS
    EEFVKLHITKRSGQDPRTQGC
    CG

    >gi|17556042|ref|NP_499610.1| GLutaRedoXin family member (glrx-5) [Caenorhabditis elegans]
    MLRVLSRQAFSMVRAANFSASASSAGGGGLSDEVRKRIDGIVKKDDVVVFMKGTQQEPACGFSRNVKLVLDFHNVKFQDY
    NVLTDQELREGVKIFSEWPTIPQVYVKGEFVGGCDILISMHKDGEISDFLDEKGISNKYGKQ

    >gi|17556044|ref|NP_499613.1| hypothetical protein Y49E10.4 [Caenorhabditis elegans]
    MPRSLWILLVFAISGSSTFYTAKDSVFELTDSNFDAKVLKSDRIWIVEFYAPYCGHCKSLVPEYKKAAKLLKGIAEIGAI
    DATVHQKIPLKYSIKGYPTIKIFGATEKSKPIDYNGPRTAKGIADAVKKSIEKSLEQRLKGKSSEKSKKSDKKGKVVVLT
    DSNFDKLVLNSKEPWMVEFFAPW
    CGHCQKLEPEWKKAAEEMGGRVKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSA
    SDAEDYQGGRTSTDLISYAESKYDDFGAAPEVVEGTGKAVVETVCKDKQLCIFTFLPSIFDCQSKCRKQKIDMLNELATI
    FKKRSFGWVWMEGGAQENVQRAFEIGDYGFPVLIAMSPKKMMYSTQIGQFSVDGIKEFLNAVNYGKGRVLEIKPTHLSNN
    FLKIVETQPWDGKDKELPVMEDIDLSDVDMDEKTEL

    >gi|17556548|ref|NP_499778.1| CU (copper) ATPase family member (cua-1) [Caenorhabditis elegans]
    MSENVSLLDGSPLPSRPSTSSIPRPSPSKNIQLLVDFGAPKTDGNVQETMLEIKGMTCNSCVKNIQDVIGAKPGIHSIQV
    NLKEENAKCSFDTTKWTAEKVAEAVDDMGFDCKVLKKEPPTQMAEKPKIRRAIVSIEGMTCHACVNNIQDTVGSKDGIVK
    IVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITDQEIAAVEPQKASTTKLSISPLKTVDLSDGKVELQLNGVKY
    SKEGSSDHLEKCTFAVEGMT
    CASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATLLD
    SMGANPNYSKIRLIIGNLSTESDANRIESHVLSKSGIDSCNVSIATSMALVEFSPQVIGPRDIINVVESLGFTADLATRD
    DQMKRLDHSDDVKKWRNTFFIALIFGVPVMIIMIIFHWILRTPMHPDKQTPIFTPALSLDNFLLLCLCTPVQIFGGRYFY
    VASWKAIKHGNANMDVLIMLSTTIAYTYSIVVLLLAIIFKWPSSPMTFFDVPPMLIVFIALGRMLEHKAKGKTSEALSKL
    MSLQAKEATLVTMDSEGRLTSEKGINIELVQRNDLIKVVPGAKVPVDGVVVDGKSSVDESFITGESMPVVKKPGSTVIGG
    SVNQKGVLIVKATHVGNDSTLSQIVRLVEEAQTNRAPIQQLADKIAGYFVPFVIVLSLFTLGVWIYIEYNSARNANLPPG
    LRFEEALKIAFEAAITVLAIACPCSLGLATPTAVMVGTGVGAANGILIKGGEPLESVHKVTTIVFDKTGTITEGRPRVVQ
    IASFVNPSTMSLKLITFLSGATEALSEHPIGNAVAAFAKQLLNEPTWPNTSRFHVSAGHGVTCRIDSIRQSFSSLALSGS
    TCEIPRLPDGQTITIPGTEVNLLQVSSKEVSQPNPDTANIVIGTERMMERHGIPVSEVVKMTLSEEQRKGHISVICAINA
    EVVAVISIADQVKKEASLAIYTLREMGLRVVLLTGDNSKTAESTAKQVGIDEVFAEVLPNQKQQKIKQLKGYKNKVAMVG
    DGVNDSPALAEANVGIAIAAGSDVAIESAGIVLVRNDLVDVVGAIKLSKMTTRRIRLNFLFAIIYNAIGIPIAAGVFRPF
    GFMLQPWMAAAAMALSSVSVVSSSLLLKNFRKPTIANLYTTSFKRHQKFLESGSFQVQVHRGLDDSAVFRGAASSKLSIL
    SSKVGSLLGSTTSIVSSGSSKKQRLLDNVGSDLEDLIV

    >gi|25153706|ref|NP_741287.1| PeRoxireDoXin family member (prdx-6) [Caenorhabditis elegans]
    MKLGDTVPNFTFETDLRKNQTLHNYIGEQWLMLFSHPADFTPVCTTELAELVKLAPEFRKRHVQILAISIDSSETHRDWA
    KDINSVAQLSNCGSHLPFEIIADTDRSICTELGMIDPDEMNSEGICLSARAVMLFGPDKKLKSKILYPATFGRNFVEILR
    MVDGVQLGTKAPVATPANWIAGDNVIAQPSLSQERVIQELCGGDPDKCKTVPLPSGKSYLRVIEGDAYLQN

    >gi|71998175|ref|NP_500036.2| hypothetical protein Y55F3AR.2 [Caenorhabditis elegans]
    MPVIVVNGDSDFDRKFSAGNGKAVFVDFTASWCGPCQYIAPIFSDLANQYKGSVFLKVDVDECRGTAATYGVNAMPTFIA
    FVNGQKKATIQGADESGLRSMVAKYASTSAAWSGTGQRLSGSTTGSSSSTSSSAPPRASGAAPPPAGPNPLEPVFRIIET
    INERLQGFGISGVNFAGFQLQPFHLLLAIALLIIFGPFGLLIALAVCFFTQPRGGGPAPGAPRAGGSGAGGAPRPPPPAG
    PRAFGGSGQRLGGN

    >gi|17544224|ref|NP_500152.1| hypothetical protein Y76B12C.3 [Caenorhabditis elegans]
    MWVIFLLLAAVVSPMFGEVEEYKIDVEECKAAGFNPETLKCGLCERLSDYHLETLLTDCLQCCIKEEEFKHEKYPTAILE
    VCE
    CNLARFPQVQAFVHKDMARQFGGKVKVKHVRGVRPQVALKDADFKTKEVLSVEKWDTDTLIDFFNQWLE

    >gi|71999642|ref|NP_500242.2| hypothetical protein Y94H6A.4 [Caenorhabditis elegans]
    MASNSLLTLAVSFTVILFAFCVEVDDTLRWKQCAVTNQSVFDFQIETLKGDYTDLSQYRGKVTLLVNVATFCAYTQQYTD
    FNPILDKYQKQGLVIAAFPCNQFYLQEPAENHELLNGLTHVRPGNG

    >gi|17539056|ref|NP_500478.1| hypothetical protein C35B1.5 [Caenorhabditis elegans]
    MADLFAGKPLINQEGKELDGGDALRGKKVVALYFSAMWCGSCRQFTPKLKRFYEALKAAGKEIEVVLVSRDREAEDLLEY
    LGHGGDWVAIPFGDERIQEYLKKYEVPTIPAFKLINNAGELLHDARADVTERGKDDAVALFDEWVEKFPAN

    >gi|71991754|ref|NP_500578.2| hypothetical protein M01H9.1 [Caenorhabditis elegans]
    MAKNFFSGTSLRLKDGTMVDAGEHLKGKIVVLYFSASWCGPCRQFTPIMKELYQQIAATNQPIEVILLSRDYMRFQLDEY
    YESHGCSWGVVPLRDPIIEKCLEKYDVKALPSCRVVDEFGNCIDANARQSVEFYREKYKMAELFNKWTEKGNLERIRA

    >gi|71987380|ref|NP_500604.2| hypothetical protein F29B9.5 [Caenorhabditis elegans]
    MDLIIFFFPQLICILQLNHELFMSDSPTMSEFMKGVMLLKQDLTEVPAEEALKGKVVALYFSAGWCPPCKQFTPKLVRFY
    HHLKKAGKPIEVVFFSRDRSKADLEENFTEKHGDWLCVKYGDDILTRYQSKFEIKTIPVLRVINAAGKMVVVDGKSEVVD
    KGKADPQGLFAAWEAACNK

    >gi|17544108|ref|NP_500961.1| hypothetical protein Y73B6BL.12 [Caenorhabditis elegans]
    MSVIYNSSSMVQVISYKDFQNSDQSDEENDDSIIHVVKIVRKEPFAELKLTGTVEVKKSVIFGFEHIIIIGLLLDSVILI
    RSFRFGNDYPNHMWRNSDSIQRWVYNFLPTEVVSLGNDFHTTVLDSSEPWIVDFFAPW
    CGHCIQFAPIYDRIAKELAGKV
    NFAKIDCDQWPGVCQGAQVRAYPTIRLYTGKTGWSRQGDQGIGIGTQHKEQFIQIVRQQLKLDEHDEL

    >gi|71982272|ref|NP_501085.2| ThioRedoXin Reductase family member (trxr-1) [Caenorhabditis elegans]
    MKSLTELFGCFKRQPRQQEASSPANPHVSDTLSMGVAASGMPPPKRPAPAESPTLPGETLVDAPGIPLKEALKEAANSKI
    VIFYNSSDEEKQLVEFETYLNSLKEPADAEKPLEIPEIKKLQVSRASQKVIQYLTLHTSWPLMYIKGNAVGGLKELKALK
    QDYLKEWLRDHTYDLIVIGGGSGGLAAAKEASRLGKKVACLDFVKPSPQGTSWGLGGT
    CVNVGCIPKKLMHQASLLGHSI
    HDAKKYGWKLPEGKVEHQWNHLRDSVQDHIASLNWGYRVQLREKTVTYINSYGEFTGPFEISATNKKKKVEKLTADRFLI
    STGLRPKYPEIPGVKEYTITSDDLFQLPYSPGKTLCVGASYVSLECAGFLHGFGFDVTVMVRSILLRGFDQDMAERIRKH
    MIAYGMKFEAGVPTRIEQIDEKTDEKAGKYRVFWPKKNEETGEMQEVSEEYNTILMAIGREAVTDDVGLTTIGVERAKSK
    KVLGRREQSTTIPWVYAIGDVLEGTPELTPVAIQAGRVLMRRIFDGANELTEYDQIPTTVFTPLEYGCCGLSEEDAMMKY
    GKDNIIIYHNVFNPLEYTISERMDKDHCYLKMICLRNEEEKVVGFHILTPNAGEVTQGFGIALKLAAKKADFDRLIGIHP
    TVAENFTTLTLEKKEGDEELQASGC
    CG

    >gi|17538470|ref|NP_501303.1| hypothetical protein C06A6.5 [Caenorhabditis elegans]
    MNLASVLLLLAACHLSVSVNGQEHKEAIELSMANHDHVLGSAQVVFVAFCADWCPFSRRLKPIFEESARVFHQENPQASA
    VWAIVDSQRQADIGDKYFVNKYPTMKVFVNGELITKEYRSTRSVEALTNFVKFQLSTAINEFSSQDQLNQEMDKSKRNVV
    AWLKKDGPEFANLKKVASILREDCSFWVPTDHFGTQTNDNKLSFFDPDSNEEAKFTGNFNDYDFVKQWVTDKCIPLVREV
    TFENVEELTEEGMPFLIYFRDPDNKTTDKVFGEAVARELYDQRSAINPLLADGHKFAHPLKHLGKTKEDLPVLAIDSFQH
    MYLFPDMTQMNIPGKLREFVMDLHSGKLHKDFHENLDQRMIELAKAKAARGITDDHEAQAPSTRPIDTTPPPSVFKELKP
    SDKRYSILQKSEL

    >gi|17540408|ref|NP_501357.1| hypothetical protein F42G8.7 [Caenorhabditis elegans]
    MQVLNSYSICDFNFQLTFVAFTASWCPFSRKLMSSFSQAAADYQAKYPDRKTVWGNVDCMAEDYLMNKYSITKFPTMKVF
    FYGYMMTEYRGSRQVKGLIEYIEKMENTSSLVNLNEAESLTQWQNYVIPQKGTLILWFPRGSPPFELILKAIALIHSQLV
    VVVPISENLLKHEDHQLWFSLDGEHVERFEGSVSNFKEIVEWIKKKSAGMVRELTFENMEEMVEDGKPLLILLRKKDDIE
    TEKQFVTTIRRELDQDTLLKLAPVMADGKVLTAVLRHFNKGLDDLPFLLIDQFTHSFPSPWKGNEIFAEGNIKQVCMRKD
    YVFKNQEESRKSKIVEFWHCIIVLEIHNLNIFQFVADLFNDNHHRKLHEKLNELIQKIVTETEEIEKQASEEKVEKPTEK
    LEKHESVGWLIAQSEQTSGCPESFCLVDVNDNDVYHKSHIANAYHYDRIMLSRLVYETPILAQARAEGHLLVIYGREAER
    VAKVLFQRGFKTVLLKGNTAQFKEQYPCLLEPSIDFVKLKEIYEKKKNSVFGGRLWRSTSASRIKSVTRDERAEKSKKVN
    SRPTSQSRKPWL

    >gi|17540406|ref|NP_501359.1| hypothetical protein F42G8.6 [Caenorhabditis elegans]
    MNDDQWVAGISKKDAGRYSRQLLVDDFGVSGQKNLKNLNVLIVGAGGLGCPVATYLGAAGIGTIGIVDYDHISLDNLHRQ
    VAYKEDQVGKSKAQALADNIKLQNSDLNVQVHNTSLDSSNAMQLFKNYEIVCDCTDNVATRYLINDVCVLLNIPLVSGSA
    LRWDGQLSVYHYGSDCPCYRCLFPSPPDPNSVTN
    CNEGGVLGPIVGVIGSMQALEVMKIAAKVRTTLAGQLLLFDGREGK
    SRTIRLRKRDPKCEVCGDNPTITAPIDYVLFCGAGAHDKIENLKLLELSDRVNVTEYRNKRREQKPVLLDTRPSLEFEIA
    HLPEAINVTLKECRSLSAEDISNRLGLQNTEHSDVFVI
    CHRGNDSQRAVLLLREKLVDIKFRDIIGGYEQWALKINDMFP
    LY

    >gi|86565313|ref|NP_001033391.1| GLutaRedoXin family member (glrx-22) [Caenorhabditis elegans]
    MGGSASTPPKPTLSEHSKKIVEEVKEHAVVLYTKDGCGYCVKAKNELYEDGIHYTEKNLNTVSKVIPNPQEYIQGLMDLT
    RQRTVPQIFICGKFVGGYTELNALRPNLAKILETCSVDNGETLRREYASKI

    >gi|71993584|ref|NP_001023368.1| hypothetical protein T09A12.2 [Caenorhabditis elegans]
    MNGRSLIFSILFVFSELKCDDTDENDQHGTIYQFQAKNIDGKMVSMEKYRDKVVLFTNVASYCGYTDSNYNAFKELDGIY
    REKGFRVAAFPCNQFEKQEPETEGKILDFVKSSYTYAPDMYSKIEVNGQNTHPLWKFLKKERGSSLSADIPWNFSKFLVD
    KNGHVVGRYSHSVNPIDLEEEISRLLNS

    >gi|71993573|ref|NP_001023367.1| hypothetical protein T09A12.2 [Caenorhabditis elegans]
    MNGRSLIFSILFVFSELKCDDTDENDQHGTIYQFQAKNIDGKMVSMEKYRDKVVLFTNVASYCGYTDSNYNAFKELDGIY
    REKGFRVAAFPCNQFEKQEPETEGKILDFVKSSYTYAPDMYSKVR

    >gi|17543838|ref|NP_501461.1| hypothetical protein Y59H11AM.3 [Caenorhabditis elegans]
    MAVDMIVEPKWVVQNFGNIRILDASWTFKPKADIAEYKAKYYNKFGVGMNELKNPEYLAEHINGAAHFNFDIAYYPSENE
    RFTLYTPEEFSSYVKRLGVFNGDHLVIYGRGKDGGMAAASRAYWTFRYYGYTTVSVLNGGIEAFKLAQGVVQSGESMISS
    GNYEAKSVDNNILAKMADIPFDNLASIKYLDARSKEEFIGKVPIGYPDSKAEGVRCKDAIHFPIGEVCAAKGFKKKTDCD
    QAFAAKGIKVGDTVVIG
    CGIGLSASAIWLAAARSGIVAKLYNGGVHELAYKAPQHLNTKG

    >gi|17543836|ref|NP_501462.1| hypothetical protein Y59H11AM.2 [Caenorhabditis elegans]
    MAVDMIVEPKWVVQNFGNIRILDASWTFKPKADIAEYKAKYYNKFGVGMNELKNPEYLAEHINGAAHFNFDIAYYPSENE
    RFTLYTPEEFSSYVKRLGVFNGDHLVIYGRGKDGGMAAASRAYWTFRYYGYTTVSVLNGGIEAFKLAQGVVQSGESMISS
    GNYEAKSVDNNILAKMADIPFDNLASIKYLDARSKEEFIGKVPIGYPDSKAEGVRCKDAIHFPIGEVCAAKGFKKKTDCD
    QAFAAKGIKVGDTVVIG
    CGIGLSASAIWLAAARSGIVAKLYNGGVHELAYKAPQHLNTKG

    >gi|71985456|ref|NP_501568.2| hypothetical protein C53D6.4 [Caenorhabditis elegans]
    MLVQILFTFCIMMTTIQTIIDLREAKNRTFNQFVVDPNERTTNECLLEDPLQRALHIFLDTCPTFYDSICDDPLFNQYNE
    FEFRCRYPRNKIQVGGVDEFIKLFGINESTRYIRKRLVMFHSPS
    CPFSARLAPYFNEIAGSYTNILPVAIDASDFTKSHR
    LNFRYGVSGTPTILLWVNGMSVARMSNKKLDLESIKALIATHTDLVENKNGKNNQSFIPVKLENVGYEVKDVATEITENR
    LVNGLYIFACLLVCLATFIYHVRERILLSAPVLQWFQSKCGGPLCEDIYFLFYVAAPRNRHPPPAPQAPPEAAELPPLVI
    EDE

    >gi|86565431|ref|NP_001033404.1| UBA (human ubiquitin) related family member (uba-1) [Caenorhabditis elegans]
    MTTILELTSANKTNNKATNNKLQREGENEYPPAKRSKTDDEEEPTVVGNGTIVGAPKQQTLSGVNQSGNVNVETTKNTEG
    QDGEKMDTSNNAGGVGGNSDELLDKNLYSRQIYTLGESAMVNLRTASVLISGLGSVGVEIAKNLILGGVRHVTIHDTKLA
    KWSDLSAQYYLRDADVGHNRATSCYERLAELNDSVNVQVSTDELTEEFVKTFDLVVLTDAARTAQRQIAAWTRAHNRRIL
    ITDARGVFSYIFNDFGDNFRIDDATGEQVREFFIEHIDKTTGEVTTLENLFHGLEDGDHVTFSEVKGLTEINGCEPLKIT
    VKNASKFNIGDFAVSFSDYKEGGRCRQVKVPTSVSHVPFEKSLVEPEFGIWDYAKFEYPSQLHALWTALYAFEEKYGRSP
    APRSTQDAALLKELIPSGTEEIPEKLIELFSFSASGNLVTVSSVVGGIAAQEAMKGVTHHMTPLKQWLHLDHVEVLPGDW
    TSFDNSKLSETDCQPRQSRYDGQAAVFGWPYQECLFRQRWFVVGAGAIGCELLKNLSMMGVACGEGGLIKITDMDQIEIS
    NLNRQFLFRRRDVGGKKSECAARAVTAFNSDVRIEALAERVGLETEHIFNDEFFGELNGVANALDNVDARRYMDRRCVYY
    RLPLLESGTMGTKGNTQVVYPYLTESYSSSVDPPEKEIPV
    CTLKNFPNEIQHTIQWAREQFETFFAQPGEMANKFLSDER
    GFNEHVDKLISGQQIDILQKVKDALIDARPSSAEDCIRWARNQFQELYHNNIAQMLHSFPPDQLTDSGAKFWSGAKRCPH
    VLNFDPSKEEHFNFVFAASILIAELYGVQPILDREEVIRVALSVNPEPFEPKSGVKIAVTDAEAKEQNERGASSMIVDDD
    AAIEALKLKLATLNVKSTSKLNCVDFEKDDDSNHHMEFITAASNLRAENYDILPADRMRTKQIAGKIIPAIATTTAAVAG
    LVCIELYKVVDANGIPKTPMERFKNTFLNLSMPFFSSAEPIGAPKKTYMDREFTLWDRIDVQGPLTLQEFIDNVQNQTGG
    CEVSMLSAGACLLFSFFMNAGKKQERLKTEVKAVYEELLKKSLHPSVHALVLEPMMSDPDGEDVEVPYIRYSF

    >gi|86565433|ref|NP_001033405.1| UBA (human ubiquitin) related family member (uba-1) [Caenorhabditis elegans]
    MDTSNNAGGVGGNSDELLDKNLYSRQIYTLGESAMVNLRTASVLISGLGSVGVEIAKNLILGGVRHVTIHDTKLAKWSDL
    SAQYYLRDADVGHNRATSCYERLAELNDSVNVQVSTDELTEEFVKTFDLVVLTDAARTAQRQIAAWTRAHNRRILITDAR
    GVFSYIFNDFGDNFRIDDATGEQVREFFIEHIDKTTGEVTTLENLFHGLEDGDHVTFSEVKGLTEINGCEPLKITVKNAS
    KFNIGDFAVSFSDYKEGGRCRQVKVPTSVSHVPFEKSLVEPEFGIWDYAKFEYPSQLHALWTALYAFEEKYGRSPAPRST
    QDAALLKELIPSGTEEIPEKLIELFSFSASGNLVTVSSVVGGIAAQEAMKGVTHHMTPLKQWLHLDHVEVLPGDWTSFDN
    SKLSETDCQPRQSRYDGQAAVFGWPYQECLFRQRWFVVGAGAIGCELLKNLSMMGVACGEGGLIKITDMDQIEISNLNRQ
    FLFRRRDVGGKKSECAARAVTAFNSDVRIEALAERVGLETEHIFNDEFFGELNGVANALDNVDARRYMDRRCVYYRLPLL
    ESGTMGTKGNTQVVYPYLTESYSSSVDPPEKEIPV
    CTLKNFPNEIQHTIQWAREQFETFFAQPGEMANKFLSDERGFNEH
    VDKLISGQQIDILQKVKDALIDARPSSAEDCIRWARNQFQELYHNNIAQMLHSFPPDQLTDSGAKFWSGAKRCPHVLNFD
    PSKEEHFNFVFAASILIAELYGVQPILDREEVIRVALSVNPEPFEPKSGVKIAVTDAEAKEQNERGASSMIVDDDAAIEA
    LKLKLATLNVKSTSKLNCVDFEKDDDSNHHMEFITAASNLRAENYDILPADRMRTKQIAGKIIPAIATTTAAVAGLVCIE
    LYKVVDANGIPKTPMERFKNTFLNLSMPFFSSAEPIGAPKKTYMDREFTLWDRIDVQGPLTLQEFIDNVQNQTGGCEVSM
    LSAGACLLFSFFMNAGKKQERLKTEVKAVYEELLKKSLHPSVHALVLEPMMSDPDGEDVEVPYIRYSF

    >gi|17541894|ref|NP_501913.1| hypothetical protein R11A8.5 [Caenorhabditis elegans]
    MRFFGVRTVQIASLAGFSWGGSKLDDIQTAKLRTCPIQVQQPEKVQNDVLLSRKVINHLDKSNLKLRLYQYETCPFCCKV
    RAFLDYHGFSYEVVEVNPVTRSQIKFSTTYKKVPILRSGETTMTESTLIISTLATYLQRPDQSLDQIIQMYPAVDSTNEK
    GKPVLNYPNKFFVMKGKVDGDANMASAREEREWREWVDNWFIHLISPNVYRNWNESVETFRWFEQVGDWHRTFPAWERVL
    AVYVGAAAMFLLSKTLKKKHNINDEREELRKACRDWMAAIGPNRQFLGGDEPNLADLSLYGAMNSFYGCSAFKEVILEEK
    IAEWWRKMDALVKNHDGRKALESRSQK

    >gi|17540154|ref|NP_502314.1| hypothetical protein F35G2.1 [Caenorhabditis elegans]
    MRSPHGTVSTTTTISCLLFIAVLPVSIEAVQSTFNYVPIGQNPTLYTPGFEPIMHLDQMTFNDTVFSDRAFLVEFYADWC
    GHCRAFAPYFRQFANMVRDWYPVVTVAVINCADSFNQAACRENGVTYFPMMKYFARTATTATQGKLFETPHSAEQIRDAL
    LRTVSNEYMFNRYPDWPNLGHIAVDSRTTYGQLWDGVPQKANYMAILFEEYDGVGAQFVMDLISRSHILGARRALSNSPL
    VQMLNIRNFPTVALFRRDHQQALYMQRYTNQTVKDIDDAITNDMEQGGRRAPILTTTLAPVTTTTNTPLIDCHSHPERCR
    DMYYVSETDMLKAMRMALLDEVTRVPGAIRGDNFTNLHEFMTLLSNHFPVLSFQNDIRRMRAKRTTSVILRNSERARLVF
    THMREFLEGRKSIGSVSSDEYRRQFESVERVYASPFPVNSTWQHCKGSSPMYRGYTCGLWTTFHALTVHTYIDTIKDDYV
    NPMKPLSTIQGWVKSYFGCEHCRNHFMHMTTTLFPLNERRVRHPHDMMTYLWRAHNIVNNRLHGDSTEDPQFTKMQFPAP
    FLCPTCHSGGQFSRRQIRNFLLRYYGSIKPHNRLADQRLAF

    >gi|115533068|ref|NP_001041054.1| AlkylGuanine DNA alkylTransferase family member (agt-1) [Caenorhabditis elegans]
    MIIRECVYEVVETDQGQALIAECVGSQKVVAIYLLDDDLDDQMEELHDAYPTVNFIPGKPTQSSGIVQALNTLDSTIKVN
    AVHKGDTAFGMQVYSAIQKIPKGETRSYSDIAREIGNPSAVRAVASACARNNLAYIVP
    CHRVIGSTGNLSGYRWGIAKKR
    RLLQAEGAELRFSVM

    >gi|115533070|ref|NP_001041055.1| AlkylGuanine DNA alkylTransferase family member (agt-1) [Caenorhabditis elegans]
    MEELHDAYPTVNFIPGKPTQSSGIVQALNTLDSTIKVNAVHKGDTAFGMQVYSAIQKIPKGETRSYSDIAREIGNPSAVR
    AVASACARNNLAYIVP
    CHRVIGSTGNLSGYRWGIAKKRRLLQAEGAELRFSVM

    >gi|17543426|ref|NP_502604.1| SELD (SelD homolog) involved in selenophosphate synthesis family member (seld-1) [Caenorhabditis elegans]
    MNRIERILEGFDPVSNGLDEDFVLTKLTGMKGCGCKVPRNVLLQLLQTFKTDLVINNDEVDIGLDSCVIPLRHPGLRLVQ
    TTDFFYPLIDDPYIMGRVTCANVLSDLYAMGVSECDNMLMLLAVAIDLNEKQRDIVVPLFIQGFKDAADEAGTKIRGGQT
    VRCPWLLLGGVATSVAHESEIIKVDQAVPGDVLILTKPIGGQVAVNSYEWIKKKNGKIEELNLEIPKIEKAFKQVCEQMS
    RLNRNAAKLLHKYDAHSSTDVTGFGLLGHAENLARVQKQPMEFIIEKLPIIEYMDEIADKMIAKGGEGFKLYQGTSAETS
    GGLLIAMSEENAKKYIAELSSLDNAPAWIIGKVTAKTTDSSIARILPDAVRISVPSHI

    >gi|32565766|ref|NP_502753.2| hypothetical protein LLC1.3 [Caenorhabditis elegans]
    MSLSRTTQLPFAKRQFFQVLARNYSNTQDADLVVIGGGPGGYVAAIKAAQLGMKTVCVEKNATLGGTCLNVGCIPSKALL
    NNSHYLHMAQHDFAARGIDCTASLNLPKMMEAKSNSVKQLTGGIKQLFKANKVGHVEGFATIVGPNTVQAKKNDGSVETI
    NARNILIASGSEVTPFPGITIDEKQIVSSTGALSLGQVPKKMVVIGAGVIGLELGSVWQRLGAEVTAVEFLGHVGGMGID
    GEVSKNFQRSLTKQGFKFLLNTKVMGASQNGSTITVEVEGAKDGKKQTLECDTLLVSVGRRPYTEGLGLSNVQIDLDNRG
    RVPVNERFQTKVPSIFAIGDVIEGPMLAHKAEDEGILCVEGIAGGPVHIDYNCVPSVVYTHPEVAWVGKAEEQLKQEGVA
    YKIGKFPFVANSRAKTNNDQEGFVKVLADKQTDRMLGVHIIGPNAGEMIAEATLAMEYGASAEDVARVCHPHPTLSEAFR
    EANLAAYCGKAINNV

    >gi|17538896|ref|NP_503101.1| hypothetical protein C30H6.8 [Caenorhabditis elegans]
    MSPSLLGSSFLRSASGNFTKFASIRNAHFLSSVPMKKRGVDGNLPKDYFENKTVVVYFSAGWCGSCKFLTPKIKKFYNAV
    KESDAGKNLEIVWVSKDKEAAHQEEYYEKNLPDWPYIPFGDENIQKLSEKYKAVVIPVLKLVNSNGDVVHDRVRADVEAG
    IKADPVKTMEEWKKLLNQ

    >gi|25153934|ref|NP_503440.2| hypothetical protein K02H11.6 [Caenorhabditis elegans]
    MDILAGMKLEKLDKSLVDANEALAGKIVGIYFSAHWCGPCRNFTPVLKDFYEEVQDDFEIVFASSDQSESDLKNYMEECH
    GNWYYIPFGNDAEEKLSTKYDVSTIPTLIFLKPDGTEVTRYGRKDVEVGRKNPKEIVAKCLK

    >gi|17564844|ref|NP_503892.1| hypothetical protein T28A11.13 [Caenorhabditis elegans]
    MLDWTLVDATEALAGKIGGFYFSAHWCPPCCMFTPILKKFYEKVYDDFEIVFVSSDPSESGLKKYMQECHGDWYYIPFGH
    EAKQKLCVKYEITGMPTLVIVKPDGTEVKSDGRYDVQMETNP

    >gi|17564492|ref|NP_503954.1| hypothetical protein T20D4.7 [Caenorhabditis elegans]
    MFLFQLIYTFPEKNMDILAGMKLEKLDKSLVDATEALAGKLVGFYFSAHWCPPCRGFTPILKDFYEEVNEEFEIVFVSSD
    RSESDLKMYMKECHGDWYHIPHGNGAKQKLSTKYGVSGIPALIIVKPDGTEITRDGRKDVQMGTNPKAIIAKWKD

    >gi|17562972|ref|NP_504045.1| hypothetical protein R08E5.3 [Caenorhabditis elegans]
    MSQQQTCSTSMKEKLFNLAVSNVISNAINIGNRLNLFKTLADISSEKGPVLPEQLAEAAGCKERYIREWCNCMACGQIIE
    VNEEEKFWIAAENVQELSNSSFEAVMNGMMATLLEPLDELIDCFRKDGPLGLEYAQFTKFQYFMGTMSQALHEKHVVADM
    LPDIGNGVVEKLEAGGVRVLDVGCGGGFHSSLLAEQYPKSHFVGLDIGEDAIRQAKQRKTKSGAAFNNLEFIECDAGKMP
    EIWTDSFDLVLIFDACHDQRRPDLCVQEIHRVLKPSGMFAMVEVLGSSNVYTDKAAMGPLAAMMYGCSMFH
    CLPVGSNCP
    DALCYGAMWGQKRATDLLKKCGFPDVKVIDTPYFPINVMYCAQKN

    >gi|71988159|ref|NP_001023757.1| hypothetical protein D2063.3 [Caenorhabditis elegans]
    MPIQEIKSGEEVAAFIKEPSPAVLHFYASWAPSCEQVNQLLDDLLAEIALPLRAAFIDAEALPGISLNFKITAAPTLVFF
    SNGKEVDRIDGFVPKEIQSKVVLVASRSLSQSSSDASSTTSSTPSLTPQQEKEALNARLGALVNSQKVMVFMKGDPSAPR
    CGFSRTIVELLNSHKIKFGSFDIFSDEAVRQGLKEYSNWPTYPQLYFDGELIGGLDVVKEEFSDPQFIKQLPKVGENSEG
    GSLEDRLKKLVSSQRLMLFMKGDRETPK
    CGFSRTIVDLLNKARADYHTFDILEDEEVRNSPIGQLIHSSISTESSSEGLM
    SSRKSSWIRISFVRFQELEMIN

    >gi|71988153|ref|NP_001023756.1| hypothetical protein D2063.3 [Caenorhabditis elegans]
    MPIQEIKSGEEVAAFIKEPSPAVLHFYASWAPSCEQVNQLLDDLLAEIALPLRAAFIDAEALPGISLNFKITAAPTLVFF
    SNGKEVDRIDGFVPKEIQSKVVLVASRSLSQSSSDASSTTSSTPSLTPQQEKEALNARLGALVNSQKVMVFMKGDPSAPR
    CGFSRTIVELLNSHKIKFGSFDIFSDEAVRQGLKEYSNWPTYPQLYFDGELIGGLDVVKEEFSDPQFIKQLPKVGENSEG
    GSLEDRLKKLVSSQRLMLFMKGDRETPK
    CGFSRTIVDLLNKARADYHTFDILEDEEVRQGLKKFSNWPTYPQLYLDGELV
    GGLDVVKEELLDTHFLRQIPRIRND

    >gi|17559180|ref|NP_504655.1| DumPY : shorter than wild-type family member (dpy-11) [Caenorhabditis elegans]
    MLLRLLAVLGLFAVGVSGGPTRSSKLVFLNEENWTDLMKGEWMIEFHAPWCPACKDLQKAWNAFADWSDDLGIKVGEVDV
    TVNPGLSGRFLVTALPTIYHVKDGVFRQYSGARDKNDFISFVEDKKYRVIDPVPDYKHPNSKQMAVVAVFFKLSMSVRDL
    HNHLVEDKGIPSWASYGLFAGVTLALGCVLGFFIVIIIDQVFPTGPRKSQQAKKTEKKDAKKDSGTESPTKKNGNNNNGK
    ETKKTK

    >gi|212646193|ref|NP_505651.2| ThioRedoXin [see also xtr] family member (trx-2) [Caenorhabditis elegans]
    MQKALKLGSFFARSAISVKPTLATSKMTQLRHFSHGASVFDIDSVEDFTEKVIQSSVPVIVDFHAEWCGPCQALGPRLEE
    KVNGRQGSVLLAKINVDHAGELAMDYGISAVPTVFAFKNGEKISGFSGVLDDEQLDDFIEDVLAA

    >gi|71991980|ref|NP_505741.2| hypothetical protein F28H7.4 [Caenorhabditis elegans]
    MSRSGAIIIGLFFIASIFDVFRAEKEPPAEDSRLEDYLSSELETTAIPTVVNENSHSQDVVDSGFSKDLPKLTILYCVSC
    GYKQAFNQFYEFAKEKYPGLVIEGGNFSPDFWKGCLAQIVGVAKIGLIAIVITGSNPFEYIGFGYPQILQTAHYNRFSYS
    LLVFMIGNLFESTLSSTGAFEIFLGDKQIWSKISKERVPTQEEFLNLIDLQLKTIR

    >gi|17559150|ref|NP_505979.1| hypothetical protein D2023.5 [Caenorhabditis elegans]
    MSLKKIIDVKSVNTLLKKGIINKEGVRIIDCSFAVAPRPDWKEFEQEGYGDFKNLMAEPSPSRNLYLAGHIPEAVHVDLD
    IATYPSRYQRFQQYRADLFEEYAQMVGLNNKEHFIFYGKGAFGGMLFASKVAWIFKSYGHENISLVDGGFDSWKRNGFEV
    STELVKLPAGNFKAEDNFKKYVITFQELEAKKDGEDKQFIEKTSEINFLDSRIRGQFDGTQETGLDPHLVNGTRIAGFKN
    LPSAELLVKGGNLKSEEEIKSWLTQNGYVENQPTITS
    CNAGIQAALLAYVIDAVKPSQNPPRVYNGSLKEMELRAPKKIS
    EGPQHLPH

    >gi|115534702|ref|NP_506242.2| hypothetical protein R186.6 [Caenorhabditis elegans]
    MQKWSVGVRPKEYETKTVEDVYNTVEEVDGKEYEDPDYFYDELGRVRRSERRMAKKVPMMATPPPIPPPMTPTHIAIHNP
    KNSTSKRWKIACVSATVTLLAVFILATILSFFFFVSSSNTFQKESYGLPRPSMESSLLSKRSDMEMTPNHLLTLLITKRK
    ICILEAASGDEAKSRDAFSVDHIESARLIFHSNLSHAGVPVHPLQFQRFARSQGIDNDCHVIVYDRGQMIWSSYTVWIFK
    LFGHQKVSLLSGGYLGWKTHQARSGQYKTEQGDAPRKPRQGDFLASWNDSVIITYDDVLLNSEIDNFDVVDAQTKDEFLG
    TAQGALYGHIKGARNIPVDAVYDWAVGQWKDADHLKGLFNNNALSLRKPVIIY
    CSTSLRSAMVWWALTRSGYNGKIYFGG
    WPEWVVRAPDGLRVIGATTET

    >gi|17561888|ref|NP_506671.1| hypothetical protein H12D21.4 [Caenorhabditis elegans]
    MIIFWSLCIFLVAISSGSLGFTSANSIVTPQWLMQNFDNVRIIDASYVETAALNNAKFNTNHPEIIISDIKSPDLYTDEH
    IPGAVHFDLDIGSYSSEYIKHDLYPPEHFQKYLRLLGVNNGDQLVIYSNGPASGMKFASRAYWTFKMYGFTTVSLLNGGM
    DVWKAAGGPTDNAVVTPKLGNVNVKSLDNTILAKFEEIPFNNFAETNTVYLDTRIRAQFDGEDPLATNFPGTKAKGSHVT
    GAINFPMAKVIGPDGFISQQDVDEQISSLGLTSASQVFVG
    CNTGMQASVIFVALERSGFKAKLYNGSMFELSYRAPELVN
    ATGI

    >gi|71997283|ref|NP_506674.2| hypothetical protein H12D21.7 [Caenorhabditis elegans]
    MSTNPIVTPQWLMQNVNKVRLIDATYAPTATRDYKEFKTKCYGNFDLLTKNNTVAAYTGEHIPGAAHFGLDSAYFPSQYI
    KFDLYPPEHFEKYLRLLGINNDEQVVIYSRGPAAGMMFASRAYWTLKAYGLTNLSLLNGGLDAWKAAGGPTDNSVVTPKL
    GNVNVKSLDNTILAKFEEIPFNEFAENKVDYLDARTTPQFTGEEPLNKTFPDTKATGSHVTGAISFPMAKVIGPDGFISQ
    QDVDAQIANLGLKSGNQVYVA
    CNTGIQASVIFVALERSGIKAKLYNGSMTELASRAPELVNATGNN

    >gi|193207701|ref|NP_507142.2| Glutathione S-Transferase family member (gst-44) [Caenorhabditis elegans]
    MSVLEGINSKALKTGDLPPPSPSPNTFRIYSMRFCPAAQRALIYASVKKIPSEVININLQQKPDWYFTKNYKGQVPTLEH
    AEGKKLVIESAVIPEYLDDIFPETKILPSDPYEKVQQKLLLERLSDQLTPAFGRVFRAIKNPEELKEKFESILKAFEEAE
    SLLEGAFYSGTSSPGFVDYLIYPSFQRVYWLTFLLEIFPLPSDNFPGPGYPKLSQWFKAITAIPEVAAASQSTENGVGSC
    KEYMKGLPYFDYGL

    >gi|25146411|ref|NP_741696.1| hypothetical protein Y39B6A.3 [Caenorhabditis elegans]
    MSKFGGATAKVIKGALKVRQTRAALTLTNEAVSRIRVLLAQQNDANALKIGVRQKGCNGLTYTLEYAKDKQKFDEEVEQD
    GIKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI

    >gi|193209025|ref|NP_001123038.1| hypothetical protein Y39B6A.3 [Caenorhabditis elegans]
    MSKFGGATAKVIKGALKVRQTSFRAALTLTNEAVSRIRVLLAQQNDANALKIGVRQKGCNGLTYTLEYAKDKQKFDEEVE
    QDGIKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI

    >gi|17567971|ref|NP_508381.1| hypothetical protein F49H12.5 [Caenorhabditis elegans]
    MKLLLLSLLAVAVLAKKESKEEIKDLSHGYPSAIEWVEFDKAIGIAKDLNKPIFFLIHKTWCGACKSLKRELKSSPKTDE
    LIILSRKFVMVNVEDDEEPEDPKYSPDGGYIPRILFLDTDGNPLKTNNERKYKNNKYFYPLPAQIIDGMERALLEFGTDE
    EPAKGEVKSEKKEEKKEEAKKEEKKVEKKEEKKDKKKDEKKEEKKEKKEDKKKDEKKKDKKKEDKKDKKDKKDKKDKKDK
    KEKKDDKKSKKNKKEEL

    >gi|17569761|ref|NP_508419.1| hypothetical protein T10H10.2 [Caenorhabditis elegans]
    MFLLILLITPVLADIATYGYHPKGANPTLYSPEDSVLQLDEATFNDTIFGAQSGAAGYLVEFYSDWCGHCRAFAPTYKNL
    AKDVDGWQNIVKIAAINCADPVNEPVCRSNGVRFFPLIKYFPRDSLNSTEGSQIKPYSTVSEMRGQLTKAVMDDYALNRY
    PEWPTFDFLKDVVTYGELWNESSSSANHIAIIFETNQASLTGAQLLLDLSGNRDRLVARRCLKSHPLAEALKITDFPSLA
    IFKRGERKPVLIAELRRLLLREIDQFLGKPTDNHLQTIHFSSRKNKTIDCNKNPELCKPNYFVSEVDMLKAMRYALFRES
    ARTGAPLQAANLSALYEFTSLLADTFPTTTIEGASDNSTVLHLDRSSRAVRVFSRLRDFIAEKGLEAPISVEDWQKEFLA
    AEEEAGHPFPLNTNWEHCAGSSTQYRGYTCGLWTTFHALTVSAFKNWQNKTNDITLPLPPLQSIRDWVGSFFGCNHCRDH
    FLKMTTDTFKIEANVRRPEDVYLYLWKAHNKVNARLHGRETEDPKFPKYQFPAKFLCVDCNAKGFLNEDDTQPFLIDYYS
    RIRPFTNSTLIKSN

    >gi|17567817|ref|NP_508652.1| hypothetical protein F47B7.2 [Caenorhabditis elegans]
    MNEKEPGVAKSLCIAAVITGVFMLFILVVILAFSAGGSSGESLYDKDDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGA
    CIGYAPTFKKFAKQLEKWAPLVQVTVVNCADDKNMPLCREHSVSSYPSLRYFKYNSHNKDDGMKYSGDKYDINKLAHDIA
    GLAQADAQKQNPESWPTFLPLSDTTTLEEVFKSIGTTSYLAIVVQDSPSVIAWANLINYHGNNGVKVAYVTQNHPIATKF
    FSDGGVHALLFSNGNQEPLWKSSSPVDKWVDVQDKIDELIGDKIAASGPTVHPINAAPVIAAPSNPLNNQYEVQLVDLKS
    AMSYMLYKEIPRREEIRDEPMAVLKQWMHTLKKYAPGTTPMRRLFFRLDEWIQLQSVVTANEWITKVDEIQQALGNPLPK
    EITWMACAGSKPNLRGYTCGLWTLAHTITVEAYKQEKHNTAFKPVIDVLEPFRAFIFHFLS
    CSECAQNFTKEAEKNQLHL
    VTRPEDVYAWLWRVHNFVNKRLSGSLTDDPSFKKQQFPPKSLCADCYDANGDIDEAKALPFVFKYYSNIKTDSTDNLPGY
    KVVEYKEGKTLSAGQRHLNPKFQVHAGKVDQLEANDKVKNVLDASPQRTWKDIDGYDGLPDSGRSHYYFIFLSLIGVALI
    VIYCKYRKNRSKFWKTFYYKNDFKLCPWSSSPVKQNIV

    >gi|17567815|ref|NP_508653.1| hypothetical protein F47B7.2 [Caenorhabditis elegans]
    MNEKEPGVAKSLCIAAVITGVFMLFILVVILAFSAGGSSGESLYDKDDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGA
    CIGYAPTFKKFAKQLEKWAPLVQVTVVNCADDKNMPLCREHSVSSYPSLRYFKYNSHNKDDGMKYSGDKYDINKLAHDIA
    GLAQADAQKQNPESWPTFLPLSDTTTLEEVFKSIGTTSYLAIVVQDSPSVIAWANLINYHGNNGVKVAYVTQNHPIATKF
    FSDGGVHALLFSNGNQEPLWKSSSPVDKWVDVQDKIDELIGDKIAASGPTVHPINAAPVIAAPSNPLNNQYEVQLVDLKS
    AMSYMLYKEIPRREEIRDEPMAVLKQWMHTLKKYAPGTTPMRRLFFRLDEWIQLQSVVTANEWITKVDEIQQALGNPLPK
    EITWMACAGSKPNLRGYTCGLWTLAHTITVEAYKQEKHNTAFKPVIDVLEPFRAFIFHFLS
    CSECAQNFTKEAEKNQLHL
    VTRPEDVYAWLWRVHNFVNKRLSGSLTDDPSFKKQQFPPKSLCADCYDANGDIDEAKALPFVFKYYSNIKTDSTDNLPGY
    KVVEYKEGKTLSAGQRHLNPKFQVHAGKVDQLEANDKVKNVLDASPQRTWKDIDGYGVLGVPHR

    >gi|17567813|ref|NP_508654.1| hypothetical protein F47B7.2 [Caenorhabditis elegans]
    MNEKEPGVAKSLCIAAVITGVFMLFILVVILAFSAGGSSGESLYDKDDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGA
    CIGYAPTFKKFAKQLEKWAPLVQVTVVNCADDKNMPLCREHSVSSYPSLRYFKYNSHNKDDGMKYSGDKYDINKLAHDIA
    GLAQADAQKQNPESWPTFLPLSDTTTLEEVFKSIGTTSYLAIVVQDSPSVIAWANLINYHGNNGVKVAYVTQNHPIATKF
    FSDGGVHALLFSNGNQEPLWKSSSPVDKWVDVQDKIDELIGDKIAASGPTVHPINAAPVIAAPSNPLNNQYEVQLVDLKS
    AMSYMLYKEIPRREEIRDEPMAVLKQWMHTLKKYAPGTTPMRRLFFRLDEWIQLQSVVTANEWITKVDEIQQALGNPLPK
    EITWMACAGSKPNLRGYTCGLWTLAHTITVEAYKQEKHNTAFKPVIDVLEPFRAFIFHFLS
    CSECAQNFTKEAEKNQLHL
    VTRPEDVYAWLWRVHNFVNKRLSGSLTDDPSFKKQQFPPKSLCADCYDANGDIDEAKALPFVFKYYSNIKTDSTDNLPGY
    KVVEYKEGKTLSAGQRHLNPKFQVHAGKVDQLEANDKVKNVLDASPQRTWKDIDGYGKTRFWF

    >gi|32566189|ref|NP_872239.1| Protein Disulfide Isomerase family member (pdi-2) [Caenorhabditis elegans]
    MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGK
    LDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDT
    TSDDAKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENAR
    IMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQV
    ARDNTKNVLVEFYAPW
    CGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDR
    TIEGFTKFLETNGKEGAGASEEEKAEEEADEEGHTEL

    >gi|193209454|ref|NP_001123100.1| Protein Disulfide Isomerase family member (pdi-2) [Caenorhabditis elegans]
    MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGK
    LDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDT
    TSDDAKTFLEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDK
    NPVKILVGKNFEQVARDNTKNVLVEFYAPW
    CGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFF
    PAGSNKVVDYTGDRTIEGFTKFLETNGKEGAGASEEEKAEEEADEEGHTEL

    >gi|17569137|ref|NP_508778.1| Protein Disulfide Isomerase family member (pdi-2) [Caenorhabditis elegans]
    MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGK
    LDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDT
    TSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGEGIVLFKKFDDGRVAFDEKLTQDGLKTWIQANRLALVSEFTQET
    ASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDM
    TKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPW
    CGHCKQLA
    PTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEGAGASEEEK
    AEEEADEEGHTEL

    >gi|17549970|ref|NP_509190.1| Temporarily Assigned Gene name family member (tag-320) [Caenorhabditis elegans]
    MALIKLLLASLAITSVCGMYSKKDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASALKGVAKVGAV
    DMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAIADSVLAEAKKAVSARLGGKSSGSSSSGSGSGSGKRGGG
    GSGNEVVELTDANFEDLVLNSKDIWLVEFFAPW
    CGHCKSLEPQWKAAASELKGKVRLGALDATVHTVVANKFAIRGFPTI
    KYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQENMPAPEVFEGINQQVVEDACKEKQLCIFAFLPHILDCQSECRNNYL
    AMLKEQSEKFKKNLWGWIWVEGAAQPALEESFEVGGFGYPAMTALNFRKNKYAVLKGSFGKDGIHEFLRDLSYGKGRTSS
    LRGDGFPKIQKTEKWDGKDGALPAEDDIDLSDIDLDKTEL

    >gi|193210707|ref|NP_001123171.1| hypothetical protein R03G5.5 [Caenorhabditis elegans]
    MYVQKLVNDDNAFHFFISLLNQRLKIDMSTGTIYDFSVRDNSGDLVSLDKYSGLVVIIVNVASYCGLTNSNYKELKSLND
    KYHLRGLRVAAFPCNQFGFQEPHCEADINKFVNEKFSFEPDLYGKVTVNGGPLIGEEEPLWTFLKKEQGGTLFDAIKWNF
    TKFLVNRQGKVVARFGPSTNPKSFEEEIVKLLDENKL

    >gi|193210709|ref|NP_001123172.1| hypothetical protein R03G5.5 [Caenorhabditis elegans]
    MYVQKLVNDDNAFHFFISLLNQRLKIDMSTGTIYDFSVRDNSGDLVSLDKYSGLVVIIVNVASYCGLTNSNYKELKSLND
    KYHLRGLRVAAFPCNQFGFQACGLN

    >gi|193209493|ref|NP_509615.3| hypothetical protein C11E4.1 [Caenorhabditis elegans]
    MALWQLTFAALFAFVAAQPGPKMVDETTRWSQCKDTNQSIYDFQVETLQGEYTDLSQYRGQVLLMVNVATFCAYTQQYTD
    FNPLIEKYQSQGFTLIAFPCNQFYLQEPAENHELMNGIMYVRPGNGWKPHQNLHIYGKLDTNGDNQHPIYEFVKESCPQT
    VDKIGKTDELMYNPIRASDITWNFEKFLIDRNGQPRFRFHPTAWSHGDVVTPFIEQLLAEPAN

    >gi|17550320|ref|NP_509616.1| hypothetical protein C11E4.2 [Caenorhabditis elegans]
    MAPGSVLSLAVALATIIGISCTATVDETMRWKECLNTNQSIFDFQIETLQGEYTDLSQYRGKVILLVNVATFCAYTQQYT
    DFNPMLEKYQAQGLTLVAFPCNQFYLQEPAENHELMNGLTYVRPGNGWTPHQELHIYGKIDVNGDNHHPLYEFVKESCPQ
    TVDKIGKTDELMYNPVRPSDITWNFEKFLIDRNGQPRFRFHPTAWSHGDVVTPFIEQLLAEPAN

    >gi|17550840|ref|NP_509930.1| hypothetical protein C35C5.3 [Caenorhabditis elegans]
    MRIHDELQKQDMSRFGVFIIGVLFFMSVCDVLRTEEHSHDENHVHEKDDFEAEFGDETDSQSFSQGTEEDHIEVREQSSF
    VKPTAVHHAKDLPTLRIFYCVS
    CGYKQAFDQFTTFAKEKYPNMPIEGANFAPVLWKAYVAQALSFVKMAVLVLVLGGINP
    FERFGLGYPQILQHAHGNKMSSCMLVFMLGNLVEQSLISTGAFEVYLGNEQIWSKIESGRVPSPQEFMQLIDAQLAVLGK
    APVNTESFGEFQQTV

    >gi|17550842|ref|NP_509929.1| hypothetical protein C35C5.3 [Caenorhabditis elegans]
    MRIHDELQKQDMSRFGVFIIGVLFFMSVCDVLRTVSAEEHSHDENHVHEKDDFEAEFGDETDSQSFSQGTEEDHIEVREQ
    SSFVKPTAVHHAKDLPTLRIFYCVS
    CGYKQAFDQFTTFAKEKYPNMPIEGANFAPVLWKAYVAQALSFVKMAVLVLVLGG
    INPFERFGLGYPQILQHAHGNKMSSCMLVFMLGNLVEQSLISTGAFEVYLGNEQIWSKIESGRVPSPQEFMQLIDAQLAV
    LGKAPVNTESFGEFQQTV

    >gi|17551302|ref|NP_509962.1| Glutathione S-Transferase family member (gst-42) [Caenorhabditis elegans]
    MSNQKPVLYSYWRSSCSWRVRIALALKNVDYEYKTVDLLSEEAKSKLKEINPAAKVPTFVVDGQVITESLAIIEYLEETH
    PDVPLLPKDPIKRAHARAISLLVASGIQPLHNLKVLQLLNKKEAGFGGQFAKQFVVEGLTALEILLKQHSGKYAVGDDVT
    IADLSIPPLIYSANRFNLDLSPYPTVNRINETLADIPAFIAAHPDNQPDTGLNA

    >gi|25147337|ref|NP_510815.2| hypothetical protein F10D7.3 [Caenorhabditis elegans]
    MLRILTVVLALVTIATVHAELSKKKEDKTLKDLEDKIVNDVMTHKVMVYSKTYCPWSKRLKAILANYEIDDMKIVELDRS
    NQTEEMQEILKKYSGRTTVPQLFISGKFVGGHDETKAIEEKGELRPLLEKAHALFTNRVPVPDNGA

    >gi|25144390|ref|NP_491903.2| hypothetical protein D2092.4 [Caenorhabditis elegans]
    MKTSSFLTLITVSVIFLVFLSTHVDAKKKDKNLKVTVADDVAPPAPAKKSKKSAVKEAPAPPPKALSSKHKDDDNSIDDV
    DEDRIDEILRDASKNLVIFLYDGKVP
    CPTCTEALSEVEEIDDDIEATGYVQVVKTNDRSVARELGINVFPSLVYYRRKNP
    ILYDGDFKDSETLLRWLRAHEEVATWDLTDDTFESRTDSHSPDEGSIDWFVMFYDADEGNSNAFVPLWETVAHKLRGLVN
    VGKIEISVNDDVTERFHIEERDCPVFLLFHRGKMYRYKESAKDARSLTNFALHKYKEQRGHRVPEPPTAIEQVYEFAKEK
    IMDIMDDNQTLSVLGVGGLIVIVAVTLIIKAYRIRAENKNKVA